Sideway from Sideway

Service and Port Number

Draft for Information Only


 Service Name and Transport Protocol Port Number Registry
 Table of Service Name and Transport Protocol Port Number Registry

Service Name and Transport Protocol Port Number Registry

Last updated: 22 Nov 2018


Table of Service Name and Transport Protocol Port Number Registry

Transport Protocol
DescriptionService NameLast Update
0 tcpReservedN/Alast updated 2018/11/270 udpReservedN/Alast updated 2018/11/271 tcpTCP Port Service Multiplexertcpmuxlast updated 2018/11/271 udpTCP Port Service Multiplexertcpmuxlast updated 2018/11/272 tcpManagement Utilitycompressnetlast updated 2018/11/272 udpManagement Utilitycompressnetlast updated 2018/11/273 tcpCompression Processcompressnetlast updated 2018/11/273 udpCompression Processcompressnetlast updated 2018/11/274 tcpUnassignedN/Alast updated 2018/11/274 udpUnassignedN/Alast updated 2018/11/275 tcpRemote Job Entryrjelast updated 2018/11/275 udpRemote Job Entryrjelast updated 2018/11/276 tcpUnassignedN/Alast updated 2018/11/276 udpUnassignedN/Alast updated 2018/11/277 tcpEchoecholast updated 2018/11/277 udpEchoecholast updated 2018/11/278 tcpUnassignedN/Alast updated 2018/11/278 udpUnassignedN/Alast updated 2018/11/279 tcpDiscarddiscardlast updated 2018/11/279 udpDiscarddiscardlast updated 2018/11/279 sctpDiscarddiscardlast updated 2018/11/279 dccpDiscarddiscardlast updated 2018/11/2710 tcpUnassignedN/Alast updated 2018/11/2710 udpUnassignedN/Alast updated 2018/11/2711 tcpActive Userssystatlast updated 2018/11/2711 udpActive Userssystatlast updated 2018/11/2712 tcpUnassignedN/Alast updated 2018/11/2712 udpUnassignedN/Alast updated 2018/11/2713 tcpDaytimedaytimelast updated 2018/11/2713 udpDaytimedaytimelast updated 2018/11/2714 tcpUnassignedN/Alast updated 2018/11/2714 udpUnassignedN/Alast updated 2018/11/2715 tcpUnassigned [was netstat]N/Alast updated 2018/11/2715 udpUnassignedN/Alast updated 2018/11/2716 tcpUnassignedN/Alast updated 2018/11/2716 udpUnassignedN/Alast updated 2018/11/2717 tcpQuote of the Dayqotdlast updated 2018/11/2717 udpQuote of the Dayqotdlast updated 2018/11/2718 tcpMessage Send Protocol (historic)msplast updated 2018/11/2718 udpMessage Send Protocol (historic)msplast updated 2018/11/2719 tcpCharacter Generatorchargenlast updated 2018/11/2719 udpCharacter Generatorchargenlast updated 2018/11/2720 tcpFile Transfer [Default Data]ftp-datalast updated 2018/11/2720 udpFile Transfer [Default Data]ftp-datalast updated 2018/11/2720 sctpFTPftp-datalast updated 2018/11/2721 tcpFile Transfer Protocol [Control]ftplast updated 2018/11/2721 udpFile Transfer Protocol [Control]ftplast updated 2018/11/2721 sctpFTPftplast updated 2018/11/2722 tcpThe Secure Shell (SSH) Protocolsshlast updated 2018/11/2722 udpThe Secure Shell (SSH) Protocolsshlast updated 2018/11/2722 sctpSSHsshlast updated 2018/11/2723 tcpTelnettelnetlast updated 2018/11/2723 udpTelnettelnetlast updated 2018/11/2724 tcpany private mail systemN/Alast updated 2018/11/2724 udpany private mail systemN/Alast updated 2018/11/2725 tcpSimple Mail Transfersmtplast updated 2018/11/2725 udpSimple Mail Transfersmtplast updated 2018/11/2726 tcpUnassignedN/Alast updated 2018/11/2726 udpUnassignedN/Alast updated 2018/11/2727 tcpNSW User System FEnsw-felast updated 2018/11/2727 udpNSW User System FEnsw-felast updated 2018/11/2728 tcpUnassignedN/Alast updated 2018/11/2728 udpUnassignedN/Alast updated 2018/11/2729 tcpMSG ICPmsg-icplast updated 2018/11/2729 udpMSG ICPmsg-icplast updated 2018/11/2730 tcpUnassignedN/Alast updated 2018/11/2730 udpUnassignedN/Alast updated 2018/11/2731 tcpMSG Authenticationmsg-authlast updated 2018/11/2731 udpMSG Authenticationmsg-authlast updated 2018/11/2732 tcpUnassignedN/Alast updated 2018/11/2732 udpUnassignedN/Alast updated 2018/11/2733 tcpDisplay Support Protocoldsplast updated 2018/11/2733 udpDisplay Support Protocoldsplast updated 2018/11/2734 tcpUnassignedN/Alast updated 2018/11/2734 udpUnassignedN/Alast updated 2018/11/2735 tcpany private printer serverN/Alast updated 2018/11/2735 udpany private printer serverN/Alast updated 2018/11/2736 tcpUnassignedN/Alast updated 2018/11/2736 udpUnassignedN/Alast updated 2018/11/2737 tcpTimetimelast updated 2018/11/2737 udpTimetimelast updated 2018/11/2738 tcpRoute Access Protocolraplast updated 2018/11/2738 udpRoute Access Protocolraplast updated 2018/11/2739 tcpResource Location Protocolrlplast updated 2018/11/2739 udpResource Location Protocolrlplast updated 2018/11/2740 tcpUnassignedN/Alast updated 2018/11/2740 udpUnassignedN/Alast updated 2018/11/2741 tcpGraphicsgraphicslast updated 2018/11/2741 udpGraphicsgraphicslast updated 2018/11/2742 tcp (name)Host Name Servernamelast updated 2018/11/2742 udp (name)Host Name Servernamelast updated 2018/11/2742 tcpHost Name Servernameserverlast updated 2018/11/2742 udpHost Name Servernameserverlast updated 2018/11/2743 tcpWho Isnicnamelast updated 2018/11/2743 udpWho Isnicnamelast updated 2018/11/2744 tcpMPM FLAGS Protocolmpm-flagslast updated 2018/11/2744 udpMPM FLAGS Protocolmpm-flagslast updated 2018/11/2745 tcpMessage Processing Module [recv]mpmlast updated 2018/11/2745 udpMessage Processing Module [recv]mpmlast updated 2018/11/2746 tcpMPM [default send]mpm-sndlast updated 2018/11/2746 udpMPM [default send]mpm-sndlast updated 2018/11/2747 tcpReservedN/Alast updated 2018/11/2747 udpReservedN/Alast updated 2018/11/2748 tcpDigital Audit Daemonauditdlast updated 2018/11/2748 udpDigital Audit Daemonauditdlast updated 2018/11/2749 tcpLogin Host Protocol (TACACS)tacacslast updated 2018/11/2749 udpLogin Host Protocol (TACACS)tacacslast updated 2018/11/2750 tcpRemote Mail Checking Protocolre-mail-cklast updated 2018/11/2750 udpRemote Mail Checking Protocolre-mail-cklast updated 2018/11/2751 ReservedN/Alast updated 2018/11/2752 tcpXNS Time Protocolxns-timelast updated 2018/11/2752 udpXNS Time Protocolxns-timelast updated 2018/11/2753 tcpDomain Name Serverdomainlast updated 2018/11/2753 udpDomain Name Serverdomainlast updated 2018/11/2754 tcpXNS Clearinghousexns-chlast updated 2018/11/2754 udpXNS Clearinghousexns-chlast updated 2018/11/2755 tcpISI Graphics Languageisi-gllast updated 2018/11/2755 udpISI Graphics Languageisi-gllast updated 2018/11/2756 tcpXNS Authenticationxns-authlast updated 2018/11/2756 udpXNS Authenticationxns-authlast updated 2018/11/2757 tcpany private terminal accessN/Alast updated 2018/11/2757 udpany private terminal accessN/Alast updated 2018/11/2758 tcpXNS Mailxns-maillast updated 2018/11/2758 udpXNS Mailxns-maillast updated 2018/11/2759 tcpany private file serviceN/Alast updated 2018/11/2759 udpany private file serviceN/Alast updated 2018/11/2760 tcpUnassignedN/Alast updated 2018/11/2760 udpUnassignedN/Alast updated 2018/11/2761 tcpReservedN/Alast updated 2018/11/2761 udpReservedN/Alast updated 2018/11/2762 tcpACA Servicesacaslast updated 2018/11/2762 udpACA Servicesacaslast updated 2018/11/2763 tcpwhois++ IANA assigned this well-formed service name as a replacement for "whois++".whoispplast updated 2018/11/2763 tcp (whois++)whois++whois++last updated 2018/11/2763 udpwhois++ IANA assigned this well-formed service name as a replacement for "whois++".whoispplast updated 2018/11/2763 udp (whois++)whois++whois++last updated 2018/11/2764 tcpCommunications Integrator (CI)covialast updated 2018/11/2764 udpCommunications Integrator (CI)covialast updated 2018/11/2765 tcpTACACS-Database Servicetacacs-dslast updated 2018/11/2765 udpTACACS-Database Servicetacacs-dslast updated 2018/11/2766 tcpOracle SQL*NET IANA assigned this well-formed service name as a replacement for "sql*net".sql-netlast updated 2018/11/2766 tcp (sql*net)Oracle SQL*NETsql*netlast updated 2018/11/2766 udpOracle SQL*NET IANA assigned this well-formed service name as a replacement for "sql*net".sql-netlast updated 2018/11/2766 udp (sql*net)Oracle SQL*NETsql*netlast updated 2018/11/2767 tcpBootstrap Protocol Serverbootpslast updated 2018/11/2767 udpBootstrap Protocol Serverbootpslast updated 2018/11/2768 tcpBootstrap Protocol Clientbootpclast updated 2018/11/2768 udpBootstrap Protocol Clientbootpclast updated 2018/11/2769 tcpTrivial File Transfertftplast updated 2018/11/2769 udpTrivial File Transfertftplast updated 2018/11/2770 tcpGophergopherlast updated 2018/11/2770 udpGophergopherlast updated 2018/11/2771 tcpRemote Job Servicenetrjs-1last updated 2018/11/2771 udpRemote Job Servicenetrjs-1last updated 2018/11/2772 tcpRemote Job Servicenetrjs-2last updated 2018/11/2772 udpRemote Job Servicenetrjs-2last updated 2018/11/2773 tcpRemote Job Servicenetrjs-3last updated 2018/11/2773 udpRemote Job Servicenetrjs-3last updated 2018/11/2774 tcpRemote Job Servicenetrjs-4last updated 2018/11/2774 udpRemote Job Servicenetrjs-4last updated 2018/11/2775 tcpany private dial out serviceN/Alast updated 2018/11/2775 udpany private dial out serviceN/Alast updated 2018/11/2776 tcpDistributed External Object Storedeoslast updated 2018/11/2776 udpDistributed External Object Storedeoslast updated 2018/11/2777 tcpany private RJE serviceN/Alast updated 2018/11/2777 udpany private RJE serviceN/Alast updated 2018/11/2778 tcpvettcpvettcplast updated 2018/11/2778 udpvettcpvettcplast updated 2018/11/2779 tcpFingerfingerlast updated 2018/11/2779 udpFingerfingerlast updated 2018/11/2780 tcpWorld Wide Web HTTPhttplast updated 2018/11/2780 udpWorld Wide Web HTTPhttplast updated 2018/11/2780 tcp (www)World Wide Web HTTPwwwlast updated 2018/11/2780 udp (www)World Wide Web HTTPwwwlast updated 2018/11/2780 tcp (www-http)World Wide Web HTTPwww-httplast updated 2018/11/2780 udp (www-http)World Wide Web HTTPwww-httplast updated 2018/11/2780 sctpHTTPhttplast updated 2018/11/2781 UnassignedN/Alast updated 2018/11/2782 tcpXFER Utilityxferlast updated 2018/11/2782 udpXFER Utilityxferlast updated 2018/11/2783 tcpMIT ML Devicemit-ml-devlast updated 2018/11/2783 udpMIT ML Devicemit-ml-devlast updated 2018/11/2784 tcpCommon Trace Facilityctflast updated 2018/11/2784 udpCommon Trace Facilityctflast updated 2018/11/2785 tcpMIT ML Devicemit-ml-devlast updated 2018/11/2785 udpMIT ML Devicemit-ml-devlast updated 2018/11/2786 tcpMicro Focus Cobolmfcobollast updated 2018/11/2786 udpMicro Focus Cobolmfcobollast updated 2018/11/2787 tcpany private terminal linkN/Alast updated 2018/11/2787 udpany private terminal linkN/Alast updated 2018/11/2788 tcpKerberoskerberoslast updated 2018/11/2788 udpKerberoskerberoslast updated 2018/11/2789 tcpSU/MIT Telnet Gatewaysu-mit-tglast updated 2018/11/2789 udpSU/MIT Telnet Gatewaysu-mit-tglast updated 2018/11/2790 tcpDNSIX Securit Attribute Token Mapdnsixlast updated 2018/11/2790 udpDNSIX Securit Attribute Token Mapdnsixlast updated 2018/11/2791 tcpMIT Dover Spoolermit-dovlast updated 2018/11/2791 udpMIT Dover Spoolermit-dovlast updated 2018/11/2792 tcpNetwork Printing Protocolnpplast updated 2018/11/2792 udpNetwork Printing Protocolnpplast updated 2018/11/2793 tcpDevice Control Protocoldcplast updated 2018/11/2793 udpDevice Control Protocoldcplast updated 2018/11/2794 tcpTivoli Object Dispatcherobjcalllast updated 2018/11/2794 udpTivoli Object Dispatcherobjcalllast updated 2018/11/2795 tcpSUPDUPsupduplast updated 2018/11/2795 udpSUPDUPsupduplast updated 2018/11/2796 tcpDIXIE Protocol Specificationdixielast updated 2018/11/2796 udpDIXIE Protocol Specificationdixielast updated 2018/11/2797 tcpSwift Remote Virtural File Protocolswift-rvflast updated 2018/11/2797 udpSwift Remote Virtural File Protocolswift-rvflast updated 2018/11/2798 tcpTAC Newstacnewslast updated 2018/11/2798 udpTAC Newstacnewslast updated 2018/11/2799 tcpMetagram Relaymetagramlast updated 2018/11/2799 udpMetagram Relaymetagramlast updated 2018/11/27100 UnassignedN/Alast updated 2018/11/27101 tcpNIC Host Name Serverhostnamelast updated 2018/11/27101 udpNIC Host Name Serverhostnamelast updated 2018/11/27102 tcpISO-TSAP Class 0iso-tsaplast updated 2018/11/27102 udpISO-TSAP Class 0iso-tsaplast updated 2018/11/27103 tcpGenesis Point-to-Point Trans Netgppitnplast updated 2018/11/27103 udpGenesis Point-to-Point Trans Netgppitnplast updated 2018/11/27104 tcpACR-NEMA Digital Imag. & Comm. 300acr-nemalast updated 2018/11/27104 udpACR-NEMA Digital Imag. & Comm. 300acr-nemalast updated 2018/11/27105 tcp (cso)CCSO name server protocolcsolast updated 2018/11/27105 udp (cso)CCSO name server protocolcsolast updated 2018/11/27105 tcp (csnet)Mailbox Name Nameservercsnet-nslast updated 2018/11/27105 udp (csnet)Mailbox Name Nameservercsnet-nslast updated 2018/11/27106 tcp3COM-TSMUX3com-tsmuxlast updated 2018/11/27106 udp3COM-TSMUX3com-tsmuxlast updated 2018/11/27107 tcpRemote Telnet Servicertelnetlast updated 2018/11/27107 udpRemote Telnet Servicertelnetlast updated 2018/11/27108 tcpSNA Gateway Access Serversnagaslast updated 2018/11/27108 udpSNA Gateway Access Serversnagaslast updated 2018/11/27109 tcpPost Office Protocol - Version 2pop2last updated 2018/11/27109 udpPost Office Protocol - Version 2pop2last updated 2018/11/27110 tcpPost Office Protocol - Version 3pop3last updated 2018/11/27110 udpPost Office Protocol - Version 3pop3last updated 2018/11/27111 tcpSUN Remote Procedure Callsunrpclast updated 2018/11/27111 udpSUN Remote Procedure Callsunrpclast updated 2018/11/27112 tcpMcIDAS Data Transmission Protocolmcidaslast updated 2018/11/27112 udpMcIDAS Data Transmission Protocolmcidaslast updated 2018/11/27113 tcp (ident)identlast updated 2018/11/27113 tcpAuthentication Serviceauthlast updated 2018/11/27113 udpAuthentication Serviceauthlast updated 2018/11/27114 unassignedN/Alast updated 2018/11/27115 tcpSimple File Transfer Protocolsftplast updated 2018/11/27115 udpSimple File Transfer Protocolsftplast updated 2018/11/27116 tcpANSA REX Notifyansanotifylast updated 2018/11/27116 udpANSA REX Notifyansanotifylast updated 2018/11/27117 tcpUUCP Path Serviceuucp-pathlast updated 2018/11/27117 udpUUCP Path Serviceuucp-pathlast updated 2018/11/27118 tcpSQL Servicessqlservlast updated 2018/11/27118 udpSQL Servicessqlservlast updated 2018/11/27119 tcpNetwork News Transfer Protocolnntplast updated 2018/11/27119 udpNetwork News Transfer Protocolnntplast updated 2018/11/27120 tcpCFDPTKTcfdptktlast updated 2018/11/27120 udpCFDPTKTcfdptktlast updated 2018/11/27121 tcpEncore Expedited Remote Pro.Callerpclast updated 2018/11/27121 udpEncore Expedited Remote Pro.Callerpclast updated 2018/11/27122 tcpSMAKYNETsmakynetlast updated 2018/11/27122 udpSMAKYNETsmakynetlast updated 2018/11/27123 tcpNetwork Time Protocolntplast updated 2018/11/27123 udpNetwork Time Protocolntplast updated 2018/11/27124 tcpANSA REX Traderansatraderlast updated 2018/11/27124 udpANSA REX Traderansatraderlast updated 2018/11/27125 tcpLocus PC-Interface Net Map Serlocus-maplast updated 2018/11/27125 udpLocus PC-Interface Net Map Serlocus-maplast updated 2018/11/27126 tcpNXEditnxeditlast updated 2018/11/27126 udpNXEditnxeditlast updated 2018/11/27127 tcpLocus PC-Interface Conn Serverlocus-conlast updated 2018/11/27127 udpLocus PC-Interface Conn Serverlocus-conlast updated 2018/11/27128 tcpGSS X License Verificationgss-xlicenlast updated 2018/11/27128 udpGSS X License Verificationgss-xlicenlast updated 2018/11/27129 tcpPassword Generator Protocolpwdgenlast updated 2018/11/27129 udpPassword Generator Protocolpwdgenlast updated 2018/11/27130 tcpcisco FNATIVEcisco-fnalast updated 2018/11/27130 udpcisco FNATIVEcisco-fnalast updated 2018/11/27131 tcpcisco TNATIVEcisco-tnalast updated 2018/11/27131 udpcisco TNATIVEcisco-tnalast updated 2018/11/27132 tcpcisco SYSMAINTcisco-syslast updated 2018/11/27132 udpcisco SYSMAINTcisco-syslast updated 2018/11/27133 tcpStatistics Servicestatsrvlast updated 2018/11/27133 udpStatistics Servicestatsrvlast updated 2018/11/27134 tcpINGRES-NET Serviceingres-netlast updated 2018/11/27134 udpINGRES-NET Serviceingres-netlast updated 2018/11/27135 tcpDCE endpoint resolutionepmaplast updated 2018/11/27135 udpDCE endpoint resolutionepmaplast updated 2018/11/27136 tcpPROFILE Naming Systemprofilelast updated 2018/11/27136 udpPROFILE Naming Systemprofilelast updated 2018/11/27137 tcpNETBIOS Name Servicenetbios-nslast updated 2018/11/27137 udpNETBIOS Name Servicenetbios-nslast updated 2018/11/27138 tcpNETBIOS Datagram Servicenetbios-dgmlast updated 2018/11/27138 udpNETBIOS Datagram Servicenetbios-dgmlast updated 2018/11/27139 tcpNETBIOS Session Servicenetbios-ssnlast updated 2018/11/27139 udpNETBIOS Session Servicenetbios-ssnlast updated 2018/11/27140 tcpEMFIS Data Serviceemfis-datalast updated 2018/11/27140 udpEMFIS Data Serviceemfis-datalast updated 2018/11/27141 tcpEMFIS Control Serviceemfis-cntllast updated 2018/11/27141 udpEMFIS Control Serviceemfis-cntllast updated 2018/11/27142 tcpBritton-Lee IDMbl-idmlast updated 2018/11/27142 udpBritton-Lee IDMbl-idmlast updated 2018/11/27143 tcpInternet Message Access Protocolimaplast updated 2018/11/27143 udpInternet Message Access Protocolimaplast updated 2018/11/27144 tcpUniversal Management Architectureumalast updated 2018/11/27144 udpUniversal Management Architectureumalast updated 2018/11/27145 tcpUAAC Protocoluaaclast updated 2018/11/27145 udpUAAC Protocoluaaclast updated 2018/11/27146 tcpISO-IP0iso-tp0last updated 2018/11/27146 udpISO-IP0iso-tp0last updated 2018/11/27147 tcpISO-IPiso-iplast updated 2018/11/27147 udpISO-IPiso-iplast updated 2018/11/27148 tcpJargonjargonlast updated 2018/11/27148 udpJargonjargonlast updated 2018/11/27149 tcpAED 512 Emulation Serviceaed-512last updated 2018/11/27149 udpAED 512 Emulation Serviceaed-512last updated 2018/11/27150 tcpSQL-NETsql-netlast updated 2018/11/27150 udpSQL-NETsql-netlast updated 2018/11/27151 tcpHEMShemslast updated 2018/11/27151 udpHEMShemslast updated 2018/11/27152 tcpBackground File Transfer Programbftplast updated 2018/11/27152 udpBackground File Transfer Programbftplast updated 2018/11/27153 tcpSGMPsgmplast updated 2018/11/27153 udpSGMPsgmplast updated 2018/11/27154 tcpNETSCnetsc-prodlast updated 2018/11/27154 udpNETSCnetsc-prodlast updated 2018/11/27155 tcpNETSCnetsc-devlast updated 2018/11/27155 udpNETSCnetsc-devlast updated 2018/11/27156 tcpSQL Servicesqlsrvlast updated 2018/11/27156 udpSQL Servicesqlsrvlast updated 2018/11/27157 tcpKNET/VM Command/Message Protocolknet-cmplast updated 2018/11/27157 udpKNET/VM Command/Message Protocolknet-cmplast updated 2018/11/27158 tcpPCMail Serverpcmail-srvlast updated 2018/11/27158 udpPCMail Serverpcmail-srvlast updated 2018/11/27159 tcpNSS-Routingnss-routinglast updated 2018/11/27159 udpNSS-Routingnss-routinglast updated 2018/11/27160 tcpSGMP-TRAPSsgmp-trapslast updated 2018/11/27160 udpSGMP-TRAPSsgmp-trapslast updated 2018/11/27161 tcpSNMPsnmplast updated 2018/11/27161 udpSNMPsnmplast updated 2018/11/27162 tcpSNMPTRAPsnmptraplast updated 2018/11/27162 udpSNMPTRAPsnmptraplast updated 2018/11/27163 tcpCMIP/TCP Managercmip-manlast updated 2018/11/27163 udpCMIP/TCP Managercmip-manlast updated 2018/11/27164 tcpCMIP/TCP Agentcmip-agentlast updated 2018/11/27164 udpCMIP/TCP Agentcmip-agentlast updated 2018/11/27165 tcpXeroxxns-courierlast updated 2018/11/27165 udpXeroxxns-courierlast updated 2018/11/27166 tcpSirius Systemss-netlast updated 2018/11/27166 udpSirius Systemss-netlast updated 2018/11/27167 tcpNAMPnamplast updated 2018/11/27167 udpNAMPnamplast updated 2018/11/27168 tcpRSVDrsvdlast updated 2018/11/27168 udpRSVDrsvdlast updated 2018/11/27169 tcpSENDsendlast updated 2018/11/27169 udpSENDsendlast updated 2018/11/27170 tcpNetwork PostScriptprint-srvlast updated 2018/11/27170 udpNetwork PostScriptprint-srvlast updated 2018/11/27171 tcpNetwork Innovations Multiplexmultiplexlast updated 2018/11/27171 udpNetwork Innovations Multiplexmultiplexlast updated 2018/11/27172 tcpNetwork Innovations CL/1 IANA assigned this well-formed service name as a replacement for "cl/1".cl-1last updated 2018/11/27172 tcp (cl/1)Network Innovations CL/1cl/1last updated 2018/11/27172 udpNetwork Innovations CL/1 IANA assigned this well-formed service name as a replacement for "cl/1".cl-1last updated 2018/11/27172 udp (cl/1)Network Innovations CL/1cl/1last updated 2018/11/27173 tcpXyplexxyplex-muxlast updated 2018/11/27173 udpXyplexxyplex-muxlast updated 2018/11/27174 tcpMAILQmailqlast updated 2018/11/27174 udpMAILQmailqlast updated 2018/11/27175 tcpVMNETvmnetlast updated 2018/11/27175 udpVMNETvmnetlast updated 2018/11/27176 tcpGENRAD-MUXgenrad-muxlast updated 2018/11/27176 udpGENRAD-MUXgenrad-muxlast updated 2018/11/27177 tcpX Display Manager Control Protocolxdmcplast updated 2018/11/27177 udpX Display Manager Control Protocolxdmcplast updated 2018/11/27178 tcpNextStep Window Servernextsteplast updated 2018/11/27178 udpNextStep Window Servernextsteplast updated 2018/11/27179 tcpBorder Gateway Protocolbgplast updated 2018/11/27179 udpBorder Gateway Protocolbgplast updated 2018/11/27179 sctpBGPbgplast updated 2018/11/27180 tcpIntergraphrislast updated 2018/11/27180 udpIntergraphrislast updated 2018/11/27181 tcpUnifyunifylast updated 2018/11/27181 udpUnifyunifylast updated 2018/11/27182 tcpUnisys Audit SITPauditlast updated 2018/11/27182 udpUnisys Audit SITPauditlast updated 2018/11/27183 tcpOCBinderocbinderlast updated 2018/11/27183 udpOCBinderocbinderlast updated 2018/11/27184 tcpOCServerocserverlast updated 2018/11/27184 udpOCServerocserverlast updated 2018/11/27185 tcpRemote-KISremote-kislast updated 2018/11/27185 udpRemote-KISremote-kislast updated 2018/11/27186 tcpKIS Protocolkislast updated 2018/11/27186 udpKIS Protocolkislast updated 2018/11/27187 tcpApplication Communication Interfaceacilast updated 2018/11/27187 udpApplication Communication Interfaceacilast updated 2018/11/27188 tcpPlus Five's MUMPSmumpslast updated 2018/11/27188 udpPlus Five's MUMPSmumpslast updated 2018/11/27189 tcpQueued File Transportqftlast updated 2018/11/27189 udpQueued File Transportqftlast updated 2018/11/27190 tcpGateway Access Control Protocolgacplast updated 2018/11/27190 udpGateway Access Control Protocolgacplast updated 2018/11/27191 tcpProspero Directory Serviceprosperolast updated 2018/11/27191 udpProspero Directory Serviceprosperolast updated 2018/11/27192 tcpOSU Network Monitoring Systemosu-nmslast updated 2018/11/27192 udpOSU Network Monitoring Systemosu-nmslast updated 2018/11/27193 tcpSpider Remote Monitoring Protocolsrmplast updated 2018/11/27193 udpSpider Remote Monitoring Protocolsrmplast updated 2018/11/27194 tcpInternet Relay Chat Protocolirclast updated 2018/11/27194 udpInternet Relay Chat Protocolirclast updated 2018/11/27195 tcpDNSIX Network Level Module Auditdn6-nlm-audlast updated 2018/11/27195 udpDNSIX Network Level Module Auditdn6-nlm-audlast updated 2018/11/27196 tcpDNSIX Session Mgt Module Audit Redirdn6-smm-redlast updated 2018/11/27196 udpDNSIX Session Mgt Module Audit Redirdn6-smm-redlast updated 2018/11/27197 tcpDirectory Location Servicedlslast updated 2018/11/27197 udpDirectory Location Servicedlslast updated 2018/11/27198 tcpDirectory Location Service Monitordls-monlast updated 2018/11/27198 udpDirectory Location Service Monitordls-monlast updated 2018/11/27199 tcpSMUXsmuxlast updated 2018/11/27199 udpSMUXsmuxlast updated 2018/11/27200 tcpIBM System Resource Controllersrclast updated 2018/11/27200 udpIBM System Resource Controllersrclast updated 2018/11/27201 tcpAppleTalk Routing Maintenanceat-rtmplast updated 2018/11/27201 udpAppleTalk Routing Maintenanceat-rtmplast updated 2018/11/27202 tcpAppleTalk Name Bindingat-nbplast updated 2018/11/27202 udpAppleTalk Name Bindingat-nbplast updated 2018/11/27203 tcpAppleTalk Unusedat-3last updated 2018/11/27203 udpAppleTalk Unusedat-3last updated 2018/11/27204 tcpAppleTalk Echoat-echolast updated 2018/11/27204 udpAppleTalk Echoat-echolast updated 2018/11/27205 tcpAppleTalk Unusedat-5last updated 2018/11/27205 udpAppleTalk Unusedat-5last updated 2018/11/27206 tcpAppleTalk Zone Informationat-zislast updated 2018/11/27206 udpAppleTalk Zone Informationat-zislast updated 2018/11/27207 tcpAppleTalk Unusedat-7last updated 2018/11/27207 udpAppleTalk Unusedat-7last updated 2018/11/27208 tcpAppleTalk Unusedat-8last updated 2018/11/27208 udpAppleTalk Unusedat-8last updated 2018/11/27209 tcpThe Quick Mail Transfer Protocolqmtplast updated 2018/11/27209 udpThe Quick Mail Transfer Protocolqmtplast updated 2018/11/27210 tcpANSI Z39.50 IANA assigned this well-formed service name as a replacement for "z39.50".z39-50last updated 2018/11/27210 tcp (z39.50)ANSI Z39.50z39.50last updated 2018/11/27210 udpANSI Z39.50 IANA assigned this well-formed service name as a replacement for "z39.50".z39-50last updated 2018/11/27210 udp (z39.50)ANSI Z39.50z39.50last updated 2018/11/27211 tcpTexas Instruments 914C/G Terminal IANA assigned this well-formed service name as a replacement for "914c/g".914c-glast updated 2018/11/27211 tcp (914c/g)Texas Instruments 914C/G Terminal914c/glast updated 2018/11/27211 udpTexas Instruments 914C/G Terminal IANA assigned this well-formed service name as a replacement for "914c/g".914c-glast updated 2018/11/27211 udp (914c/g)Texas Instruments 914C/G Terminal914c/glast updated 2018/11/27212 tcpATEXSSTRanetlast updated 2018/11/27212 udpATEXSSTRanetlast updated 2018/11/27213 tcpIPXipxlast updated 2018/11/27213 udpIPXipxlast updated 2018/11/27214 tcpVM PWSCSvmpwscslast updated 2018/11/27214 udpVM PWSCSvmpwscslast updated 2018/11/27215 tcpInsignia Solutionssoftpclast updated 2018/11/27215 udpInsignia Solutionssoftpclast updated 2018/11/27216 tcpComputer Associates Int'l License ServerCAIliclast updated 2018/11/27216 udpComputer Associates Int'l License ServerCAIliclast updated 2018/11/27217 tcpdBASE Unixdbaselast updated 2018/11/27217 udpdBASE Unixdbaselast updated 2018/11/27218 tcpNetix Message Posting Protocolmpplast updated 2018/11/27218 udpNetix Message Posting Protocolmpplast updated 2018/11/27219 tcpUnisys ARPsuarpslast updated 2018/11/27219 udpUnisys ARPsuarpslast updated 2018/11/27220 tcpInteractive Mail Access Protocol v3imap3last updated 2018/11/27220 udpInteractive Mail Access Protocol v3imap3last updated 2018/11/27221 tcpBerkeley rlogind with SPX authfln-spxlast updated 2018/11/27221 udpBerkeley rlogind with SPX authfln-spxlast updated 2018/11/27222 tcpBerkeley rshd with SPX authrsh-spxlast updated 2018/11/27222 udpBerkeley rshd with SPX authrsh-spxlast updated 2018/11/27223 tcpCertificate Distribution Centercdclast updated 2018/11/27223 udpCertificate Distribution Centercdclast updated 2018/11/27224 tcpmasqdialermasqdialerlast updated 2018/11/27224 udpmasqdialermasqdialerlast updated 2018/11/27225-241 ReservedN/Alast updated 2018/11/27242 tcpDirectdirectlast updated 2018/11/27242 udpDirectdirectlast updated 2018/11/27243 tcpSurvey Measurementsur-measlast updated 2018/11/27243 udpSurvey Measurementsur-measlast updated 2018/11/27244 tcpinbusinessinbusinesslast updated 2018/11/27244 udpinbusinessinbusinesslast updated 2018/11/27245 tcpLINKlinklast updated 2018/11/27245 udpLINKlinklast updated 2018/11/27246 tcpDisplay Systems Protocoldsp3270last updated 2018/11/27246 udpDisplay Systems Protocoldsp3270last updated 2018/11/27247 tcpSUBNTBCST_TFTP IANA assigned this well-formed service name as a replacement for "subntbcst_tftp".subntbcst-tftplast updated 2018/11/27247 tcp (subntbcst_tftp)SUBNTBCST_TFTPsubntbcst_tftplast updated 2018/11/27247 udpSUBNTBCST_TFTP IANA assigned this well-formed service name as a replacement for "subntbcst_tftp".subntbcst-tftplast updated 2018/11/27247 udp (subntbcst_tftp)SUBNTBCST_TFTPsubntbcst_tftplast updated 2018/11/27248 tcpbhfhsbhfhslast updated 2018/11/27248 udpbhfhsbhfhslast updated 2018/11/27249-255 ReservedN/Alast updated 2018/11/27256 tcpRAPraplast updated 2018/11/27256 udpRAPraplast updated 2018/11/27257 tcpSecure Electronic Transactionsetlast updated 2018/11/27257 udpSecure Electronic Transactionsetlast updated 2018/11/27258 UnassignedN/Alast updated 2018/11/27259 tcpEfficient Short Remote Operationsesro-genlast updated 2018/11/27259 udpEfficient Short Remote Operationsesro-genlast updated 2018/11/27260 tcpOpenportopenportlast updated 2018/11/27260 udpOpenportopenportlast updated 2018/11/27261 tcpIIOP Name Service over TLS/SSLnsiiopslast updated 2018/11/27261 udpIIOP Name Service over TLS/SSLnsiiopslast updated 2018/11/27262 tcpArcisdmsarcisdmslast updated 2018/11/27262 udpArcisdmsarcisdmslast updated 2018/11/27263 tcpHDAPhdaplast updated 2018/11/27263 udpHDAPhdaplast updated 2018/11/27264 tcpBGMPbgmplast updated 2018/11/27264 udpBGMPbgmplast updated 2018/11/27265 tcpX-Bone CTLx-bone-ctllast updated 2018/11/27265 udpX-Bone CTLx-bone-ctllast updated 2018/11/27266 tcpSCSI on STsstlast updated 2018/11/27266 udpSCSI on STsstlast updated 2018/11/27267 tcpTobit David Service Layertd-servicelast updated 2018/11/27267 udpTobit David Service Layertd-servicelast updated 2018/11/27268 tcpTobit David Replicatd-replicalast updated 2018/11/27268 udpTobit David Replicatd-replicalast updated 2018/11/27269 tcpMANET Protocolsmanetlast updated 2018/11/27269 udpMANET Protocolsmanetlast updated 2018/11/27270 tcpReservedN/Alast updated 2018/11/27270 udpQ-mode encapsulation for GIST messagesgistlast updated 2018/11/27271 tcpIETF Network Endpoint Assessment (NEA) Posture Transport Protocol over TLS (PT-TLS)pt-tlslast updated 2018/11/27271 udpReservedN/Alast updated 2018/11/27272-279 UnassignedN/Alast updated 2018/11/27280 tcphttp-mgmthttp-mgmtlast updated 2018/11/27280 udphttp-mgmthttp-mgmtlast updated 2018/11/27281 tcpPersonal Linkpersonal-linklast updated 2018/11/27281 udpPersonal Linkpersonal-linklast updated 2018/11/27282 tcpCable Port A/Xcableport-axlast updated 2018/11/27282 udpCable Port A/Xcableport-axlast updated 2018/11/27283 tcprescaprescaplast updated 2018/11/27283 udprescaprescaplast updated 2018/11/27284 tcpcorerjdcorerjdlast updated 2018/11/27284 udpcorerjdcorerjdlast updated 2018/11/27285 UnassignedN/Alast updated 2018/11/27286 tcpFXP Communicationfxplast updated 2018/11/27286 udpFXP Communicationfxplast updated 2018/11/27287 tcpK-BLOCKk-blocklast updated 2018/11/27287 udpK-BLOCKk-blocklast updated 2018/11/27288-307 UnassignedN/Alast updated 2018/11/27308 tcpNovastor Backupnovastorbakcuplast updated 2018/11/27308 udpNovastor Backupnovastorbakcuplast updated 2018/11/27309 tcpEntrustTimeentrusttimelast updated 2018/11/27309 udpEntrustTimeentrusttimelast updated 2018/11/27310 tcpbhmdsbhmdslast updated 2018/11/27310 udpbhmdsbhmdslast updated 2018/11/27311 tcpAppleShare IP WebAdminasip-webadminlast updated 2018/11/27311 udpAppleShare IP WebAdminasip-webadminlast updated 2018/11/27312 tcpVSLMPvslmplast updated 2018/11/27312 udpVSLMPvslmplast updated 2018/11/27313 tcpMagenta Logicmagenta-logiclast updated 2018/11/27313 udpMagenta Logicmagenta-logiclast updated 2018/11/27314 tcpOpalis Robotopalis-robotlast updated 2018/11/27314 udpOpalis Robotopalis-robotlast updated 2018/11/27315 tcpDPSIdpsilast updated 2018/11/27315 udpDPSIdpsilast updated 2018/11/27316 tcpdecAuthdecauthlast updated 2018/11/27316 udpdecAuthdecauthlast updated 2018/11/27317 tcpZannetzannetlast updated 2018/11/27317 udpZannetzannetlast updated 2018/11/27318 tcpPKIX TimeStamppkix-timestamplast updated 2018/11/27318 udpPKIX TimeStamppkix-timestamplast updated 2018/11/27319 tcpPTP Eventptp-eventlast updated 2018/11/27319 udpPTP Eventptp-eventlast updated 2018/11/27320 tcpPTP Generalptp-generallast updated 2018/11/27320 udpPTP Generalptp-generallast updated 2018/11/27321 tcpPIPpiplast updated 2018/11/27321 udpPIPpiplast updated 2018/11/27322 tcpRTSPSrtspslast updated 2018/11/27322 udpRTSPSrtspslast updated 2018/11/27323 tcpResource PKI to Router Protocolrpki-rtrlast updated 2018/11/27323 udpReservedN/Alast updated 2018/11/27324 tcpResource PKI to Router Protocol over TLSrpki-rtr-tlslast updated 2018/11/27324 udpReservedN/Alast updated 2018/11/27325-332 UnassignedN/Alast updated 2018/11/27333 tcpTexar Security Porttexarlast updated 2018/11/27333 udpTexar Security Porttexarlast updated 2018/11/27334-343 UnassignedN/Alast updated 2018/11/27344 tcpProspero Data Access Protocolpdaplast updated 2018/11/27344 udpProspero Data Access Protocolpdaplast updated 2018/11/27345 tcpPerf Analysis Workbenchpawservlast updated 2018/11/27345 udpPerf Analysis Workbenchpawservlast updated 2018/11/27346 tcpZebra serverzservlast updated 2018/11/27346 udpZebra serverzservlast updated 2018/11/27347 tcpFatmen Serverfatservlast updated 2018/11/27347 udpFatmen Serverfatservlast updated 2018/11/27348 tcpCabletron Management Protocolcsi-sgwplast updated 2018/11/27348 udpCabletron Management Protocolcsi-sgwplast updated 2018/11/27349 tcpmftpmftplast updated 2018/11/27349 udpmftpmftplast updated 2018/11/27350 tcpMATIP Type Amatip-type-alast updated 2018/11/27350 udpMATIP Type Amatip-type-alast updated 2018/11/27351 tcpMATIP Type Bmatip-type-blast updated 2018/11/27351 udpMATIP Type Bmatip-type-blast updated 2018/11/27351 tcp (bhoetty)bhoettybhoettylast updated 2018/11/27351 udp tcp (bhoetty)bhoettybhoettylast updated 2018/11/27352 tcpDTAGdtag-ste-sblast updated 2018/11/27352 udpDTAGdtag-ste-sblast updated 2018/11/27352 tcp (bhoedap4)bhoedap4bhoedap4last updated 2018/11/27352 udp (bhoedap4)bhoedap4bhoedap4last updated 2018/11/27353 tcpNDSAUTHndsauthlast updated 2018/11/27353 udpNDSAUTHndsauthlast updated 2018/11/27354 tcpbh611bh611last updated 2018/11/27354 udpbh611bh611last updated 2018/11/27355 tcpDATEX-ASNdatex-asnlast updated 2018/11/27355 udpDATEX-ASNdatex-asnlast updated 2018/11/27356 tcpCloanto Net 1cloanto-net-1last updated 2018/11/27356 udpCloanto Net 1cloanto-net-1last updated 2018/11/27357 tcpbheventbheventlast updated 2018/11/27357 udpbheventbheventlast updated 2018/11/27358 tcpShrinkwrapshrinkwraplast updated 2018/11/27358 udpShrinkwrapshrinkwraplast updated 2018/11/27359 tcpNetwork Security Risk Management Protocolnsrmplast updated 2018/11/27359 udpNetwork Security Risk Management Protocolnsrmplast updated 2018/11/27360 tcpscoi2odialogscoi2odialoglast updated 2018/11/27360 udpscoi2odialogscoi2odialoglast updated 2018/11/27361 tcpSemantixsemantixlast updated 2018/11/27361 udpSemantixsemantixlast updated 2018/11/27362 tcpSRS Sendsrssendlast updated 2018/11/27362 udpSRS Sendsrssendlast updated 2018/11/27363 tcpRSVP Tunnel IANA assigned this well-formed service name as a replacement for "rsvp_tunnel".rsvp-tunnellast updated 2018/11/27363 tcp (rsvp_tunnel)RSVP Tunnelrsvp_tunnellast updated 2018/11/27363 udpRSVP Tunnel IANA assigned this well-formed service name as a replacement for "rsvp_tunnel".rsvp-tunnellast updated 2018/11/27363 udp (rsvp_tunnel)RSVP Tunnelrsvp_tunnellast updated 2018/11/27364 tcpAurora CMGRaurora-cmgrlast updated 2018/11/27364 udpAurora CMGRaurora-cmgrlast updated 2018/11/27365 tcpDTKdtklast updated 2018/11/27365 udpDTKdtklast updated 2018/11/27366 tcpODMRodmrlast updated 2018/11/27366 udpODMRodmrlast updated 2018/11/27367 tcpMortgageWaremortgagewarelast updated 2018/11/27367 udpMortgageWaremortgagewarelast updated 2018/11/27368 tcpQbikGDPqbikgdplast updated 2018/11/27368 udpQbikGDPqbikgdplast updated 2018/11/27369 tcprpc2portmaprpc2portmaplast updated 2018/11/27369 udprpc2portmaprpc2portmaplast updated 2018/11/27370 tcpcodaauth2codaauth2last updated 2018/11/27370 udpcodaauth2codaauth2last updated 2018/11/27371 tcpClearcaseclearcaselast updated 2018/11/27371 udpClearcaseclearcaselast updated 2018/11/27372 tcpListProcessorulistproclast updated 2018/11/27372 udpListProcessorulistproclast updated 2018/11/27373 tcpLegent Corporationlegent-1last updated 2018/11/27373 udpLegent Corporationlegent-1last updated 2018/11/27374 tcpLegent Corporationlegent-2last updated 2018/11/27374 udpLegent Corporationlegent-2last updated 2018/11/27375 tcpHasslehasslelast updated 2018/11/27375 udpHasslehasslelast updated 2018/11/27376 tcpAmiga Envoy Network Inquiry Protoniplast updated 2018/11/27376 udpAmiga Envoy Network Inquiry Protoniplast updated 2018/11/27377 tcpNEC CorporationtnETOSlast updated 2018/11/27377 udpNEC CorporationtnETOSlast updated 2018/11/27378 tcpNEC CorporationdsETOSlast updated 2018/11/27378 udpNEC CorporationdsETOSlast updated 2018/11/27379 tcpTIA/EIA/IS-99 modem clientis99clast updated 2018/11/27379 udpTIA/EIA/IS-99 modem clientis99clast updated 2018/11/27380 tcpTIA/EIA/IS-99 modem serveris99slast updated 2018/11/27380 udpTIA/EIA/IS-99 modem serveris99slast updated 2018/11/27381 tcphp performance data collectorhp-collectorlast updated 2018/11/27381 udphp performance data collectorhp-collectorlast updated 2018/11/27382 tcphp performance data managed nodehp-managed-nodelast updated 2018/11/27382 udphp performance data managed nodehp-managed-nodelast updated 2018/11/27383 tcphp performance data alarm managerhp-alarm-mgrlast updated 2018/11/27383 udphp performance data alarm managerhp-alarm-mgrlast updated 2018/11/27384 tcpA Remote Network Server Systemarnslast updated 2018/11/27384 udpA Remote Network Server Systemarnslast updated 2018/11/27385 tcpIBM Applicationibm-applast updated 2018/11/27385 udpIBM Applicationibm-applast updated 2018/11/27386 tcpASA Message Router Object Def.asalast updated 2018/11/27386 udpASA Message Router Object Def.asalast updated 2018/11/27387 tcpAppletalk Update-Based Routing Pro.aurplast updated 2018/11/27387 udpAppletalk Update-Based Routing Pro.aurplast updated 2018/11/27388 tcpUnidata LDMunidata-ldmlast updated 2018/11/27388 udpUnidata LDMunidata-ldmlast updated 2018/11/27389 tcpLightweight Directory Access Protocolldaplast updated 2018/11/27389 udpLightweight Directory Access Protocolldaplast updated 2018/11/27390 tcpUISuislast updated 2018/11/27390 udpUISuislast updated 2018/11/27391 tcpSynOptics SNMP Relay Portsynotics-relaylast updated 2018/11/27391 udpSynOptics SNMP Relay Portsynotics-relaylast updated 2018/11/27392 tcpSynOptics Port Broker Portsynotics-brokerlast updated 2018/11/27392 udpSynOptics Port Broker Portsynotics-brokerlast updated 2018/11/27393 tcpMeta5meta5last updated 2018/11/27393 udpMeta5meta5last updated 2018/11/27394 tcpEMBL Nucleic Data Transferembl-ndtlast updated 2018/11/27394 udpEMBL Nucleic Data Transferembl-ndtlast updated 2018/11/27395 tcpNetScout Control Protocolnetcplast updated 2018/11/27395 udpNetScout Control Protocolnetcplast updated 2018/11/27396 tcpNovell Netware over IPnetware-iplast updated 2018/11/27396 udpNovell Netware over IPnetware-iplast updated 2018/11/27397 tcpMulti Protocol Trans. Net.mptnlast updated 2018/11/27397 udpMulti Protocol Trans. Net.mptnlast updated 2018/11/27398 tcpKryptolankryptolanlast updated 2018/11/27398 udpKryptolankryptolanlast updated 2018/11/27399 tcpISO Transport Class 2 Non-Control over TCPiso-tsap-c2last updated 2018/11/27399 udpISO Transport Class 2 Non-Control over UDPiso-tsap-c2last updated 2018/11/27400 tcpOracle Secure Backuposb-sdlast updated 2018/11/27400 udpOracle Secure Backuposb-sdlast updated 2018/11/27401 tcpUninterruptible Power Supplyupslast updated 2018/11/27401 udpUninterruptible Power Supplyupslast updated 2018/11/27402 tcpGenie Protocolgenielast updated 2018/11/27402 udpGenie Protocolgenielast updated 2018/11/27403 tcpdecapdecaplast updated 2018/11/27403 udpdecapdecaplast updated 2018/11/27404 tcpncedncedlast updated 2018/11/27404 udpncedncedlast updated 2018/11/27405 tcpncldncldlast updated 2018/11/27405 udpncldncldlast updated 2018/11/27406 tcpInteractive Mail Support Protocolimsplast updated 2018/11/27406 udpInteractive Mail Support Protocolimsplast updated 2018/11/27407 tcpTimbuktutimbuktulast updated 2018/11/27407 udpTimbuktutimbuktulast updated 2018/11/27408 tcpProspero Resource Manager Sys. Man.prm-smlast updated 2018/11/27408 udpProspero Resource Manager Sys. Man.prm-smlast updated 2018/11/27409 tcpProspero Resource Manager Node Man.prm-nmlast updated 2018/11/27409 udpProspero Resource Manager Node Man.prm-nmlast updated 2018/11/27410 tcpDECLadebug Remote Debug Protocoldecladebuglast updated 2018/11/27410 udpDECLadebug Remote Debug Protocoldecladebuglast updated 2018/11/27411 tcpRemote MT Protocolrmtlast updated 2018/11/27411 udpRemote MT Protocolrmtlast updated 2018/11/27412 tcpTrap Convention Portsynoptics-traplast updated 2018/11/27412 udpTrap Convention Portsynoptics-traplast updated 2018/11/27413 tcpStorage Management Services Protocolsmsplast updated 2018/11/27413 udpStorage Management Services Protocolsmsplast updated 2018/11/27414 tcpInfoSeekinfoseeklast updated 2018/11/27414 udpInfoSeekinfoseeklast updated 2018/11/27415 tcpBNetbnetlast updated 2018/11/27415 udpBNetbnetlast updated 2018/11/27416 tcpSilverplattersilverplatterlast updated 2018/11/27416 udpSilverplattersilverplatterlast updated 2018/11/27417 tcpOnmuxonmuxlast updated 2018/11/27417 udpOnmuxonmuxlast updated 2018/11/27418 tcpHyper-Ghyper-glast updated 2018/11/27418 udpHyper-Ghyper-glast updated 2018/11/27419 tcpAriel 1ariel1last updated 2018/11/27419 udpAriel 1ariel1last updated 2018/11/27420 tcpSMPTEsmptelast updated 2018/11/27420 udpSMPTEsmptelast updated 2018/11/27421 tcpAriel 2ariel2last updated 2018/11/27421 udpAriel 2ariel2last updated 2018/11/27422 tcpAriel 3ariel3last updated 2018/11/27422 udpAriel 3ariel3last updated 2018/11/27423 tcpIBM Operations Planning and Control Startopc-job-startlast updated 2018/11/27423 udpIBM Operations Planning and Control Startopc-job-startlast updated 2018/11/27424 tcpIBM Operations Planning and Control Trackopc-job-tracklast updated 2018/11/27424 udpIBM Operations Planning and Control Trackopc-job-tracklast updated 2018/11/27425 tcpICADicad-ellast updated 2018/11/27425 udpICADicad-ellast updated 2018/11/27426 tcpsmartsdpsmartsdplast updated 2018/11/27426 udpsmartsdpsmartsdplast updated 2018/11/27427 tcpServer Locationsvrloclast updated 2018/11/27427 udpServer Locationsvrloclast updated 2018/11/27428 tcpOCS_CMU IANA assigned this well-formed service name as a replacement for "ocs_cmu".ocs-cmulast updated 2018/11/27428 tcp (ocs_cmu)OCS_CMUocs_cmulast updated 2018/11/27428 udpOCS_CMU IANA assigned this well-formed service name as a replacement for "ocs_cmu".ocs-cmulast updated 2018/11/27428 udp (ocs_cmu)OCS_CMUocs_cmulast updated 2018/11/27429 tcpOCS_AMU IANA assigned this well-formed service name as a replacement for "ocs_amu".ocs-amulast updated 2018/11/27429 tcp (ocs_amu)OCS_AMUocs_amulast updated 2018/11/27429 udpOCS_AMU IANA assigned this well-formed service name as a replacement for "ocs_amu".ocs-amulast updated 2018/11/27429 udp (ocs_amu)OCS_AMUocs_amulast updated 2018/11/27430 tcpUTMPSDutmpsdlast updated 2018/11/27430 udpUTMPSDutmpsdlast updated 2018/11/27431 tcpUTMPCDutmpcdlast updated 2018/11/27431 udpUTMPCDutmpcdlast updated 2018/11/27432 tcpIASDiasdlast updated 2018/11/27432 udpIASDiasdlast updated 2018/11/27433 tcpNNTP for transit servers (NNSP)nnsplast updated 2018/11/27433 udpNNTP for transit servers (NNSP)nnsplast updated 2018/11/27434 tcpMobileIP-Agentmobileip-agentlast updated 2018/11/27434 udpMobileIP-Agentmobileip-agentlast updated 2018/11/27435 tcpMobilIP-MNmobilip-mnlast updated 2018/11/27435 udpMobilIP-MNmobilip-mnlast updated 2018/11/27436 tcpDNA-CMLdna-cmllast updated 2018/11/27436 udpDNA-CMLdna-cmllast updated 2018/11/27437 tcpcomscmcomscmlast updated 2018/11/27437 udpcomscmcomscmlast updated 2018/11/27438 tcpdsfgwdsfgwlast updated 2018/11/27438 udpdsfgwdsfgwlast updated 2018/11/27439 tcpdaspdasplast updated 2018/11/27439 udpdaspdasplast updated 2018/11/27440 tcpsgcpsgcplast updated 2018/11/27440 udpsgcpsgcplast updated 2018/11/27441 tcpdecvms-sysmgtdecvms-sysmgtlast updated 2018/11/27441 udpdecvms-sysmgtdecvms-sysmgtlast updated 2018/11/27442 tcpcvc_hostd IANA assigned this well-formed service name as a replacement for "cvc_hostd".cvc-hostdlast updated 2018/11/27442 tcp (cvc_hostd)cvc_hostdcvc_hostdlast updated 2018/11/27442 udpcvc_hostd IANA assigned this well-formed service name as a replacement for "cvc_hostd".cvc-hostdlast updated 2018/11/27442 udp (cvc_hostd)cvc_hostdcvc_hostdlast updated 2018/11/27443 tcphttp protocol over TLS/SSLhttpslast updated 2018/11/27443 udphttp protocol over TLS/SSLhttpslast updated 2018/11/27443 sctpHTTPShttpslast updated 2018/11/27444 tcpSimple Network Paging Protocolsnpplast updated 2018/11/27444 udpSimple Network Paging Protocolsnpplast updated 2018/11/27445 tcpMicrosoft-DSmicrosoft-dslast updated 2018/11/27445 udpMicrosoft-DSmicrosoft-dslast updated 2018/11/27446 tcpDDM-Remote Relational Database Accessddm-rdblast updated 2018/11/27446 udpDDM-Remote Relational Database Accessddm-rdblast updated 2018/11/27447 tcpDDM-Distributed File Managementddm-dfmlast updated 2018/11/27447 udpDDM-Distributed File Managementddm-dfmlast updated 2018/11/27448 tcpDDM-Remote DB Access Using Secure Socketsddm-ssllast updated 2018/11/27448 udpDDM-Remote DB Access Using Secure Socketsddm-ssllast updated 2018/11/27449 tcpAS Server Mapperas-servermaplast updated 2018/11/27449 udpAS Server Mapperas-servermaplast updated 2018/11/27450 tcpComputer Supported Telecomunication Applicationstserverlast updated 2018/11/27450 udpComputer Supported Telecomunication Applicationstserverlast updated 2018/11/27451 tcpCray Network Semaphore serversfs-smp-netlast updated 2018/11/27451 udpCray Network Semaphore serversfs-smp-netlast updated 2018/11/27452 tcpCray SFS config serversfs-configlast updated 2018/11/27452 udpCray SFS config serversfs-configlast updated 2018/11/27453 tcpCreativeServercreativeserverlast updated 2018/11/27453 udpCreativeServercreativeserverlast updated 2018/11/27454 tcpContentServercontentserverlast updated 2018/11/27454 udpContentServercontentserverlast updated 2018/11/27455 tcpCreativePartnrcreativepartnrlast updated 2018/11/27455 udpCreativePartnrcreativepartnrlast updated 2018/11/27456 tcpmacon-tcpmacon-tcplast updated 2018/11/27456 udpmacon-udpmacon-udplast updated 2018/11/27457 tcpscohelpscohelplast updated 2018/11/27457 udpscohelpscohelplast updated 2018/11/27458 tcpapple quick timeappleqtclast updated 2018/11/27458 udpapple quick timeappleqtclast updated 2018/11/27459 tcpampr-rcmdampr-rcmdlast updated 2018/11/27459 udpampr-rcmdampr-rcmdlast updated 2018/11/27460 tcpskronkskronklast updated 2018/11/27460 udpskronkskronklast updated 2018/11/27461 tcpDataRampSrvdatasurfsrvlast updated 2018/11/27461 udpDataRampSrvdatasurfsrvlast updated 2018/11/27462 tcpDataRampSrvSecdatasurfsrvseclast updated 2018/11/27462 udpDataRampSrvSecdatasurfsrvseclast updated 2018/11/27463 tcpalpesalpeslast updated 2018/11/27463 udpalpesalpeslast updated 2018/11/27464 tcpkpasswdkpasswdlast updated 2018/11/27464 udpkpasswdkpasswdlast updated 2018/11/27465 tcp (urd)URL Rendezvous Directory for SSMurdlast updated 2018/11/27465 tcpMessage Submission over TLS protocolsubmissionslast updated 2018/11/27465 udpIGMP over UDP for SSMigmpv3litelast updated 2018/11/27466 tcpdigital-vrcdigital-vrclast updated 2018/11/27466 udpdigital-vrcdigital-vrclast updated 2018/11/27467 tcpmylex-mapdmylex-mapdlast updated 2018/11/27467 udpmylex-mapdmylex-mapdlast updated 2018/11/27468 tcpproturisphoturislast updated 2018/11/27468 udpproturisphoturislast updated 2018/11/27469 tcpRadio Control Protocolrcplast updated 2018/11/27469 udpRadio Control Protocolrcplast updated 2018/11/27470 tcpscx-proxyscx-proxylast updated 2018/11/27470 udpscx-proxyscx-proxylast updated 2018/11/27471 tcpMondexmondexlast updated 2018/11/27471 udpMondexmondexlast updated 2018/11/27472 tcpljk-loginljk-loginlast updated 2018/11/27472 udpljk-loginljk-loginlast updated 2018/11/27473 tcphybrid-pophybrid-poplast updated 2018/11/27473 udphybrid-pophybrid-poplast updated 2018/11/27474 tcptn-tl-w1tn-tl-w1last updated 2018/11/27474 udptn-tl-w2tn-tl-w2last updated 2018/11/27475 tcptcpnethaspsrvtcpnethaspsrvlast updated 2018/11/27475 udptcpnethaspsrvtcpnethaspsrvlast updated 2018/11/27476 tcptn-tl-fd1tn-tl-fd1last updated 2018/11/27476 udptn-tl-fd1tn-tl-fd1last updated 2018/11/27477 tcpss7nsss7nslast updated 2018/11/27477 udpss7nsss7nslast updated 2018/11/27478 tcpspscspsclast updated 2018/11/27478 udpspscspsclast updated 2018/11/27479 tcpiafserveriafserverlast updated 2018/11/27479 udpiafserveriafserverlast updated 2018/11/27480 tcpiafdbaseiafdbaselast updated 2018/11/27480 udpiafdbaseiafdbaselast updated 2018/11/27481 tcpPh servicephlast updated 2018/11/27481 udpPh servicephlast updated 2018/11/27482 tcpbgs-nsibgs-nsilast updated 2018/11/27482 udpbgs-nsibgs-nsilast updated 2018/11/27483 tcpulpnetulpnetlast updated 2018/11/27483 udpulpnetulpnetlast updated 2018/11/27484 tcpIntegra Software Management Environmentintegra-smelast updated 2018/11/27484 udpIntegra Software Management Environmentintegra-smelast updated 2018/11/27485 tcpAir Soft Power Burstpowerburstlast updated 2018/11/27485 udpAir Soft Power Burstpowerburstlast updated 2018/11/27486 tcpavianavianlast updated 2018/11/27486 udpavianavianlast updated 2018/11/27487 tcpsaft Simple Asynchronous File Transfersaftlast updated 2018/11/27487 udpsaft Simple Asynchronous File Transfersaftlast updated 2018/11/27488 tcpgss-httpgss-httplast updated 2018/11/27488 udpgss-httpgss-httplast updated 2018/11/27489 tcpnest-protocolnest-protocollast updated 2018/11/27489 udpnest-protocolnest-protocollast updated 2018/11/27490 tcpmicom-pfsmicom-pfslast updated 2018/11/27490 udpmicom-pfsmicom-pfslast updated 2018/11/27491 tcpgo-logingo-loginlast updated 2018/11/27491 udpgo-logingo-loginlast updated 2018/11/27492 tcpTransport Independent Convergence for FNAticf-1last updated 2018/11/27492 udpTransport Independent Convergence for FNAticf-1last updated 2018/11/27493 tcpTransport Independent Convergence for FNAticf-2last updated 2018/11/27493 udpTransport Independent Convergence for FNAticf-2last updated 2018/11/27494 tcpPOV-Raypov-raylast updated 2018/11/27494 udpPOV-Raypov-raylast updated 2018/11/27495 tcpintecourierintecourierlast updated 2018/11/27495 udpintecourierintecourierlast updated 2018/11/27496 tcpPIM-RP-DISCpim-rp-disclast updated 2018/11/27496 udpPIM-RP-DISCpim-rp-disclast updated 2018/11/27497 tcpRetrospect backup and restore serviceretrospectlast updated 2018/11/27497 udpRetrospect backup and restore serviceretrospectlast updated 2018/11/27498 tcpsiamsiamlast updated 2018/11/27498 udpsiamsiamlast updated 2018/11/27499 tcpISO ILL Protocoliso-illlast updated 2018/11/27499 udpISO ILL Protocoliso-illlast updated 2018/11/27500 tcpisakmpisakmplast updated 2018/11/27500 udpisakmpisakmplast updated 2018/11/27501 tcpSTMFstmflast updated 2018/11/27501 udpSTMFstmflast updated 2018/11/27502 tcpModbus Application Protocolmbaplast updated 2018/11/27502 udpModbus Application Protocolmbaplast updated 2018/11/27503 tcpIntrinsaintrinsalast updated 2018/11/27503 udpIntrinsaintrinsalast updated 2018/11/27504 tcpcitadelcitadellast updated 2018/11/27504 udpcitadelcitadellast updated 2018/11/27505 tcpmailbox-lmmailbox-lmlast updated 2018/11/27505 udpmailbox-lmmailbox-lmlast updated 2018/11/27506 tcpohimsrvohimsrvlast updated 2018/11/27506 udpohimsrvohimsrvlast updated 2018/11/27507 tcpcrscrslast updated 2018/11/27507 udpcrscrslast updated 2018/11/27508 tcpxvttpxvttplast updated 2018/11/27508 udpxvttpxvttplast updated 2018/11/27509 tcpsnaresnarelast updated 2018/11/27509 udpsnaresnarelast updated 2018/11/27510 tcpFirstClass Protocolfcplast updated 2018/11/27510 udpFirstClass Protocolfcplast updated 2018/11/27511 tcpPassGopassgolast updated 2018/11/27511 udpPassGopassgolast updated 2018/11/27512 tcpremote process execution; authentication performed using passwords and UNIX login namesexeclast updated 2018/11/27512 udpcomsatlast updated 2018/11/27512 udp (biff)used by mail system to notify users of new mail received; currently receives messages only from processes on the same machinebifflast updated 2018/11/27513 tcpremote login a la telnet; automatic authentication performed based on priviledged port numbers and distributed data bases which identify "authentication domains"loginlast updated 2018/11/27513 udpmaintains data bases showing who's logged in to machines on a local net and the load average of the machinewholast updated 2018/11/27514 tcpcmd like exec, but automatic authentication is performed as for login servershelllast updated 2018/11/27514 udpsysloglast updated 2018/11/27515 tcpspoolerprinterlast updated 2018/11/27515 udpspoolerprinterlast updated 2018/11/27516 tcpvideotexvideotexlast updated 2018/11/27516 udpvideotexvideotexlast updated 2018/11/27517 tcplike tenex link, but across machine - unfortunately, doesn't use link protocol (this is actually just a rendezvous port from which a tcp connection is established)talklast updated 2018/11/27517 udplike tenex link, but across machine - unfortunately, doesn't use link protocol (this is actually just a rendezvous port from which a tcp connection is established)talklast updated 2018/11/27518 tcpntalklast updated 2018/11/27518 udpntalklast updated 2018/11/27519 tcpunixtimeutimelast updated 2018/11/27519 udpunixtimeutimelast updated 2018/11/27520 tcpextended file name serverefslast updated 2018/11/27520 udplocal routing process (on site); uses variant of Xerox NS routing information protocol - RIProuterlast updated 2018/11/27521 tcpripngripnglast updated 2018/11/27521 udpripngripnglast updated 2018/11/27522 tcpULPulplast updated 2018/11/27522 udpULPulplast updated 2018/11/27523 tcpIBM-DB2ibm-db2last updated 2018/11/27523 udpIBM-DB2ibm-db2last updated 2018/11/27524 tcpNCPncplast updated 2018/11/27524 udpNCPncplast updated 2018/11/27525 tcptimeservertimedlast updated 2018/11/27525 udptimeservertimedlast updated 2018/11/27526 tcpnewdatetempolast updated 2018/11/27526 udpnewdatetempolast updated 2018/11/27527 tcpStock IXChangestxlast updated 2018/11/27527 udpStock IXChangestxlast updated 2018/11/27528 tcpCustomer IXChangecustixlast updated 2018/11/27528 udpCustomer IXChangecustixlast updated 2018/11/27529 tcpIRC-SERVirc-servlast updated 2018/11/27529 udpIRC-SERVirc-servlast updated 2018/11/27530 tcprpccourierlast updated 2018/11/27530 udprpccourierlast updated 2018/11/27531 tcpchatconferencelast updated 2018/11/27531 udpchatconferencelast updated 2018/11/27532 tcpreadnewsnetnewslast updated 2018/11/27532 udpreadnewsnetnewslast updated 2018/11/27533 tcpfor emergency broadcastsnetwalllast updated 2018/11/27533 udpfor emergency broadcastsnetwalllast updated 2018/11/27534 tcpwindream Adminwindreamlast updated 2018/11/27534 udpwindream Adminwindreamlast updated 2018/11/27535 tcpiiopiioplast updated 2018/11/27535 udpiiopiioplast updated 2018/11/27536 tcpopalis-rdvopalis-rdvlast updated 2018/11/27536 udpopalis-rdvopalis-rdvlast updated 2018/11/27537 tcpNetworked Media Streaming Protocolnmsplast updated 2018/11/27537 udpNetworked Media Streaming Protocolnmsplast updated 2018/11/27538 tcpgdomapgdomaplast updated 2018/11/27538 udpgdomapgdomaplast updated 2018/11/27539 tcpApertus Technologies Load Determinationapertus-ldplast updated 2018/11/27539 udpApertus Technologies Load Determinationapertus-ldplast updated 2018/11/27540 tcpuucpduucplast updated 2018/11/27540 udpuucpduucplast updated 2018/11/27541 tcpuucp-rloginuucp-rloginlast updated 2018/11/27541 udpuucp-rloginuucp-rloginlast updated 2018/11/27542 tcpcommercecommercelast updated 2018/11/27542 udpcommercecommercelast updated 2018/11/27543 tcpkloginlast updated 2018/11/27543 udpkloginlast updated 2018/11/27544 tcpkrcmdkshelllast updated 2018/11/27544 udpkrcmdkshelllast updated 2018/11/27545 tcpappleqtcsrvrappleqtcsrvrlast updated 2018/11/27545 udpappleqtcsrvrappleqtcsrvrlast updated 2018/11/27546 tcpDHCPv6 Clientdhcpv6-clientlast updated 2018/11/27546 udpDHCPv6 Clientdhcpv6-clientlast updated 2018/11/27547 tcpDHCPv6 Serverdhcpv6-serverlast updated 2018/11/27547 udpDHCPv6 Serverdhcpv6-serverlast updated 2018/11/27548 tcpAFP over TCPafpovertcplast updated 2018/11/27548 udpAFP over TCPafpovertcplast updated 2018/11/27549 tcpIDFPidfplast updated 2018/11/27549 udpIDFPidfplast updated 2018/11/27550 tcpnew-whonew-rwholast updated 2018/11/27550 udpnew-whonew-rwholast updated 2018/11/27551 tcpcybercashcybercashlast updated 2018/11/27551 udpcybercashcybercashlast updated 2018/11/27552 tcpDeviceSharedevshr-ntslast updated 2018/11/27552 udpDeviceSharedevshr-ntslast updated 2018/11/27553 tcppirppirplast updated 2018/11/27553 udppirppirplast updated 2018/11/27554 tcpReal Time Streaming Protocol (RTSP)rtsplast updated 2018/11/27554 udpReal Time Streaming Protocol (RTSP)rtsplast updated 2018/11/27555 tcpdsflast updated 2018/11/27555 udpdsflast updated 2018/11/27556 tcprfs serverremotefslast updated 2018/11/27556 udprfs serverremotefslast updated 2018/11/27557 tcpopenvms-sysipcopenvms-sysipclast updated 2018/11/27557 udpopenvms-sysipcopenvms-sysipclast updated 2018/11/27558 tcpSDNSKMPsdnskmplast updated 2018/11/27558 udpSDNSKMPsdnskmplast updated 2018/11/27559 tcpTEEDTAPteedtaplast updated 2018/11/27559 udpTEEDTAPteedtaplast updated 2018/11/27560 tcprmonitordrmonitorlast updated 2018/11/27560 udprmonitordrmonitorlast updated 2018/11/27561 tcpmonitorlast updated 2018/11/27561 udpmonitorlast updated 2018/11/27562 tcpchcmdchshelllast updated 2018/11/27562 udpchcmdchshelllast updated 2018/11/27563 tcpnntp protocol over TLS/SSL (was snntp)nntpslast updated 2018/11/27563 udpnntp protocol over TLS/SSL (was snntp)nntpslast updated 2018/11/27564 tcpplan 9 file service9pfslast updated 2018/11/27564 udpplan 9 file service9pfslast updated 2018/11/27565 tcpwhoamiwhoamilast updated 2018/11/27565 udpwhoamiwhoamilast updated 2018/11/27566 tcpstreettalkstreettalklast updated 2018/11/27566 udpstreettalkstreettalklast updated 2018/11/27567 tcpbanyan-rpcbanyan-rpclast updated 2018/11/27567 udpbanyan-rpcbanyan-rpclast updated 2018/11/27568 tcpmicrosoft shuttlems-shuttlelast updated 2018/11/27568 udpmicrosoft shuttlems-shuttlelast updated 2018/11/27569 tcpmicrosoft romems-romelast updated 2018/11/27569 udpmicrosoft romems-romelast updated 2018/11/27570 tcpdemonmeterlast updated 2018/11/27570 udpdemonmeterlast updated 2018/11/27571 tcpudemonmeterlast updated 2018/11/27571 udpudemonmeterlast updated 2018/11/27572 tcpsonarsonarlast updated 2018/11/27572 udpsonarsonarlast updated 2018/11/27573 tcpbanyan-vipbanyan-viplast updated 2018/11/27573 udpbanyan-vipbanyan-viplast updated 2018/11/27574 tcpFTP Software Agent Systemftp-agentlast updated 2018/11/27574 udpFTP Software Agent Systemftp-agentlast updated 2018/11/27575 tcpVEMMIvemmilast updated 2018/11/27575 udpVEMMIvemmilast updated 2018/11/27576 tcpipcdipcdlast updated 2018/11/27576 udpipcdipcdlast updated 2018/11/27577 tcpvnasvnaslast updated 2018/11/27577 udpvnasvnaslast updated 2018/11/27578 tcpipddipddlast updated 2018/11/27578 udpipddipddlast updated 2018/11/27579 tcpdecbsrvdecbsrvlast updated 2018/11/27579 udpdecbsrvdecbsrvlast updated 2018/11/27580 tcpSNTP HEARTBEATsntp-heartbeatlast updated 2018/11/27580 udpSNTP HEARTBEATsntp-heartbeatlast updated 2018/11/27581 tcpBundle Discovery Protocolbdplast updated 2018/11/27581 udpBundle Discovery Protocolbdplast updated 2018/11/27582 tcpSCC Securityscc-securitylast updated 2018/11/27582 udpSCC Securityscc-securitylast updated 2018/11/27583 tcpPhilips Video-Conferencingphilips-vclast updated 2018/11/27583 udpPhilips Video-Conferencingphilips-vclast updated 2018/11/27584 tcpKey Serverkeyserverlast updated 2018/11/27584 udpKey Serverkeyserverlast updated 2018/11/27585 De-registeredN/Alast updated 2018/11/27586 tcpPassword Changepassword-chglast updated 2018/11/27586 udpPassword Changepassword-chglast updated 2018/11/27587 tcpMessage Submissionsubmissionlast updated 2018/11/27587 udpMessage Submissionsubmissionlast updated 2018/11/27588 tcpCALcallast updated 2018/11/27588 udpCALcallast updated 2018/11/27589 tcpEyeLinkeyelinklast updated 2018/11/27589 udpEyeLinkeyelinklast updated 2018/11/27590 tcpTNS CMLtns-cmllast updated 2018/11/27590 udpTNS CMLtns-cmllast updated 2018/11/27591 tcpFileMaker, Inc. - HTTP Alternate (see Port 80)http-altlast updated 2018/11/27591 udpFileMaker, Inc. - HTTP Alternate (see Port 80)http-altlast updated 2018/11/27592 tcpEudora Seteudora-setlast updated 2018/11/27592 udpEudora Seteudora-setlast updated 2018/11/27593 tcpHTTP RPC Ep Maphttp-rpc-epmaplast updated 2018/11/27593 udpHTTP RPC Ep Maphttp-rpc-epmaplast updated 2018/11/27594 tcpTPIPtpiplast updated 2018/11/27594 udpTPIPtpiplast updated 2018/11/27595 tcpCAB Protocolcab-protocollast updated 2018/11/27595 udpCAB Protocolcab-protocollast updated 2018/11/27596 tcpSMSDsmsdlast updated 2018/11/27596 udpSMSDsmsdlast updated 2018/11/27597 tcpPTC Name Serviceptcnameservicelast updated 2018/11/27597 udpPTC Name Serviceptcnameservicelast updated 2018/11/27598 tcpSCO Web Server Manager 3sco-websrvrmg3last updated 2018/11/27598 udpSCO Web Server Manager 3sco-websrvrmg3last updated 2018/11/27599 tcpAeolon Core Protocolacplast updated 2018/11/27599 udpAeolon Core Protocolacplast updated 2018/11/27600 tcpSun IPC serveripcserverlast updated 2018/11/27600 udpSun IPC serveripcserverlast updated 2018/11/27601 tcpReliable Syslog Servicesyslog-connlast updated 2018/11/27601 udpReliable Syslog Servicesyslog-connlast updated 2018/11/27602 tcpXML-RPC over BEEPxmlrpc-beeplast updated 2018/11/27602 udpXML-RPC over BEEPxmlrpc-beeplast updated 2018/11/27603 tcpIDXPidxplast updated 2018/11/27603 udpIDXPidxplast updated 2018/11/27604 tcpTUNNELtunnellast updated 2018/11/27604 udpTUNNELtunnellast updated 2018/11/27605 tcpSOAP over BEEPsoap-beeplast updated 2018/11/27605 udpSOAP over BEEPsoap-beeplast updated 2018/11/27606 tcpCray Unified Resource Managerurmlast updated 2018/11/27606 udpCray Unified Resource Managerurmlast updated 2018/11/27607 tcpnqsnqslast updated 2018/11/27607 udpnqsnqslast updated 2018/11/27608 tcpSender-Initiated/Unsolicited File Transfersift-uftlast updated 2018/11/27608 udpSender-Initiated/Unsolicited File Transfersift-uftlast updated 2018/11/27609 tcpnpmp-trapnpmp-traplast updated 2018/11/27609 udpnpmp-trapnpmp-traplast updated 2018/11/27610 tcpnpmp-localnpmp-locallast updated 2018/11/27610 udpnpmp-localnpmp-locallast updated 2018/11/27611 tcpnpmp-guinpmp-guilast updated 2018/11/27611 udpnpmp-guinpmp-guilast updated 2018/11/27612 tcpHMMP Indicationhmmp-indlast updated 2018/11/27612 udpHMMP Indicationhmmp-indlast updated 2018/11/27613 tcpHMMP Operationhmmp-oplast updated 2018/11/27613 udpHMMP Operationhmmp-oplast updated 2018/11/27614 tcpSSLshellsshelllast updated 2018/11/27614 udpSSLshellsshelllast updated 2018/11/27615 tcpInternet Configuration Managersco-inetmgrlast updated 2018/11/27615 udpInternet Configuration Managersco-inetmgrlast updated 2018/11/27616 tcpSCO System Administration Serversco-sysmgrlast updated 2018/11/27616 udpSCO System Administration Serversco-sysmgrlast updated 2018/11/27617 tcpSCO Desktop Administration Serversco-dtmgrlast updated 2018/11/27617 udpSCO Desktop Administration Serversco-dtmgrlast updated 2018/11/27618 tcpDEI-ICDAdei-icdalast updated 2018/11/27618 udpDEI-ICDAdei-icdalast updated 2018/11/27619 tcpCompaq EVMcompaq-evmlast updated 2018/11/27619 udpCompaq EVMcompaq-evmlast updated 2018/11/27620 tcpSCO WebServer Managersco-websrvrmgrlast updated 2018/11/27620 udpSCO WebServer Managersco-websrvrmgrlast updated 2018/11/27621 tcpESCPescp-iplast updated 2018/11/27621 udpESCPescp-iplast updated 2018/11/27622 tcpCollaboratorcollaboratorlast updated 2018/11/27622 udpCollaboratorcollaboratorlast updated 2018/11/27623 tcpDMTF out-of-band web services management protocoloob-ws-httplast updated 2018/11/27623 udpASF Remote Management and Control Protocolasf-rmcplast updated 2018/11/27624 tcpCrypto Admincryptoadminlast updated 2018/11/27624 udpCrypto Admincryptoadminlast updated 2018/11/27625 tcpDEC DLM IANA assigned this well-formed service name as a replacement for "dec_dlm".dec-dlmlast updated 2018/11/27625 tcp (dec_dlm)DEC DLMdec_dlmlast updated 2018/11/27625 udpDEC DLM IANA assigned this well-formed service name as a replacement for "dec_dlm".dec-dlmlast updated 2018/11/27625 udp (dec_dlm)DEC DLMdec_dlmlast updated 2018/11/27626 tcpASIAasialast updated 2018/11/27626 udpASIAasialast updated 2018/11/27627 tcpPassGo Tivolipassgo-tivolilast updated 2018/11/27627 udpPassGo Tivolipassgo-tivolilast updated 2018/11/27628 tcpQMQPqmqplast updated 2018/11/27628 udpQMQPqmqplast updated 2018/11/27629 tcp3Com AMP33com-amp3last updated 2018/11/27629 udp3Com AMP33com-amp3last updated 2018/11/27630 tcpRDArdalast updated 2018/11/27630 udpRDArdalast updated 2018/11/27631 tcpIPP (Internet Printing Protocol)ipplast updated 2018/11/27631 udpIPP (Internet Printing Protocol)ipplast updated 2018/11/27631 tcp (ipps)Internet Printing Protocol over HTTPSippslast updated 2018/11/27632 tcpbmppbmpplast updated 2018/11/27632 udpbmppbmpplast updated 2018/11/27633 tcpService Status update (Sterling Software)servstatlast updated 2018/11/27633 udpService Status update (Sterling Software)servstatlast updated 2018/11/27634 tcpginadginadlast updated 2018/11/27634 udpginadginadlast updated 2018/11/27635 tcpRLZ DBaserlzdbaselast updated 2018/11/27635 udpRLZ DBaserlzdbaselast updated 2018/11/27636 tcpldap protocol over TLS/SSL (was sldap)ldapslast updated 2018/11/27636 udpldap protocol over TLS/SSL (was sldap)ldapslast updated 2018/11/27637 tcplanserverlanserverlast updated 2018/11/27637 udplanserverlanserverlast updated 2018/11/27638 tcpmcns-secmcns-seclast updated 2018/11/27638 udpmcns-secmcns-seclast updated 2018/11/27639 tcpMSDPmsdplast updated 2018/11/27639 udpMSDPmsdplast updated 2018/11/27640 tcpentrust-spsentrust-spslast updated 2018/11/27640 udpentrust-spsentrust-spslast updated 2018/11/27641 tcprepcmdrepcmdlast updated 2018/11/27641 udprepcmdrepcmdlast updated 2018/11/27642 tcpESRO-EMSDP V1.3esro-emsdplast updated 2018/11/27642 udpESRO-EMSDP V1.3esro-emsdplast updated 2018/11/27643 tcpSANitysanitylast updated 2018/11/27643 udpSANitysanitylast updated 2018/11/27644 tcpdwrdwrlast updated 2018/11/27644 udpdwrdwrlast updated 2018/11/27645 tcpPSSCpssclast updated 2018/11/27645 udpPSSCpssclast updated 2018/11/27646 tcpLDPldplast updated 2018/11/27646 udpLDPldplast updated 2018/11/27647 tcpDHCP Failoverdhcp-failoverlast updated 2018/11/27647 udpDHCP Failoverdhcp-failoverlast updated 2018/11/27648 tcpRegistry Registrar Protocol (RRP)rrplast updated 2018/11/27648 udpRegistry Registrar Protocol (RRP)rrplast updated 2018/11/27649 tcpCadview-3d - streaming 3d models over the internetcadview-3dlast updated 2018/11/27649 udpCadview-3d - streaming 3d models over the internetcadview-3dlast updated 2018/11/27650 tcpOBEXobexlast updated 2018/11/27650 udpOBEXobexlast updated 2018/11/27651 tcpIEEE MMSieee-mmslast updated 2018/11/27651 udpIEEE MMSieee-mmslast updated 2018/11/27652 tcpHELLO_PORThello-portlast updated 2018/11/27652 udpHELLO_PORThello-portlast updated 2018/11/27653 tcpRepCmdrepscmdlast updated 2018/11/27653 udpRepCmdrepscmdlast updated 2018/11/27654 tcpAODVaodvlast updated 2018/11/27654 udpAODVaodvlast updated 2018/11/27655 tcpTINCtinclast updated 2018/11/27655 udpTINCtinclast updated 2018/11/27656 tcpSPMPspmplast updated 2018/11/27656 udpSPMPspmplast updated 2018/11/27657 tcpRMCrmclast updated 2018/11/27657 udpRMCrmclast updated 2018/11/27658 tcpTenFoldtenfoldlast updated 2018/11/27658 udpTenFoldtenfoldlast updated 2018/11/27659 RemovedN/Alast updated 2018/11/27660 tcpMacOS Server Adminmac-srvr-adminlast updated 2018/11/27660 udpMacOS Server Adminmac-srvr-adminlast updated 2018/11/27661 tcpHAPhaplast updated 2018/11/27661 udpHAPhaplast updated 2018/11/27662 tcpPFTPpftplast updated 2018/11/27662 udpPFTPpftplast updated 2018/11/27663 tcpPureNoisepurenoiselast updated 2018/11/27663 udpPureNoisepurenoiselast updated 2018/11/27664 tcpDMTF out-of-band secure web services management protocoloob-ws-httpslast updated 2018/11/27664 udpASF Secure Remote Management and Control Protocolasf-secure-rmcplast updated 2018/11/27665 tcpSun DRsun-drlast updated 2018/11/27665 udpSun DRsun-drlast updated 2018/11/27666 tcpmdqslast updated 2018/11/27666 udpmdqslast updated 2018/11/27666 tcp (doom)doom Id Softwaredoomlast updated 2018/11/27666 udp (doom)doom Id Softwaredoomlast updated 2018/11/27667 tcpcampaign contribution disclosures - SDR Technologiesdiscloselast updated 2018/11/27667 udpcampaign contribution disclosures - SDR Technologiesdiscloselast updated 2018/11/27668 tcpMeCommmecommlast updated 2018/11/27668 udpMeCommmecommlast updated 2018/11/27669 tcpMeRegistermeregisterlast updated 2018/11/27669 udpMeRegistermeregisterlast updated 2018/11/27670 tcpVACDSM-SWSvacdsm-swslast updated 2018/11/27670 udpVACDSM-SWSvacdsm-swslast updated 2018/11/27671 tcpVACDSM-APPvacdsm-applast updated 2018/11/27671 udpVACDSM-APPvacdsm-applast updated 2018/11/27672 tcpVPPS-QUAvpps-qualast updated 2018/11/27672 udpVPPS-QUAvpps-qualast updated 2018/11/27673 tcpCIMPLEXcimplexlast updated 2018/11/27673 udpCIMPLEXcimplexlast updated 2018/11/27674 tcpACAPacaplast updated 2018/11/27674 udpACAPacaplast updated 2018/11/27675 tcpDCTPdctplast updated 2018/11/27675 udpDCTPdctplast updated 2018/11/27676 tcpVPPS Viavpps-vialast updated 2018/11/27676 udpVPPS Viavpps-vialast updated 2018/11/27677 tcpVirtual Presence Protocolvpplast updated 2018/11/27677 udpVirtual Presence Protocolvpplast updated 2018/11/27678 tcpGNU Generation Foundation NCPggf-ncplast updated 2018/11/27678 udpGNU Generation Foundation NCPggf-ncplast updated 2018/11/27679 tcpMRMmrmlast updated 2018/11/27679 udpMRMmrmlast updated 2018/11/27680 tcpentrust-aaasentrust-aaaslast updated 2018/11/27680 udpentrust-aaasentrust-aaaslast updated 2018/11/27681 tcpentrust-aamsentrust-aamslast updated 2018/11/27681 udpentrust-aamsentrust-aamslast updated 2018/11/27682 tcpXFRxfrlast updated 2018/11/27682 udpXFRxfrlast updated 2018/11/27683 tcpCORBA IIOPcorba-iioplast updated 2018/11/27683 udpCORBA IIOPcorba-iioplast updated 2018/11/27684 tcpCORBA IIOP SSLcorba-iiop-ssllast updated 2018/11/27684 udpCORBA IIOP SSLcorba-iiop-ssllast updated 2018/11/27685 tcpMDC Port Mappermdc-portmapperlast updated 2018/11/27685 udpMDC Port Mappermdc-portmapperlast updated 2018/11/27686 tcpHardware Control Protocol Wismarhcp-wismarlast updated 2018/11/27686 udpHardware Control Protocol Wismarhcp-wismarlast updated 2018/11/27687 tcpasipregistryasipregistrylast updated 2018/11/27687 udpasipregistryasipregistrylast updated 2018/11/27688 tcpApplianceWare managment protocolrealm-rusdlast updated 2018/11/27688 udpApplianceWare managment protocolrealm-rusdlast updated 2018/11/27689 tcpNMAPnmaplast updated 2018/11/27689 udpNMAPnmaplast updated 2018/11/27690 tcpVelneo Application Transfer Protocolvatplast updated 2018/11/27690 udpVelneo Application Transfer Protocolvatplast updated 2018/11/27691 tcpMS Exchange Routingmsexch-routinglast updated 2018/11/27691 udpMS Exchange Routingmsexch-routinglast updated 2018/11/27692 tcpHyperwave-ISPhyperwave-isplast updated 2018/11/27692 udpHyperwave-ISPhyperwave-isplast updated 2018/11/27693 tcpalmanid Connection Endpointconnendplast updated 2018/11/27693 udpalmanid Connection Endpointconnendplast updated 2018/11/27694 tcpha-clusterha-clusterlast updated 2018/11/27694 udpha-clusterha-clusterlast updated 2018/11/27695 tcpIEEE-MMS-SSLieee-mms-ssllast updated 2018/11/27695 udpIEEE-MMS-SSLieee-mms-ssllast updated 2018/11/27696 tcpRUSHDrushdlast updated 2018/11/27696 udpRUSHDrushdlast updated 2018/11/27697 tcpUUIDGENuuidgenlast updated 2018/11/27697 udpUUIDGENuuidgenlast updated 2018/11/27698 tcpOLSRolsrlast updated 2018/11/27698 udpOLSRolsrlast updated 2018/11/27699 tcpAccess Networkaccessnetworklast updated 2018/11/27699 udpAccess Networkaccessnetworklast updated 2018/11/27700 tcpExtensible Provisioning Protocolepplast updated 2018/11/27700 udpExtensible Provisioning Protocolepplast updated 2018/11/27701 tcpLink Management Protocol (LMP)lmplast updated 2018/11/27701 udpLink Management Protocol (LMP)lmplast updated 2018/11/27702 tcpIRIS over BEEPiris-beeplast updated 2018/11/27702 udpIRIS over BEEPiris-beeplast updated 2018/11/27703 UnassignedN/Alast updated 2018/11/27704 tcperrlog copy/server daemonelcsdlast updated 2018/11/27704 udperrlog copy/server daemonelcsdlast updated 2018/11/27705 tcpAgentXagentxlast updated 2018/11/27705 udpAgentXagentxlast updated 2018/11/27706 tcpSILCsilclast updated 2018/11/27706 udpSILCsilclast updated 2018/11/27707 tcpBorland DSJborland-dsjlast updated 2018/11/27707 udpBorland DSJborland-dsjlast updated 2018/11/27708 UnassignedN/Alast updated 2018/11/27709 tcpEntrust Key Management Service Handlerentrust-kmshlast updated 2018/11/27709 udpEntrust Key Management Service Handlerentrust-kmshlast updated 2018/11/27710 tcpEntrust Administration Service Handlerentrust-ashlast updated 2018/11/27710 udpEntrust Administration Service Handlerentrust-ashlast updated 2018/11/27711 tcpCisco TDPcisco-tdplast updated 2018/11/27711 udpCisco TDPcisco-tdplast updated 2018/11/27712 tcpTBRPFtbrpflast updated 2018/11/27712 udpTBRPFtbrpflast updated 2018/11/27713 tcpIRIS over XPCiris-xpclast updated 2018/11/27713 udpIRIS over XPCiris-xpclast updated 2018/11/27714 tcpIRIS over XPCSiris-xpcslast updated 2018/11/27714 udpIRIS over XPCSiris-xpcslast updated 2018/11/27715 tcpIRIS-LWZiris-lwzlast updated 2018/11/27715 udpIRIS-LWZiris-lwzlast updated 2018/11/27716 udpPANA Messagespanalast updated 2018/11/27717-728 UnassignedN/Alast updated 2018/11/27729 tcpIBM NetView DM/6000 Server/Clientnetviewdm1last updated 2018/11/27729 udpIBM NetView DM/6000 Server/Clientnetviewdm1last updated 2018/11/27730 tcpIBM NetView DM/6000 send/tcpnetviewdm2last updated 2018/11/27730 udpIBM NetView DM/6000 send/tcpnetviewdm2last updated 2018/11/27731 tcpIBM NetView DM/6000 receive/tcpnetviewdm3last updated 2018/11/27731 udpIBM NetView DM/6000 receive/tcpnetviewdm3last updated 2018/11/27732-740 UnassignedN/Alast updated 2018/11/27741 tcpnetGWnetgwlast updated 2018/11/27741 udpnetGWnetgwlast updated 2018/11/27742 tcpNetwork based Rev. Cont. Sys.netrcslast updated 2018/11/27742 udpNetwork based Rev. Cont. Sys.netrcslast updated 2018/11/27743 UnassignedN/Alast updated 2018/11/27744 tcpFlexible License Managerflexlmlast updated 2018/11/27744 udpFlexible License Managerflexlmlast updated 2018/11/27745-746 UnassignedN/Alast updated 2018/11/27747 tcpFujitsu Device Controlfujitsu-devlast updated 2018/11/27747 udpFujitsu Device Controlfujitsu-devlast updated 2018/11/27748 tcpRussell Info Sci Calendar Managerris-cmlast updated 2018/11/27748 udpRussell Info Sci Calendar Managerris-cmlast updated 2018/11/27749 tcpkerberos administrationkerberos-admlast updated 2018/11/27749 udpkerberos administrationkerberos-admlast updated 2018/11/27750 tcprfilelast updated 2018/11/27750 udploadavlast updated 2018/11/27750 udp (kerberos-iv)kerberos version ivkerberos-ivlast updated 2018/11/27751 tcppumplast updated 2018/11/27751 udppumplast updated 2018/11/27752 tcpqrhlast updated 2018/11/27752 udpqrhlast updated 2018/11/27753 tcprrhlast updated 2018/11/27753 udprrhlast updated 2018/11/27754 tcpsendtelllast updated 2018/11/27754 udpsendtelllast updated 2018/11/27755-757 UnassignedN/Alast updated 2018/11/27758 tcpnloginlast updated 2018/11/27758 udpnloginlast updated 2018/11/27759 tcpconlast updated 2018/11/27759 udpconlast updated 2018/11/27760 tcpnslast updated 2018/11/27760 udpnslast updated 2018/11/27761 tcprxelast updated 2018/11/27761 udprxelast updated 2018/11/27762 tcpquotadlast updated 2018/11/27762 udpquotadlast updated 2018/11/27763 tcpcycleservlast updated 2018/11/27763 udpcycleservlast updated 2018/11/27764 tcpomservlast updated 2018/11/27764 udpomservlast updated 2018/11/27765 tcpwebsterlast updated 2018/11/27765 udpwebsterlast updated 2018/11/27766 UnassignedN/Alast updated 2018/11/27767 tcpphonephonebooklast updated 2018/11/27767 udpphonephonebooklast updated 2018/11/27768 UnassignedN/Alast updated 2018/11/27769 tcpvidlast updated 2018/11/27769 udpvidlast updated 2018/11/27770 tcpcadlocklast updated 2018/11/27770 udpcadlocklast updated 2018/11/27771 tcprtiplast updated 2018/11/27771 udprtiplast updated 2018/11/27772 tcpcycleserv2last updated 2018/11/27772 udpcycleserv2last updated 2018/11/27773 tcpsubmitlast updated 2018/11/27773 udpnotifylast updated 2018/11/27774 tcprpasswdlast updated 2018/11/27774 udpIANA assigned this well-formed service name as a replacement for "acmaint_dbd".acmaint-dbdlast updated 2018/11/27774 udp (acmaint_dbd)acmaint_dbdlast updated 2018/11/27775 tcpentomblast updated 2018/11/27775 udpIANA assigned this well-formed service name as a replacement for "acmaint_transd".acmaint-transdlast updated 2018/11/27775 udp (acmaint_transd)acmaint_transdlast updated 2018/11/27776 tcpwpageslast updated 2018/11/27776 udpwpageslast updated 2018/11/27777 tcpMultiling HTTPmultiling-httplast updated 2018/11/27777 udpMultiling HTTPmultiling-httplast updated 2018/11/27778-779 UnassignedN/Alast updated 2018/11/27780 tcpwpgslast updated 2018/11/27780 udpwpgslast updated 2018/11/27781-785 UnassignedN/Alast updated 2018/11/27786 UnassignedN/Alast updated 2018/11/27787 UnassignedN/Alast updated 2018/11/27788-799 UnassignedN/Alast updated 2018/11/27800 tcpIANA assigned this well-formed service name as a replacement for "mdbs_daemon".mdbs-daemonlast updated 2018/11/27800 tcp (mdbs_daemon)mdbs_daemonlast updated 2018/11/27800 udpIANA assigned this well-formed service name as a replacement for "mdbs_daemon".mdbs-daemonlast updated 2018/11/27800 udp (mdbs_daemon)mdbs_daemonlast updated 2018/11/27801 tcpdevicelast updated 2018/11/27801 udpdevicelast updated 2018/11/27802 tcpModbus Application Protocol Securembap-slast updated 2018/11/27802 udpModbus Application Protocol Securembap-slast updated 2018/11/27803-809 UnassignedN/Alast updated 2018/11/27810 tcpFCPfcp-udplast updated 2018/11/27810 udpFCP Datagramfcp-udplast updated 2018/11/27811-827 UnassignedN/Alast updated 2018/11/27828 tcpitm-mcell-sitm-mcell-slast updated 2018/11/27828 udpitm-mcell-sitm-mcell-slast updated 2018/11/27829 tcpPKIX-3 CA/RApkix-3-ca-ralast updated 2018/11/27829 udpPKIX-3 CA/RApkix-3-ca-ralast updated 2018/11/27830 tcpNETCONF over SSHnetconf-sshlast updated 2018/11/27830 udpNETCONF over SSHnetconf-sshlast updated 2018/11/27831 tcpNETCONF over BEEPnetconf-beeplast updated 2018/11/27831 udpNETCONF over BEEPnetconf-beeplast updated 2018/11/27832 tcpNETCONF for SOAP over HTTPSnetconfsoaphttplast updated 2018/11/27832 udpNETCONF for SOAP over HTTPSnetconfsoaphttplast updated 2018/11/27833 tcpNETCONF for SOAP over BEEPnetconfsoapbeeplast updated 2018/11/27833 udpNETCONF for SOAP over BEEPnetconfsoapbeeplast updated 2018/11/27834-846 UnassignedN/Alast updated 2018/11/27847 tcpdhcp-failover 2dhcp-failover2last updated 2018/11/27847 udpdhcp-failover 2dhcp-failover2last updated 2018/11/27848 tcpGDOIgdoilast updated 2018/11/27848 udpGDOIgdoilast updated 2018/11/27849-852 UnassignedN/Alast updated 2018/11/27853 tcpDNS query-response protocol run over TLS/DTLSdomain-slast updated 2018/11/27853 udpDNS query-response protocol run over TLS/DTLSdomain-slast updated 2018/11/27854 tcpDynamic Link Exchange Protocol (DLEP)dleplast updated 2018/11/27854 udpDynamic Link Exchange Protocol (DLEP)dleplast updated 2018/11/27855-859 UnassignedN/Alast updated 2018/11/27860 tcpiSCSIiscsilast updated 2018/11/27860 udpiSCSIiscsilast updated 2018/11/27861 tcpOWAMP-Controlowamp-controllast updated 2018/11/27861 udpOWAMP-Controlowamp-controllast updated 2018/11/27862 tcpTwo-way Active Measurement Protocol (TWAMP) Controltwamp-controllast updated 2018/11/27862 udpTwo-way Active Measurement Protocol (TWAMP) Controltwamp-controllast updated 2018/11/27863-872 UnassignedN/Alast updated 2018/11/27873 tcprsyncrsynclast updated 2018/11/27873 udprsyncrsynclast updated 2018/11/27874-885 UnassignedN/Alast updated 2018/11/27886 tcpICL coNETion locate servericlcnet-locatelast updated 2018/11/27886 udpICL coNETion locate servericlcnet-locatelast updated 2018/11/27887 tcpICL coNETion server info IANA assigned this well-formed service name as a replacement for "iclcnet_svinfo".iclcnet-svinfolast updated 2018/11/27887 tcp (iclcnet_svinfo)ICL coNETion server infoiclcnet_svinfolast updated 2018/11/27887 udpICL coNETion server info IANA assigned this well-formed service name as a replacement for "iclcnet_svinfo".iclcnet-svinfolast updated 2018/11/27887 udp (iclcnet_svinfo)ICL coNETion server infoiclcnet_svinfolast updated 2018/11/27888 tcpAccessBuilderaccessbuilderlast updated 2018/11/27888 udpAccessBuilderaccessbuilderlast updated 2018/11/27888 tcp (cddbp)CD Database Protocolcddbplast updated 2018/11/27889-899 UnassignedN/Alast updated 2018/11/27900 tcpOMG Initial Refsomginitialrefslast updated 2018/11/27900 udpOMG Initial Refsomginitialrefslast updated 2018/11/27901 tcpSMPNAMERESsmpnamereslast updated 2018/11/27901 udpSMPNAMERESsmpnamereslast updated 2018/11/27902 tcpself documenting Telnet Doorideafarm-doorlast updated 2018/11/27902 udpself documenting Door: send 0x00 for infoideafarm-doorlast updated 2018/11/27903 tcpself documenting Telnet Panic Doorideafarm-paniclast updated 2018/11/27903 udpself documenting Panic Door: send 0x00 for infoideafarm-paniclast updated 2018/11/27904-909 UnassignedN/Alast updated 2018/11/27910 tcpKerberized Internet Negotiation of Keys (KINK)kinklast updated 2018/11/27910 udpKerberized Internet Negotiation of Keys (KINK)kinklast updated 2018/11/27911 tcpxact-backupxact-backuplast updated 2018/11/27911 udpxact-backupxact-backuplast updated 2018/11/27912 tcpAPEX relay-relay serviceapex-meshlast updated 2018/11/27912 udpAPEX relay-relay serviceapex-meshlast updated 2018/11/27913 tcpAPEX endpoint-relay serviceapex-edgelast updated 2018/11/27913 udpAPEX endpoint-relay serviceapex-edgelast updated 2018/11/27914-952 UnassignedN/Alast updated 2018/11/27953 tcpBIND9 remote name daemon controllerrndclast updated 2018/11/27953 udpReservedN/Alast updated 2018/11/27954-988 UnassignedN/Alast updated 2018/11/27989 tcpftp protocol, data, over TLS/SSLftps-datalast updated 2018/11/27989 udpftp protocol, data, over TLS/SSLftps-datalast updated 2018/11/27990 tcpftp protocol, control, over TLS/SSLftpslast updated 2018/11/27990 udpftp protocol, control, over TLS/SSLftpslast updated 2018/11/27991 tcpNetnews Administration Systemnaslast updated 2018/11/27991 udpNetnews Administration Systemnaslast updated 2018/11/27992 tcptelnet protocol over TLS/SSLtelnetslast updated 2018/11/27992 udptelnet protocol over TLS/SSLtelnetslast updated 2018/11/27993 tcpIMAP over TLS protocolimapslast updated 2018/11/27993 udpimap4 protocol over TLS/SSLimapslast updated 2018/11/27994 tcpReservedN/Alast updated 2018/11/27994 udpReservedN/Alast updated 2018/11/27995 tcpPOP3 over TLS protocolpop3slast updated 2018/11/27995 udppop3 protocol over TLS/SSL (was spop3)pop3slast updated 2018/11/27996 tcpvsinetvsinetlast updated 2018/11/27996 udpvsinetvsinetlast updated 2018/11/27997 tcpmaitrdlast updated 2018/11/27997 udpmaitrdlast updated 2018/11/27998 tcpbusboylast updated 2018/11/27998 udppuparplast updated 2018/11/27999 tcpgarconlast updated 2018/11/27999 udpApplix acapplixlast updated 2018/11/27999 tcp (puprouter)puprouterlast updated 2018/11/27999 udp (puprouter)puprouterlast updated 2018/11/271000 tcpcadlock2last updated 2018/11/271000 udpcadlock2last updated 2018/11/271001 tcpHTTP Web Pushwebpushlast updated 2018/11/271001 udpReservedN/Alast updated 2018/11/271002-1007 UnassignedN/Alast updated 2018/11/271008 udpPossibly used by Sun Solaris????N/Alast updated 2018/11/271009 UnassignedN/Alast updated 2018/11/271010 tcpsurfsurflast updated 2018/11/271010 udpsurfsurflast updated 2018/11/271011-1020 ReservedN/Alast updated 2018/11/271021 tcpRFC3692-style Experiment 1exp1last updated 2018/11/271021 udpRFC3692-style Experiment 1exp1last updated 2018/11/271021 sctpRFC3692-style Experiment 1exp1last updated 2018/11/271021 dccpRFC3692-style Experiment 1exp1last updated 2018/11/271022 tcpRFC3692-style Experiment 2exp2last updated 2018/11/271022 udpRFC3692-style Experiment 2exp2last updated 2018/11/271022 sctpRFC3692-style Experiment 2exp2last updated 2018/11/271022 dccpRFC3692-style Experiment 2exp2last updated 2018/11/271023 tcpReservedN/Alast updated 2018/11/271023 udpReservedN/Alast updated 2018/11/271024 tcpReservedN/Alast updated 2018/11/271024 udpReservedN/Alast updated 2018/11/271025 tcpnetwork blackjackblackjacklast updated 2018/11/271025 udpnetwork blackjackblackjacklast updated 2018/11/271026 tcpCalendar Access Protocolcaplast updated 2018/11/271026 udpCalendar Access Protocolcaplast updated 2018/11/271027 udpIPv6 Behind NAT44 CPEs6a44last updated 2018/11/271027 tcpReservedN/Alast updated 2018/11/271028 DeprecatedN/Alast updated 2018/11/271029 tcpSolid Mux Serversolid-muxlast updated 2018/11/271029 udpSolid Mux Serversolid-muxlast updated 2018/11/271030 ReservedN/Alast updated 2018/11/271031 ReservedN/Alast updated 2018/11/271032 ReservedN/Alast updated 2018/11/271033 tcplocal netinfo portnetinfo-locallast updated 2018/11/271033 udplocal netinfo portnetinfo-locallast updated 2018/11/271034 tcpActiveSync Notificationsactivesynclast updated 2018/11/271034 udpActiveSync Notificationsactivesynclast updated 2018/11/271035 tcpMX-XR RPCmxxrloginlast updated 2018/11/271035 udpMX-XR RPCmxxrloginlast updated 2018/11/271036 tcpNebula Secure Segment Transfer Protocolnsstplast updated 2018/11/271036 udpNebula Secure Segment Transfer Protocolnsstplast updated 2018/11/271037 tcpAMSamslast updated 2018/11/271037 udpAMSamslast updated 2018/11/271038 tcpMessage Tracking Query Protocolmtqplast updated 2018/11/271038 udpMessage Tracking Query Protocolmtqplast updated 2018/11/271039 tcpStreamlined Blackholesbllast updated 2018/11/271039 udpStreamlined Blackholesbllast updated 2018/11/271040 tcpNetarx Netcarenetarxlast updated 2018/11/271040 udpNetarx Netcarenetarxlast updated 2018/11/271041 tcpAK2 Productdanf-ak2last updated 2018/11/271041 udpAK2 Productdanf-ak2last updated 2018/11/271042 tcpSubnet Roamingafroglast updated 2018/11/271042 udpSubnet Roamingafroglast updated 2018/11/271043 tcpBOINC Client Controlboinc-clientlast updated 2018/11/271043 udpBOINC Client Controlboinc-clientlast updated 2018/11/271044 tcpDev Consortium Utilitydcutilitylast updated 2018/11/271044 udpDev Consortium Utilitydcutilitylast updated 2018/11/271045 tcpFingerprint Image Transfer Protocolfpitplast updated 2018/11/271045 udpFingerprint Image Transfer Protocolfpitplast updated 2018/11/271046 tcpWebFilter Remote Monitorwfremotertmlast updated 2018/11/271046 udpWebFilter Remote Monitorwfremotertmlast updated 2018/11/271047 tcpSun's NEO Object Request Brokerneod1last updated 2018/11/271047 udpSun's NEO Object Request Brokerneod1last updated 2018/11/271048 tcpSun's NEO Object Request Brokerneod2last updated 2018/11/271048 udpSun's NEO Object Request Brokerneod2last updated 2018/11/271049 tcpTobit David Postman VPMNtd-postmanlast updated 2018/11/271049 udpTobit David Postman VPMNtd-postmanlast updated 2018/11/271050 tcpCORBA Management Agentcmalast updated 2018/11/271050 udpCORBA Management Agentcmalast updated 2018/11/271051 tcpOptima VNEToptima-vnetlast updated 2018/11/271051 udpOptima VNEToptima-vnetlast updated 2018/11/271052 tcpDynamic DNS Toolsddtlast updated 2018/11/271052 udpDynamic DNS Toolsddtlast updated 2018/11/271053 tcpRemote Assistant (RA)remote-aslast updated 2018/11/271053 udpRemote Assistant (RA)remote-aslast updated 2018/11/271054 tcpBRVREADbrvreadlast updated 2018/11/271054 udpBRVREADbrvreadlast updated 2018/11/271055 tcpANSYS - License Manageransyslmdlast updated 2018/11/271055 udpANSYS - License Manageransyslmdlast updated 2018/11/271056 tcpVFOvfolast updated 2018/11/271056 udpVFOvfolast updated 2018/11/271057 tcpSTARTRONstartronlast updated 2018/11/271057 udpSTARTRONstartronlast updated 2018/11/271058 tcpnimnimlast updated 2018/11/271058 udpnimnimlast updated 2018/11/271059 tcpnimregnimreglast updated 2018/11/271059 udpnimregnimreglast updated 2018/11/271060 tcpPOLESTARpolestarlast updated 2018/11/271060 udpPOLESTARpolestarlast updated 2018/11/271061 tcpKIOSKkiosklast updated 2018/11/271061 udpKIOSKkiosklast updated 2018/11/271062 tcpVeracityveracitylast updated 2018/11/271062 udpVeracityveracitylast updated 2018/11/271063 tcpKyoceraNetDevkyoceranetdevlast updated 2018/11/271063 udpKyoceraNetDevkyoceranetdevlast updated 2018/11/271064 tcpJSTELjstellast updated 2018/11/271064 udpJSTELjstellast updated 2018/11/271065 tcpSYSCOMLANsyscomlanlast updated 2018/11/271065 udpSYSCOMLANsyscomlanlast updated 2018/11/271066 tcpFPO-FNSfpo-fnslast updated 2018/11/271066 udpFPO-FNSfpo-fnslast updated 2018/11/271067 tcpInstallation Bootstrap Proto. Serv. IANA assigned this well-formed service name as a replacement for "instl_boots".instl-bootslast updated 2018/11/271067 tcp (instl_boots)Installation Bootstrap Proto. Serv.instl_bootslast updated 2018/11/271067 udpInstallation Bootstrap Proto. Serv. IANA assigned this well-formed service name as a replacement for "instl_boots".instl-bootslast updated 2018/11/271067 udp (instl_boots)Installation Bootstrap Proto. Serv.instl_bootslast updated 2018/11/271068 tcpInstallation Bootstrap Proto. Cli. IANA assigned this well-formed service name as a replacement for "instl_bootc".instl-bootclast updated 2018/11/271068 tcp (instl_bootc)Installation Bootstrap Proto. Cli.instl_bootclast updated 2018/11/271068 udpInstallation Bootstrap Proto. Cli. IANA assigned this well-formed service name as a replacement for "instl_bootc".instl-bootclast updated 2018/11/271068 udp (instl_bootc)Installation Bootstrap Proto. Cli.instl_bootclast updated 2018/11/271069 tcpCOGNEX-INSIGHTcognex-insightlast updated 2018/11/271069 udpCOGNEX-INSIGHTcognex-insightlast updated 2018/11/271070 tcpGMRUpdateSERVgmrupdateservlast updated 2018/11/271070 udpGMRUpdateSERVgmrupdateservlast updated 2018/11/271071 tcpBSQUARE-VOIPbsquare-voiplast updated 2018/11/271071 udpBSQUARE-VOIPbsquare-voiplast updated 2018/11/271072 tcpCARDAXcardaxlast updated 2018/11/271072 udpCARDAXcardaxlast updated 2018/11/271073 tcpBridge Controlbridgecontrollast updated 2018/11/271073 udpBridge Controlbridgecontrollast updated 2018/11/271074 tcpWarmspot Management ProtocolwarmspotMgmtlast updated 2018/11/271074 udpWarmspot Management ProtocolwarmspotMgmtlast updated 2018/11/271075 tcpRDRMSHCrdrmshclast updated 2018/11/271075 udpRDRMSHCrdrmshclast updated 2018/11/271076 tcpDAB STI-Cdab-sti-clast updated 2018/11/271076 udpDAB STI-Cdab-sti-clast updated 2018/11/271077 tcpIMGamesimgameslast updated 2018/11/271077 udpIMGamesimgameslast updated 2018/11/271078 tcpAvocent Proxy Protocolavocent-proxylast updated 2018/11/271078 udpAvocent Proxy Protocolavocent-proxylast updated 2018/11/271079 tcpASPROVATalkasprovatalklast updated 2018/11/271079 udpASPROVATalkasprovatalklast updated 2018/11/271080 tcpSockssockslast updated 2018/11/271080 udpSockssockslast updated 2018/11/271081 tcpPVUNIWIENpvuniwienlast updated 2018/11/271081 udpPVUNIWIENpvuniwienlast updated 2018/11/271082 tcpAMT-ESD-PROTamt-esd-protlast updated 2018/11/271082 udpAMT-ESD-PROTamt-esd-protlast updated 2018/11/271083 tcpAnasoft License Manageransoft-lm-1last updated 2018/11/271083 udpAnasoft License Manageransoft-lm-1last updated 2018/11/271084 tcpAnasoft License Manageransoft-lm-2last updated 2018/11/271084 udpAnasoft License Manageransoft-lm-2last updated 2018/11/271085 tcpWeb Objectswebobjectslast updated 2018/11/271085 udpWeb Objectswebobjectslast updated 2018/11/271086 tcpCPL Scrambler Loggingcplscrambler-lglast updated 2018/11/271086 udpCPL Scrambler Loggingcplscrambler-lglast updated 2018/11/271087 tcpCPL Scrambler Internalcplscrambler-inlast updated 2018/11/271087 udpCPL Scrambler Internalcplscrambler-inlast updated 2018/11/271088 tcpCPL Scrambler Alarm Logcplscrambler-allast updated 2018/11/271088 udpCPL Scrambler Alarm Logcplscrambler-allast updated 2018/11/271089 tcpFF Annunciationff-annunclast updated 2018/11/271089 udpFF Annunciationff-annunclast updated 2018/11/271090 tcpFF Fieldbus Message Specificationff-fmslast updated 2018/11/271090 udpFF Fieldbus Message Specificationff-fmslast updated 2018/11/271091 tcpFF System Managementff-smlast updated 2018/11/271091 udpFF System Managementff-smlast updated 2018/11/271092 tcpOpen Business Reporting Protocolobrpdlast updated 2018/11/271092 udpOpen Business Reporting Protocolobrpdlast updated 2018/11/271093 tcpPROOFDproofdlast updated 2018/11/271093 udpPROOFDproofdlast updated 2018/11/271094 tcpROOTDrootdlast updated 2018/11/271094 udpROOTDrootdlast updated 2018/11/271095 tcpNICELinknicelinklast updated 2018/11/271095 udpNICELinknicelinklast updated 2018/11/271096 tcpCommon Name Resolution Protocolcnrprotocollast updated 2018/11/271096 udpCommon Name Resolution Protocolcnrprotocollast updated 2018/11/271097 tcpSun Cluster Managersunclustermgrlast updated 2018/11/271097 udpSun Cluster Managersunclustermgrlast updated 2018/11/271098 tcpRMI Activationrmiactivationlast updated 2018/11/271098 udpRMI Activationrmiactivationlast updated 2018/11/271099 tcpRMI Registryrmiregistrylast updated 2018/11/271099 udpRMI Registryrmiregistrylast updated 2018/11/271100 tcpMCTPmctplast updated 2018/11/271100 udpMCTPmctplast updated 2018/11/271101 tcpPT2-DISCOVERpt2-discoverlast updated 2018/11/271101 udpPT2-DISCOVERpt2-discoverlast updated 2018/11/271102 tcpADOBE SERVER 1adobeserver-1last updated 2018/11/271102 udpADOBE SERVER 1adobeserver-1last updated 2018/11/271103 tcpADOBE SERVER 2adobeserver-2last updated 2018/11/271103 udpADOBE SERVER 2adobeserver-2last updated 2018/11/271104 tcpXRLxrllast updated 2018/11/271104 udpXRLxrllast updated 2018/11/271105 tcpFTRANHCftranhclast updated 2018/11/271105 udpFTRANHCftranhclast updated 2018/11/271106 tcpISOIPSIGPORT-1isoipsigport-1last updated 2018/11/271106 udpISOIPSIGPORT-1isoipsigport-1last updated 2018/11/271107 tcpISOIPSIGPORT-2isoipsigport-2last updated 2018/11/271107 udpISOIPSIGPORT-2isoipsigport-2last updated 2018/11/271108 tcpratio-adpratio-adplast updated 2018/11/271108 udpratio-adpratio-adplast updated 2018/11/271109 Reserved - IANAN/Alast updated 2018/11/271110 tcpStart web admin serverwebadmstartlast updated 2018/11/271110 udpClient status infonfsd-keepalivelast updated 2018/11/271111 tcpLM Social Serverlmsocialserverlast updated 2018/11/271111 udpLM Social Serverlmsocialserverlast updated 2018/11/271112 tcpIntelligent Communication Protocolicplast updated 2018/11/271112 udpIntelligent Communication Protocolicplast updated 2018/11/271113 tcpLicklider Transmission Protocolltp-deepspacelast updated 2018/11/271113 udpLicklider Transmission Protocolltp-deepspacelast updated 2018/11/271113 dccpLicklider Transmission Protocolltp-deepspacelast updated 2018/11/271114 tcpMini SQLmini-sqllast updated 2018/11/271114 udpMini SQLmini-sqllast updated 2018/11/271115 tcpARDUS Transferardus-trnslast updated 2018/11/271115 udpARDUS Transferardus-trnslast updated 2018/11/271116 tcpARDUS Controlardus-cntllast updated 2018/11/271116 udpARDUS Controlardus-cntllast updated 2018/11/271117 tcpARDUS Multicast Transferardus-mtrnslast updated 2018/11/271117 udpARDUS Multicast Transferardus-mtrnslast updated 2018/11/271118 tcpSACREDsacredlast updated 2018/11/271118 udpSACREDsacredlast updated 2018/11/271119 Chat/Game Protocolbnetgamelast updated 2018/11/271119 Chat/Game Protocolbnetgamelast updated 2018/11/271120 File Transfer Protocolbnetfilelast updated 2018/11/271120 File Transfer Protocolbnetfilelast updated 2018/11/271121 tcpDatalode RMPPrmpplast updated 2018/11/271121 udpDatalode RMPPrmpplast updated 2018/11/271122 tcpavailant-mgravailant-mgrlast updated 2018/11/271122 udpavailant-mgravailant-mgrlast updated 2018/11/271123 tcpMurraymurraylast updated 2018/11/271123 udpMurraymurraylast updated 2018/11/271124 tcpHP VMM Controlhpvmmcontrollast updated 2018/11/271124 udpHP VMM Controlhpvmmcontrollast updated 2018/11/271125 tcpHP VMM Agenthpvmmagentlast updated 2018/11/271125 udpHP VMM Agenthpvmmagentlast updated 2018/11/271126 tcpHP VMM Agenthpvmmdatalast updated 2018/11/271126 udpHP VMM Agenthpvmmdatalast updated 2018/11/271127 tcpKWDB Remote Communicationkwdb-commnlast updated 2018/11/271127 udpKWDB Remote Communicationkwdb-commnlast updated 2018/11/271128 tcpSAPHostControl over SOAP/HTTPsaphostctrllast updated 2018/11/271128 udpSAPHostControl over SOAP/HTTPsaphostctrllast updated 2018/11/271129 tcpSAPHostControl over SOAP/HTTPSsaphostctrlslast updated 2018/11/271129 udpSAPHostControl over SOAP/HTTPSsaphostctrlslast updated 2018/11/271130 tcpCAC App Service Protocolcasplast updated 2018/11/271130 udpCAC App Service Protocolcasplast updated 2018/11/271131 tcpCAC App Service Protocol Encriptedcaspssllast updated 2018/11/271131 udpCAC App Service Protocol Encriptedcaspssllast updated 2018/11/271132 tcpKVM-via-IP Management Servicekvm-via-iplast updated 2018/11/271132 udpKVM-via-IP Management Servicekvm-via-iplast updated 2018/11/271133 tcpData Flow Networkdfnlast updated 2018/11/271133 udpData Flow Networkdfnlast updated 2018/11/271134 tcpMicroAPL APLXaplxlast updated 2018/11/271134 udpMicroAPL APLXaplxlast updated 2018/11/271135 tcpOmniVision Communication Serviceomnivisionlast updated 2018/11/271135 udpOmniVision Communication Serviceomnivisionlast updated 2018/11/271136 tcpHHB Gateway Controlhhb-gatewaylast updated 2018/11/271136 udpHHB Gateway Controlhhb-gatewaylast updated 2018/11/271137 tcpTRIM Workgroup Servicetrimlast updated 2018/11/271137 udpTRIM Workgroup Servicetrimlast updated 2018/11/271138 tcpencrypted admin requests IANA assigned this well-formed service name as a replacement for "encrypted_admin".encrypted-adminlast updated 2018/11/271138 tcp (encrypted_admin)encrypted admin requestsencrypted_adminlast updated 2018/11/271138 udpencrypted admin requests IANA assigned this well-formed service name as a replacement for "encrypted_admin".encrypted-adminlast updated 2018/11/271138 udp (encrypted_admin)encrypted admin requestsencrypted_adminlast updated 2018/11/271139 tcpEnterprise Virtual Managerevmlast updated 2018/11/271139 udpEnterprise Virtual Managerevmlast updated 2018/11/271140 tcpAutoNOC Network Operations Protocolautonoclast updated 2018/11/271140 udpAutoNOC Network Operations Protocolautonoclast updated 2018/11/271141 tcpUser Message Servicemxomsslast updated 2018/11/271141 udpUser Message Servicemxomsslast updated 2018/11/271142 tcpUser Discovery Serviceedtoolslast updated 2018/11/271142 udpUser Discovery Serviceedtoolslast updated 2018/11/271143 tcpInfomatryx Exchangeimyxlast updated 2018/11/271143 udpInfomatryx Exchangeimyxlast updated 2018/11/271144 tcpFusion Scriptfuscriptlast updated 2018/11/271144 udpFusion Scriptfuscriptlast updated 2018/11/271145 tcpX9 iCue Show Controlx9-icuelast updated 2018/11/271145 udpX9 iCue Show Controlx9-icuelast updated 2018/11/271146 tcpaudit transferaudit-transferlast updated 2018/11/271146 udpaudit transferaudit-transferlast updated 2018/11/271147 tcpCAPIoverLANcapioverlanlast updated 2018/11/271147 udpCAPIoverLANcapioverlanlast updated 2018/11/271148 tcpElfiq Replication Serviceelfiq-repllast updated 2018/11/271148 udpElfiq Replication Serviceelfiq-repllast updated 2018/11/271149 tcpBlueView Sonar Servicebvtsonarlast updated 2018/11/271149 udpBlueView Sonar Servicebvtsonarlast updated 2018/11/271150 tcpBlaze File Serverblazelast updated 2018/11/271150 udpBlaze File Serverblazelast updated 2018/11/271151 tcpUnizensus Login Serverunizensuslast updated 2018/11/271151 udpUnizensus Login Serverunizensuslast updated 2018/11/271152 tcpWinpopup LAN Messengerwinpoplanmesslast updated 2018/11/271152 udpWinpopup LAN Messengerwinpoplanmesslast updated 2018/11/271153 tcpANSI C12.22 Portc1222-acselast updated 2018/11/271153 udpANSI C12.22 Portc1222-acselast updated 2018/11/271154 tcpCommunity Serviceresacommunitylast updated 2018/11/271154 udpCommunity Serviceresacommunitylast updated 2018/11/271155 tcpNetwork File Accessnfalast updated 2018/11/271155 udpNetwork File Accessnfalast updated 2018/11/271156 tcpiasControl OMSiascontrol-omslast updated 2018/11/271156 udpiasControl OMSiascontrol-omslast updated 2018/11/271157 tcpOracle iASControliascontrollast updated 2018/11/271157 udpOracle iASControliascontrollast updated 2018/11/271158 tcpdbControl OMSdbcontrol-omslast updated 2018/11/271158 udpdbControl OMSdbcontrol-omslast updated 2018/11/271159 tcpOracle OMSoracle-omslast updated 2018/11/271159 udpOracle OMSoracle-omslast updated 2018/11/271160 tcpDB Lite Mult-User Serverolsvlast updated 2018/11/271160 udpDB Lite Mult-User Serverolsvlast updated 2018/11/271161 tcpHealth Pollinghealth-pollinglast updated 2018/11/271161 udpHealth Pollinghealth-pollinglast updated 2018/11/271162 tcpHealth Traphealth-traplast updated 2018/11/271162 udpHealth Traphealth-traplast updated 2018/11/271163 tcpSmartDialer Data Protocolsddplast updated 2018/11/271163 udpSmartDialer Data Protocolsddplast updated 2018/11/271164 tcpQSM Proxy Serviceqsm-proxylast updated 2018/11/271164 udpQSM Proxy Serviceqsm-proxylast updated 2018/11/271165 tcpQSM GUI Serviceqsm-guilast updated 2018/11/271165 udpQSM GUI Serviceqsm-guilast updated 2018/11/271166 tcpQSM RemoteExecqsm-remotelast updated 2018/11/271166 udpQSM RemoteExecqsm-remotelast updated 2018/11/271167 tcpCisco IP SLAs Control Protocolcisco-ipslalast updated 2018/11/271167 udpCisco IP SLAs Control Protocolcisco-ipslalast updated 2018/11/271167 sctpCisco IP SLAs Control Protocolcisco-ipslalast updated 2018/11/271168 tcpVChat Conference Servicevchatlast updated 2018/11/271168 udpVChat Conference Servicevchatlast updated 2018/11/271169 tcpTRIPWIREtripwirelast updated 2018/11/271169 udpTRIPWIREtripwirelast updated 2018/11/271170 tcpAT+C License Manageratc-lmlast updated 2018/11/271170 udpAT+C License Manageratc-lmlast updated 2018/11/271171 tcpAT+C FmiApplicationServeratc-appserverlast updated 2018/11/271171 udpAT+C FmiApplicationServeratc-appserverlast updated 2018/11/271172 tcpDNA Protocoldnaplast updated 2018/11/271172 udpDNA Protocoldnaplast updated 2018/11/271173 tcpD-Cinema Request-Responsed-cinema-rrplast updated 2018/11/271173 udpD-Cinema Request-Responsed-cinema-rrplast updated 2018/11/271174 tcpFlashNet Remote Adminfnet-remote-uilast updated 2018/11/271174 udpFlashNet Remote Adminfnet-remote-uilast updated 2018/11/271175 tcpDossier Serverdossierlast updated 2018/11/271175 udpDossier Serverdossierlast updated 2018/11/271176 tcpIndigo Home Serverindigo-serverlast updated 2018/11/271176 udpIndigo Home Serverindigo-serverlast updated 2018/11/271177 tcpDKMessenger Protocoldkmessengerlast updated 2018/11/271177 udpDKMessenger Protocoldkmessengerlast updated 2018/11/271178 tcpSGI Storage Managersgi-stormanlast updated 2018/11/271178 udpSGI Storage Managersgi-stormanlast updated 2018/11/271179 tcpBackup To Neighborb2nlast updated 2018/11/271179 udpBackup To Neighborb2nlast updated 2018/11/271180 tcpMillicent Client Proxymc-clientlast updated 2018/11/271180 udpMillicent Client Proxymc-clientlast updated 2018/11/271181 tcp3Com Net Management3comnetmanlast updated 2018/11/271181 udp3Com Net Management3comnetmanlast updated 2018/11/271182 tcpAcceleNet Controlaccelenetlast updated 2018/11/271182 udpAcceleNet Dataaccelenet-datalast updated 2018/11/271183 tcpLL Surfup HTTPllsurfup-httplast updated 2018/11/271183 udpLL Surfup HTTPllsurfup-httplast updated 2018/11/271184 tcpLL Surfup HTTPSllsurfup-httpslast updated 2018/11/271184 udpLL Surfup HTTPSllsurfup-httpslast updated 2018/11/271185 tcpCatchpole portcatchpolelast updated 2018/11/271185 udpCatchpole portcatchpolelast updated 2018/11/271186 tcpMySQL Cluster Managermysql-clusterlast updated 2018/11/271186 udpMySQL Cluster Managermysql-clusterlast updated 2018/11/271187 tcpAlias Servicealiaslast updated 2018/11/271187 udpAlias Servicealiaslast updated 2018/11/271188 tcpHP Web Adminhp-webadminlast updated 2018/11/271188 udpHP Web Adminhp-webadminlast updated 2018/11/271189 tcpUnet Connectionunetlast updated 2018/11/271189 udpUnet Connectionunetlast updated 2018/11/271190 tcpCommLinx GPS / AVL Systemcommlinx-avllast updated 2018/11/271190 udpCommLinx GPS / AVL Systemcommlinx-avllast updated 2018/11/271191 tcpGeneral Parallel File Systemgpfslast updated 2018/11/271191 udpGeneral Parallel File Systemgpfslast updated 2018/11/271192 tcpcaids sensors channelcaids-sensorlast updated 2018/11/271192 udpcaids sensors channelcaids-sensorlast updated 2018/11/271193 tcpFive Across Serverfiveacrosslast updated 2018/11/271193 udpFive Across Serverfiveacrosslast updated 2018/11/271194 tcpOpenVPNopenvpnlast updated 2018/11/271194 udpOpenVPNopenvpnlast updated 2018/11/271195 tcpRSF-1 clusteringrsf-1last updated 2018/11/271195 udpRSF-1 clusteringrsf-1last updated 2018/11/271196 tcpNetwork Magicnetmagiclast updated 2018/11/271196 udpNetwork Magicnetmagiclast updated 2018/11/271197 tcpCarrius Remote Accesscarrius-rshelllast updated 2018/11/271197 udpCarrius Remote Accesscarrius-rshelllast updated 2018/11/271198 tcpcajo reference discoverycajo-discoverylast updated 2018/11/271198 udpcajo reference discoverycajo-discoverylast updated 2018/11/271199 tcpDMIDIdmidilast updated 2018/11/271199 udpDMIDIdmidilast updated 2018/11/271200 tcpSCOLscollast updated 2018/11/271200 udpSCOLscollast updated 2018/11/271201 tcpNucleus Sand Database Servernucleus-sandlast updated 2018/11/271201 udpNucleus Sand Database Servernucleus-sandlast updated 2018/11/271202 tcpcaiccipccaiccipclast updated 2018/11/271202 udpcaiccipccaiccipclast updated 2018/11/271203 tcpLicense Validationssslic-mgrlast updated 2018/11/271203 udpLicense Validationssslic-mgrlast updated 2018/11/271204 tcpLog Request Listenerssslog-mgrlast updated 2018/11/271204 udpLog Request Listenerssslog-mgrlast updated 2018/11/271205 tcpAccord-MGCaccord-mgclast updated 2018/11/271205 udpAccord-MGCaccord-mgclast updated 2018/11/271206 tcpAnthony Dataanthony-datalast updated 2018/11/271206 udpAnthony Dataanthony-datalast updated 2018/11/271207 tcpMetaSagemetasagelast updated 2018/11/271207 udpMetaSagemetasagelast updated 2018/11/271208 tcpSEAGULL AISseagull-aislast updated 2018/11/271208 udpSEAGULL AISseagull-aislast updated 2018/11/271209 tcpIPCD3ipcd3last updated 2018/11/271209 udpIPCD3ipcd3last updated 2018/11/271210 tcpEOSSeosslast updated 2018/11/271210 udpEOSSeosslast updated 2018/11/271211 tcpGroove DPPgroove-dpplast updated 2018/11/271211 udpGroove DPPgroove-dpplast updated 2018/11/271212 tcplupalupalast updated 2018/11/271212 udplupalupalast updated 2018/11/271213 tcpMedtronic/Physio-Control LIFENETmpc-lifenetlast updated 2018/11/271213 udpMedtronic/Physio-Control LIFENETmpc-lifenetlast updated 2018/11/271214 tcpKAZAAkazaalast updated 2018/11/271214 udpKAZAAkazaalast updated 2018/11/271215 tcpscanSTAT 1.0scanstat-1last updated 2018/11/271215 udpscanSTAT 1.0scanstat-1last updated 2018/11/271216 tcpETEBAC 5etebac5last updated 2018/11/271216 udpETEBAC 5etebac5last updated 2018/11/271217 tcpHPSS NonDCE Gatewayhpss-ndapilast updated 2018/11/271217 udpHPSS NonDCE Gatewayhpss-ndapilast updated 2018/11/271218 tcpAeroFlight-ADsaeroflight-adslast updated 2018/11/271218 udpAeroFlight-ADsaeroflight-adslast updated 2018/11/271219 tcpAeroFlight-Retaeroflight-retlast updated 2018/11/271219 udpAeroFlight-Retaeroflight-retlast updated 2018/11/271220 tcpQT SERVER ADMINqt-serveradminlast updated 2018/11/271220 udpQT SERVER ADMINqt-serveradminlast updated 2018/11/271221 tcpSweetWARE Appssweetware-appslast updated 2018/11/271221 udpSweetWARE Appssweetware-appslast updated 2018/11/271222 tcpSNI R&D networknervlast updated 2018/11/271222 udpSNI R&D networknervlast updated 2018/11/271223 tcpTrulyGlobal Protocoltgplast updated 2018/11/271223 udpTrulyGlobal Protocoltgplast updated 2018/11/271224 tcpVPNzvpnzlast updated 2018/11/271224 udpVPNzvpnzlast updated 2018/11/271225 tcpSLINKYSEARCHslinkysearchlast updated 2018/11/271225 udpSLINKYSEARCHslinkysearchlast updated 2018/11/271226 tcpSTGXFWSstgxfwslast updated 2018/11/271226 udpSTGXFWSstgxfwslast updated 2018/11/271227 tcpDNS2Godns2golast updated 2018/11/271227 udpDNS2Godns2golast updated 2018/11/271228 tcpFLORENCEflorencelast updated 2018/11/271228 udpFLORENCEflorencelast updated 2018/11/271229 tcpZENworks Tiered Electronic Distributionzentedlast updated 2018/11/271229 udpZENworks Tiered Electronic Distributionzentedlast updated 2018/11/271230 tcpPeriscopeperiscopelast updated 2018/11/271230 udpPeriscopeperiscopelast updated 2018/11/271231 tcpmenandmice-lpmmenandmice-lpmlast updated 2018/11/271231 udpmenandmice-lpmmenandmice-lpmlast updated 2018/11/271232 tcpRemote systems monitoringfirst-defenselast updated 2018/11/271232 udpRemote systems monitoringfirst-defenselast updated 2018/11/271233 tcpUniversal App Serveruniv-appserverlast updated 2018/11/271233 udpUniversal App Serveruniv-appserverlast updated 2018/11/271234 tcpInfoseek Search Agentsearch-agentlast updated 2018/11/271234 udpInfoseek Search Agentsearch-agentlast updated 2018/11/271235 tcpmosaicsyssvc1mosaicsyssvc1last updated 2018/11/271235 udpmosaicsyssvc1mosaicsyssvc1last updated 2018/11/271236 tcpbvcontrolbvcontrollast updated 2018/11/271236 udpbvcontrolbvcontrollast updated 2018/11/271237 tcptsdos390tsdos390last updated 2018/11/271237 udptsdos390tsdos390last updated 2018/11/271238 tcphacl-qshacl-qslast updated 2018/11/271238 udphacl-qshacl-qslast updated 2018/11/271239 tcpNMSDnmsdlast updated 2018/11/271239 udpNMSDnmsdlast updated 2018/11/271240 tcpInstantiainstantialast updated 2018/11/271240 udpInstantiainstantialast updated 2018/11/271241 tcpnessusnessuslast updated 2018/11/271241 udpnessusnessuslast updated 2018/11/271242 tcpNMAS over IPnmasoveriplast updated 2018/11/271242 udpNMAS over IPnmasoveriplast updated 2018/11/271243 tcpSerialGatewayserialgatewaylast updated 2018/11/271243 udpSerialGatewayserialgatewaylast updated 2018/11/271244 tcpisbconference1isbconference1last updated 2018/11/271244 udpisbconference1isbconference1last updated 2018/11/271245 tcpisbconference2isbconference2last updated 2018/11/271245 udpisbconference2isbconference2last updated 2018/11/271246 tcppayrouterpayrouterlast updated 2018/11/271246 udppayrouterpayrouterlast updated 2018/11/271247 tcpVisionPyramidvisionpyramidlast updated 2018/11/271247 udpVisionPyramidvisionpyramidlast updated 2018/11/271248 tcphermeshermeslast updated 2018/11/271248 udphermeshermeslast updated 2018/11/271249 tcpMesa Vista Comesavistacolast updated 2018/11/271249 udpMesa Vista Comesavistacolast updated 2018/11/271250 tcpswldy-siasswldy-siaslast updated 2018/11/271250 udpswldy-siasswldy-siaslast updated 2018/11/271251 tcpservergraphservergraphlast updated 2018/11/271251 udpservergraphservergraphlast updated 2018/11/271252 tcpbspne-pccbspne-pcclast updated 2018/11/271252 udpbspne-pccbspne-pcclast updated 2018/11/271253 tcpq55-pccq55-pcclast updated 2018/11/271253 udpq55-pccq55-pcclast updated 2018/11/271254 tcpde-nocde-noclast updated 2018/11/271254 udpde-nocde-noclast updated 2018/11/271255 tcpde-cache-queryde-cache-querylast updated 2018/11/271255 udpde-cache-queryde-cache-querylast updated 2018/11/271256 tcpde-serverde-serverlast updated 2018/11/271256 udpde-serverde-serverlast updated 2018/11/271257 tcpShockwave 2shockwave2last updated 2018/11/271257 udpShockwave 2shockwave2last updated 2018/11/271258 tcpOpen Network Libraryopennllast updated 2018/11/271258 udpOpen Network Libraryopennllast updated 2018/11/271259 tcpOpen Network Library Voiceopennl-voicelast updated 2018/11/271259 udpOpen Network Library Voiceopennl-voicelast updated 2018/11/271260 tcpibm-ssdibm-ssdlast updated 2018/11/271260 udpibm-ssdibm-ssdlast updated 2018/11/271261 tcpmpshrsvmpshrsvlast updated 2018/11/271261 udpmpshrsvmpshrsvlast updated 2018/11/271262 tcpQNTS-ORBqnts-orblast updated 2018/11/271262 udpQNTS-ORBqnts-orblast updated 2018/11/271263 tcpdkadkalast updated 2018/11/271263 udpdkadkalast updated 2018/11/271264 tcpPRATpratlast updated 2018/11/271264 udpPRATpratlast updated 2018/11/271265 tcpDSSIAPIdssiapilast updated 2018/11/271265 udpDSSIAPIdssiapilast updated 2018/11/271266 tcpDELLPWRAPPKSdellpwrappkslast updated 2018/11/271266 udpDELLPWRAPPKSdellpwrappkslast updated 2018/11/271267 tcpeTrust Policy Complianceepclast updated 2018/11/271267 udpeTrust Policy Complianceepclast updated 2018/11/271268 tcpPROPEL-MSGSYSpropel-msgsyslast updated 2018/11/271268 udpPROPEL-MSGSYSpropel-msgsyslast updated 2018/11/271269 tcpWATiLaPPwatilapplast updated 2018/11/271269 udpWATiLaPPwatilapplast updated 2018/11/271270 tcpMicrosoft Operations Manageropsmgrlast updated 2018/11/271270 udpMicrosoft Operations Manageropsmgrlast updated 2018/11/271271 tcpeXcWexcwlast updated 2018/11/271271 udpeXcWexcwlast updated 2018/11/271272 tcpCSPMLockMgrcspmlockmgrlast updated 2018/11/271272 udpCSPMLockMgrcspmlockmgrlast updated 2018/11/271273 tcpEMC-Gatewayemc-gatewaylast updated 2018/11/271273 udpEMC-Gatewayemc-gatewaylast updated 2018/11/271274 tcpt1distproct1distproclast updated 2018/11/271274 udpt1distproct1distproclast updated 2018/11/271275 tcpivcollectorivcollectorlast updated 2018/11/271275 udpivcollectorivcollectorlast updated 2018/11/271276 tcpReservedN/Alast updated 2018/11/271276 udpReservedN/Alast updated 2018/11/271277 tcpmqsmiva-mqslast updated 2018/11/271277 udpmqsmiva-mqslast updated 2018/11/271278 tcpDell Web Admin 1dellwebadmin-1last updated 2018/11/271278 udpDell Web Admin 1dellwebadmin-1last updated 2018/11/271279 tcpDell Web Admin 2dellwebadmin-2last updated 2018/11/271279 udpDell Web Admin 2dellwebadmin-2last updated 2018/11/271280 tcpPictrographypictrographylast updated 2018/11/271280 udpPictrographypictrographylast updated 2018/11/271281 tcphealthdhealthdlast updated 2018/11/271281 udphealthdhealthdlast updated 2018/11/271282 tcpEmperionemperionlast updated 2018/11/271282 udpEmperionemperionlast updated 2018/11/271283 tcpProduct Informationproductinfolast updated 2018/11/271283 udpProduct Informationproductinfolast updated 2018/11/271284 tcpIEE-QFXiee-qfxlast updated 2018/11/271284 udpIEE-QFXiee-qfxlast updated 2018/11/271285 tcpneoifaceneoifacelast updated 2018/11/271285 udpneoifaceneoifacelast updated 2018/11/271286 tcpnetuitivenetuitivelast updated 2018/11/271286 udpnetuitivenetuitivelast updated 2018/11/271287 tcpRouteMatch Comroutematchlast updated 2018/11/271287 udpRouteMatch Comroutematchlast updated 2018/11/271288 tcpNavBuddynavbuddylast updated 2018/11/271288 udpNavBuddynavbuddylast updated 2018/11/271289 tcpJWalkServerjwalkserverlast updated 2018/11/271289 udpJWalkServerjwalkserverlast updated 2018/11/271290 tcpWinJaServerwinjaserverlast updated 2018/11/271290 udpWinJaServerwinjaserverlast updated 2018/11/271291 tcpSEAGULLLMSseagulllmslast updated 2018/11/271291 udpSEAGULLLMSseagulllmslast updated 2018/11/271292 tcpdsdndsdnlast updated 2018/11/271292 udpdsdndsdnlast updated 2018/11/271293 tcpPKT-KRB-IPSecpkt-krb-ipseclast updated 2018/11/271293 udpPKT-KRB-IPSecpkt-krb-ipseclast updated 2018/11/271294 tcpCMMdrivercmmdriverlast updated 2018/11/271294 udpCMMdrivercmmdriverlast updated 2018/11/271295 tcpEnd-by-Hop Transmission Protocolehtplast updated 2018/11/271295 udpEnd-by-Hop Transmission Protocolehtplast updated 2018/11/271296 tcpdproxydproxylast updated 2018/11/271296 udpdproxydproxylast updated 2018/11/271297 tcpsdproxysdproxylast updated 2018/11/271297 udpsdproxysdproxylast updated 2018/11/271298 tcplpcplpcplast updated 2018/11/271298 udplpcplpcplast updated 2018/11/271299 tcphp-scihp-scilast updated 2018/11/271299 udphp-scihp-scilast updated 2018/11/271300 tcpH.323 Secure Call Control Signallingh323hostcallsclast updated 2018/11/271300 udpH.323 Secure Call Control Signallingh323hostcallsclast updated 2018/11/271301 tcpCI3-Software-1ci3-software-1last updated 2018/11/271301 udpCI3-Software-1ci3-software-1last updated 2018/11/271302 tcpCI3-Software-2ci3-software-2last updated 2018/11/271302 udpCI3-Software-2ci3-software-2last updated 2018/11/271303 tcpsftsrvsftsrvlast updated 2018/11/271303 udpsftsrvsftsrvlast updated 2018/11/271304 tcpBoomerangboomeranglast updated 2018/11/271304 udpBoomerangboomeranglast updated 2018/11/271305 tcppe-mikepe-mikelast updated 2018/11/271305 udppe-mikepe-mikelast updated 2018/11/271306 tcpRE-Conn-Protore-conn-protolast updated 2018/11/271306 udpRE-Conn-Protore-conn-protolast updated 2018/11/271307 tcpPacmandpacmandlast updated 2018/11/271307 udpPacmandpacmandlast updated 2018/11/271308 tcpOptical Domain Service Interconnect (ODSI)odsilast updated 2018/11/271308 udpOptical Domain Service Interconnect (ODSI)odsilast updated 2018/11/271309 tcpJTAG serverjtag-serverlast updated 2018/11/271309 udpJTAG serverjtag-serverlast updated 2018/11/271310 tcpHuskyhuskylast updated 2018/11/271310 udpHuskyhuskylast updated 2018/11/271311 tcpRxMonrxmonlast updated 2018/11/271311 udpRxMonrxmonlast updated 2018/11/271312 tcpSTI Envisionsti-envisionlast updated 2018/11/271312 udpSTI Envisionsti-envisionlast updated 2018/11/271313 tcpBMC_PATROLDB IANA assigned this well-formed service name as a replacement for "bmc_patroldb".bmc-patroldblast updated 2018/11/271313 tcp (bmc_patroldb)BMC_PATROLDBbmc_patroldblast updated 2018/11/271313 udpBMC_PATROLDB IANA assigned this well-formed service name as a replacement for "bmc_patroldb".bmc-patroldblast updated 2018/11/271313 udp (bmc_patroldb)BMC_PATROLDBbmc_patroldblast updated 2018/11/271314 tcpPhotoscript Distributed Printing Systempdpslast updated 2018/11/271314 udpPhotoscript Distributed Printing Systempdpslast updated 2018/11/271315 tcpE.L.S., Event Listener Serviceelslast updated 2018/11/271315 udpE.L.S., Event Listener Serviceelslast updated 2018/11/271316 tcpExbit-ESCPexbit-escplast updated 2018/11/271316 udpExbit-ESCPexbit-escplast updated 2018/11/271317 tcpvrts-ipcservervrts-ipcserverlast updated 2018/11/271317 udpvrts-ipcservervrts-ipcserverlast updated 2018/11/271318 tcpkrb5gatekeeperkrb5gatekeeperlast updated 2018/11/271318 udpkrb5gatekeeperkrb5gatekeeperlast updated 2018/11/271319 tcpAMX-ICSPamx-icsplast updated 2018/11/271319 udpAMX-ICSPamx-icsplast updated 2018/11/271320 tcpAMX-AXBNETamx-axbnetlast updated 2018/11/271320 udpAMX-AXBNETamx-axbnetlast updated 2018/11/271321 tcpPIPpiplast updated 2018/11/271321 udpPIPpiplast updated 2018/11/271322 tcpNovationnovationlast updated 2018/11/271322 udpNovationnovationlast updated 2018/11/271323 tcpbrcdbrcdlast updated 2018/11/271323 udpbrcdbrcdlast updated 2018/11/271324 tcpdelta-mcpdelta-mcplast updated 2018/11/271324 udpdelta-mcpdelta-mcplast updated 2018/11/271325 tcpDX-Instrumentdx-instrumentlast updated 2018/11/271325 udpDX-Instrumentdx-instrumentlast updated 2018/11/271326 tcpWIMSICwimsiclast updated 2018/11/271326 udpWIMSICwimsiclast updated 2018/11/271327 tcpUltrexultrexlast updated 2018/11/271327 udpUltrexultrexlast updated 2018/11/271328 tcpEWALLewalllast updated 2018/11/271328 udpEWALLewalllast updated 2018/11/271329 tcpnetdb-exportnetdb-exportlast updated 2018/11/271329 udpnetdb-exportnetdb-exportlast updated 2018/11/271330 tcpStreetPerfectstreetperfectlast updated 2018/11/271330 udpStreetPerfectstreetperfectlast updated 2018/11/271331 tcpintersanintersanlast updated 2018/11/271331 udpintersanintersanlast updated 2018/11/271332 tcpPCIA RXP-Bpcia-rxp-blast updated 2018/11/271332 udpPCIA RXP-Bpcia-rxp-blast updated 2018/11/271333 tcpPassword Policypasswrd-policylast updated 2018/11/271333 udpPassword Policypasswrd-policylast updated 2018/11/271334 tcpwritesrvwritesrvlast updated 2018/11/271334 udpwritesrvwritesrvlast updated 2018/11/271335 tcpDigital Notary Protocoldigital-notarylast updated 2018/11/271335 udpDigital Notary Protocoldigital-notarylast updated 2018/11/271336 tcpInstant Service Chatischatlast updated 2018/11/271336 udpInstant Service Chatischatlast updated 2018/11/271337 tcpmenandmice DNSmenandmice-dnslast updated 2018/11/271337 udpmenandmice DNSmenandmice-dnslast updated 2018/11/271338 tcpWMC-log-svrwmc-log-svclast updated 2018/11/271338 udpWMC-log-svrwmc-log-svclast updated 2018/11/271339 tcpkjtsiteserverkjtsiteserverlast updated 2018/11/271339 udpkjtsiteserverkjtsiteserverlast updated 2018/11/271340 tcpNAAPnaaplast updated 2018/11/271340 udpNAAPnaaplast updated 2018/11/271341 tcpQuBESqubeslast updated 2018/11/271341 udpQuBESqubeslast updated 2018/11/271342 tcpESBrokeresbrokerlast updated 2018/11/271342 udpESBrokeresbrokerlast updated 2018/11/271343 tcpre101re101last updated 2018/11/271343 udpre101re101last updated 2018/11/271344 tcpICAPicaplast updated 2018/11/271344 udpICAPicaplast updated 2018/11/271345 tcpVPJPvpjplast updated 2018/11/271345 udpVPJPvpjplast updated 2018/11/271346 tcpAlta Analytics License Manageralta-ana-lmlast updated 2018/11/271346 udpAlta Analytics License Manageralta-ana-lmlast updated 2018/11/271347 tcpmulti media conferencingbbn-mmclast updated 2018/11/271347 udpmulti media conferencingbbn-mmclast updated 2018/11/271348 tcpmulti media conferencingbbn-mmxlast updated 2018/11/271348 udpmulti media conferencingbbn-mmxlast updated 2018/11/271349 tcpRegistration Network Protocolsbooklast updated 2018/11/271349 udpRegistration Network Protocolsbooklast updated 2018/11/271350 tcpRegistration Network Protocoleditbenchlast updated 2018/11/271350 udpRegistration Network Protocoleditbenchlast updated 2018/11/271351 tcpDigital Tool Works (MIT)equationbuilderlast updated 2018/11/271351 udpDigital Tool Works (MIT)equationbuilderlast updated 2018/11/271352 tcpLotus Notelotusnotelast updated 2018/11/271352 udpLotus Notelotusnotelast updated 2018/11/271353 tcpRelief Consultingrelieflast updated 2018/11/271353 udpRelief Consultingrelieflast updated 2018/11/271354 tcpFive Across XSIP NetworkXSIP-networklast updated 2018/11/271354 udpFive Across XSIP NetworkXSIP-networklast updated 2018/11/271355 tcpIntuitive Edgeintuitive-edgelast updated 2018/11/271355 udpIntuitive Edgeintuitive-edgelast updated 2018/11/271356 tcpCuillaMartin Companycuillamartinlast updated 2018/11/271356 udpCuillaMartin Companycuillamartinlast updated 2018/11/271357 tcpElectronic PegBoardpegboardlast updated 2018/11/271357 udpElectronic PegBoardpegboardlast updated 2018/11/271358 tcpCONNLCLIconnlclilast updated 2018/11/271358 udpCONNLCLIconnlclilast updated 2018/11/271359 tcpFTSRVftsrvlast updated 2018/11/271359 udpFTSRVftsrvlast updated 2018/11/271360 tcpMIMERmimerlast updated 2018/11/271360 udpMIMERmimerlast updated 2018/11/271361 tcpLinXlinxlast updated 2018/11/271361 udpLinXlinxlast updated 2018/11/271362 tcpTimeFliestimeflieslast updated 2018/11/271362 udpTimeFliestimeflieslast updated 2018/11/271363 tcpNetwork DataMover Requesterndm-requesterlast updated 2018/11/271363 udpNetwork DataMover Requesterndm-requesterlast updated 2018/11/271364 tcpNetwork DataMover Serverndm-serverlast updated 2018/11/271364 udpNetwork DataMover Serverndm-serverlast updated 2018/11/271365 tcpNetwork Software Associatesadapt-snalast updated 2018/11/271365 udpNetwork Software Associatesadapt-snalast updated 2018/11/271366 tcpNovell NetWare Comm Service Platformnetware-csplast updated 2018/11/271366 udpNovell NetWare Comm Service Platformnetware-csplast updated 2018/11/271367 tcpDCSdcslast updated 2018/11/271367 udpDCSdcslast updated 2018/11/271368 tcpScreenCastscreencastlast updated 2018/11/271368 udpScreenCastscreencastlast updated 2018/11/271369 tcpGlobalView to Unix Shellgv-uslast updated 2018/11/271369 udpGlobalView to Unix Shellgv-uslast updated 2018/11/271370 tcpUnix Shell to GlobalViewus-gvlast updated 2018/11/271370 udpUnix Shell to GlobalViewus-gvlast updated 2018/11/271371 tcpFujitsu Config Protocolfc-clilast updated 2018/11/271371 udpFujitsu Config Protocolfc-clilast updated 2018/11/271372 tcpFujitsu Config Protocolfc-serlast updated 2018/11/271372 udpFujitsu Config Protocolfc-serlast updated 2018/11/271373 tcpChromagrafxchromagrafxlast updated 2018/11/271373 udpChromagrafxchromagrafxlast updated 2018/11/271374 tcpEPI Software Systemsmollylast updated 2018/11/271374 udpEPI Software Systemsmollylast updated 2018/11/271375 tcpBytexbytexlast updated 2018/11/271375 udpBytexbytexlast updated 2018/11/271376 tcpIBM Person to Person Softwareibm-ppslast updated 2018/11/271376 udpIBM Person to Person Softwareibm-ppslast updated 2018/11/271377 tcpCichlid License Managercichlidlast updated 2018/11/271377 udpCichlid License Managercichlidlast updated 2018/11/271378 tcpElan License Managerelanlast updated 2018/11/271378 udpElan License Managerelanlast updated 2018/11/271379 tcpIntegrity Solutionsdbreporterlast updated 2018/11/271379 udpIntegrity Solutionsdbreporterlast updated 2018/11/271380 tcpTelesis Network License Managertelesis-licmanlast updated 2018/11/271380 udpTelesis Network License Managertelesis-licmanlast updated 2018/11/271381 tcpApple Network License Managerapple-licmanlast updated 2018/11/271381 udpApple Network License Managerapple-licmanlast updated 2018/11/271382 tcpudt_os IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 2018/11/271382 tcp (udt_os)udt_osudt_oslast updated 2018/11/271382 udpudt_os IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 2018/11/271382 udp (udt_os)udt_osudt_oslast updated 2018/11/271383 tcpGW Hannaway Network License Managergwhalast updated 2018/11/271383 udpGW Hannaway Network License Managergwhalast updated 2018/11/271384 tcpObjective Solutions License Manageros-licmanlast updated 2018/11/271384 udpObjective Solutions License Manageros-licmanlast updated 2018/11/271385 tcpAtex Publishing License Manager IANA assigned this well-formed service name as a replacement for "atex_elmd".atex-elmdlast updated 2018/11/271385 tcp (atex_elmd)Atex Publishing License Manageratex_elmdlast updated 2018/11/271385 udpAtex Publishing License Manager IANA assigned this well-formed service name as a replacement for "atex_elmd".atex-elmdlast updated 2018/11/271385 udp (atex_elmd)Atex Publishing License Manageratex_elmdlast updated 2018/11/271386 tcpCheckSum License Managerchecksumlast updated 2018/11/271386 udpCheckSum License Managerchecksumlast updated 2018/11/271387 tcpComputer Aided Design Software Inc LMcadsi-lmlast updated 2018/11/271387 udpComputer Aided Design Software Inc LMcadsi-lmlast updated 2018/11/271388 tcpObjective Solutions DataBase Cacheobjective-dbclast updated 2018/11/271388 udpObjective Solutions DataBase Cacheobjective-dbclast updated 2018/11/271389 tcpDocument Managericlpv-dmlast updated 2018/11/271389 udpDocument Managericlpv-dmlast updated 2018/11/271390 tcpStorage Controllericlpv-sclast updated 2018/11/271390 udpStorage Controllericlpv-sclast updated 2018/11/271391 tcpStorage Access Servericlpv-saslast updated 2018/11/271391 udpStorage Access Servericlpv-saslast updated 2018/11/271392 tcpPrint Managericlpv-pmlast updated 2018/11/271392 udpPrint Managericlpv-pmlast updated 2018/11/271393 tcpNetwork Log Servericlpv-nlslast updated 2018/11/271393 udpNetwork Log Servericlpv-nlslast updated 2018/11/271394 tcpNetwork Log Clienticlpv-nlclast updated 2018/11/271394 udpNetwork Log Clienticlpv-nlclast updated 2018/11/271395 tcpPC Workstation Manager softwareiclpv-wsmlast updated 2018/11/271395 udpPC Workstation Manager softwareiclpv-wsmlast updated 2018/11/271396 tcpDVL Active Maildvl-activemaillast updated 2018/11/271396 udpDVL Active Maildvl-activemaillast updated 2018/11/271397 tcpAudio Active Mailaudio-activmaillast updated 2018/11/271397 udpAudio Active Mailaudio-activmaillast updated 2018/11/271398 tcpVideo Active Mailvideo-activmaillast updated 2018/11/271398 udpVideo Active Mailvideo-activmaillast updated 2018/11/271399 tcpCadkey License Managercadkey-licmanlast updated 2018/11/271399 udpCadkey License Managercadkey-licmanlast updated 2018/11/271400 tcpCadkey Tablet Daemoncadkey-tabletlast updated 2018/11/271400 udpCadkey Tablet Daemoncadkey-tabletlast updated 2018/11/271401 tcpGoldleaf License Managergoldleaf-licmanlast updated 2018/11/271401 udpGoldleaf License Managergoldleaf-licmanlast updated 2018/11/271402 tcpProspero Resource Managerprm-sm-nplast updated 2018/11/271402 udpProspero Resource Managerprm-sm-nplast updated 2018/11/271403 tcpProspero Resource Managerprm-nm-nplast updated 2018/11/271403 udpProspero Resource Managerprm-nm-nplast updated 2018/11/271404 tcpInfinite Graphics License Managerigi-lmlast updated 2018/11/271404 udpInfinite Graphics License Managerigi-lmlast updated 2018/11/271405 tcpIBM Remote Execution Starteribm-reslast updated 2018/11/271405 udpIBM Remote Execution Starteribm-reslast updated 2018/11/271406 tcpNetLabs License Managernetlabs-lmlast updated 2018/11/271406 udpNetLabs License Managernetlabs-lmlast updated 2018/11/271407 tcpTIBET Data Servertibet-serverlast updated 2018/11/271407 udpReservedN/Alast updated 2018/11/271408 tcpSophia License Managersophia-lmlast updated 2018/11/271408 udpSophia License Managersophia-lmlast updated 2018/11/271409 tcpHere License Managerhere-lmlast updated 2018/11/271409 udpHere License Managerhere-lmlast updated 2018/11/271410 tcpHiQ License Managerhiqlast updated 2018/11/271410 udpHiQ License Managerhiqlast updated 2018/11/271411 tcpAudioFileaflast updated 2018/11/271411 udpAudioFileaflast updated 2018/11/271412 tcpInnoSysinnosyslast updated 2018/11/271412 udpInnoSysinnosyslast updated 2018/11/271413 tcpInnosys-ACLinnosys-acllast updated 2018/11/271413 udpInnosys-ACLinnosys-acllast updated 2018/11/271414 tcpIBM MQSeriesibm-mqserieslast updated 2018/11/271414 udpIBM MQSeriesibm-mqserieslast updated 2018/11/271415 tcpDBStardbstarlast updated 2018/11/271415 udpDBStardbstarlast updated 2018/11/271416 tcpNovell LU6.2 IANA assigned this well-formed service name as a replacement for "novell-lu6.2".novell-lu6-2last updated 2018/11/271416 tcp (Novell LU6.2)Novell LU6.2novell-lu6.2last updated 2018/11/271416 udpNovell LU6.2 IANA assigned this well-formed service name as a replacement for "novell-lu6.2".novell-lu6-2last updated 2018/11/271416 udp (Novell LU6.2)Novell LU6.2novell-lu6.2last updated 2018/11/271417 tcpTimbuktu Service 1 Porttimbuktu-srv1last updated 2018/11/271417 udpTimbuktu Service 1 Porttimbuktu-srv1last updated 2018/11/271418 tcpTimbuktu Service 2 Porttimbuktu-srv2last updated 2018/11/271418 udpTimbuktu Service 2 Porttimbuktu-srv2last updated 2018/11/271419 tcpTimbuktu Service 3 Porttimbuktu-srv3last updated 2018/11/271419 udpTimbuktu Service 3 Porttimbuktu-srv3last updated 2018/11/271420 tcpTimbuktu Service 4 Porttimbuktu-srv4last updated 2018/11/271420 udpTimbuktu Service 4 Porttimbuktu-srv4last updated 2018/11/271421 tcpGandalf License Managergandalf-lmlast updated 2018/11/271421 udpGandalf License Managergandalf-lmlast updated 2018/11/271422 tcpAutodesk License Managerautodesk-lmlast updated 2018/11/271422 udpAutodesk License Managerautodesk-lmlast updated 2018/11/271423 tcpEssbase Arbor Softwareessbaselast updated 2018/11/271423 udpEssbase Arbor Softwareessbaselast updated 2018/11/271424 tcpHybrid Encryption Protocolhybridlast updated 2018/11/271424 udpHybrid Encryption Protocolhybridlast updated 2018/11/271425 tcpZion Software License Managerzion-lmlast updated 2018/11/271425 udpZion Software License Managerzion-lmlast updated 2018/11/271426 tcpSatellite-data Acquisition System 1saislast updated 2018/11/271426 udpSatellite-data Acquisition System 1saislast updated 2018/11/271427 tcpmloadd monitoring toolmloaddlast updated 2018/11/271427 udpmloadd monitoring toolmloaddlast updated 2018/11/271428 tcpInformatik License Managerinformatik-lmlast updated 2018/11/271428 udpInformatik License Managerinformatik-lmlast updated 2018/11/271429 tcpHypercom NMSnmslast updated 2018/11/271429 udpHypercom NMSnmslast updated 2018/11/271430 tcpHypercom TPDUtpdulast updated 2018/11/271430 udpHypercom TPDUtpdulast updated 2018/11/271431 tcpReverse Gossip Transportrgtplast updated 2018/11/271431 udpReverse Gossip Transportrgtplast updated 2018/11/271432 tcpBlueberry Software License Managerblueberry-lmlast updated 2018/11/271432 udpBlueberry Software License Managerblueberry-lmlast updated 2018/11/271433 tcpMicrosoft-SQL-Serverms-sql-slast updated 2018/11/271433 udpMicrosoft-SQL-Serverms-sql-slast updated 2018/11/271434 tcpMicrosoft-SQL-Monitorms-sql-mlast updated 2018/11/271434 udpMicrosoft-SQL-Monitorms-sql-mlast updated 2018/11/271435 tcpIBM CICSibm-cicslast updated 2018/11/271435 udpIBM CICSibm-cicslast updated 2018/11/271436 tcpSatellite-data Acquisition System 2saismlast updated 2018/11/271436 udpSatellite-data Acquisition System 2saismlast updated 2018/11/271437 tcpTabulatabulalast updated 2018/11/271437 udpTabulatabulalast updated 2018/11/271438 tcpEicon Security Agent/Servereicon-serverlast updated 2018/11/271438 udpEicon Security Agent/Servereicon-serverlast updated 2018/11/271439 tcpEicon X25/SNA Gatewayeicon-x25last updated 2018/11/271439 udpEicon X25/SNA Gatewayeicon-x25last updated 2018/11/271440 tcpEicon Service Location Protocoleicon-slplast updated 2018/11/271440 udpEicon Service Location Protocoleicon-slplast updated 2018/11/271441 tcpCadis License Managementcadis-1last updated 2018/11/271441 udpCadis License Managementcadis-1last updated 2018/11/271442 tcpCadis License Managementcadis-2last updated 2018/11/271442 udpCadis License Managementcadis-2last updated 2018/11/271443 tcpIntegrated Engineering Softwareies-lmlast updated 2018/11/271443 udpIntegrated Engineering Softwareies-lmlast updated 2018/11/271444 tcpMarcam License Managementmarcam-lmlast updated 2018/11/271444 udpMarcam License Managementmarcam-lmlast updated 2018/11/271445 tcpProxima License Managerproxima-lmlast updated 2018/11/271445 udpProxima License Managerproxima-lmlast updated 2018/11/271446 tcpOptical Research Associates License Managerora-lmlast updated 2018/11/271446 udpOptical Research Associates License Managerora-lmlast updated 2018/11/271447 tcpApplied Parallel Research LMapri-lmlast updated 2018/11/271447 udpApplied Parallel Research LMapri-lmlast updated 2018/11/271448 tcpOpenConnect License Manageroc-lmlast updated 2018/11/271448 udpOpenConnect License Manageroc-lmlast updated 2018/11/271449 tcpPEportpeportlast updated 2018/11/271449 udpPEportpeportlast updated 2018/11/271450 tcpTandem Distributed Workbench Facilitydwflast updated 2018/11/271450 udpTandem Distributed Workbench Facilitydwflast updated 2018/11/271451 tcpIBM Information Managementinfomanlast updated 2018/11/271451 udpIBM Information Managementinfomanlast updated 2018/11/271452 tcpGTE Government Systems License Mangtegsc-lmlast updated 2018/11/271452 udpGTE Government Systems License Mangtegsc-lmlast updated 2018/11/271453 tcpGenie License Managergenie-lmlast updated 2018/11/271453 udpGenie License Managergenie-lmlast updated 2018/11/271454 tcpinterHDL License Manager IANA assigned this well-formed service name as a replacement for "interhdl_elmd".interhdl-elmdlast updated 2018/11/271454 tcp (interhdl_elmd)interHDL License Managerinterhdl_elmdlast updated 2018/11/271454 udpinterHDL License Manager IANA assigned this well-formed service name as a replacement for "interhdl_elmd".interhdl-elmdlast updated 2018/11/271454 udp (interhdl_elmd)interHDL License Managerinterhdl_elmdlast updated 2018/11/271455 tcpESL License Manageresl-lmlast updated 2018/11/271455 udpESL License Manageresl-lmlast updated 2018/11/271456 tcpDCAdcalast updated 2018/11/271456 udpDCAdcalast updated 2018/11/271457 tcpValisys License Managervalisys-lmlast updated 2018/11/271457 udpValisys License Managervalisys-lmlast updated 2018/11/271458 tcpNichols Research Corp.nrcabq-lmlast updated 2018/11/271458 udpNichols Research Corp.nrcabq-lmlast updated 2018/11/271459 tcpProshare Notebook Applicationproshare1last updated 2018/11/271459 udpProshare Notebook Applicationproshare1last updated 2018/11/271460 tcpProshare Notebook Applicationproshare2last updated 2018/11/271460 udpProshare Notebook Applicationproshare2last updated 2018/11/271461 tcpIBM Wireless LAN IANA assigned this well-formed service name as a replacement for "ibm_wrless_lan".ibm-wrless-lanlast updated 2018/11/271461 tcp (ibm_wrless_lan)IBM Wireless LANibm_wrless_lanlast updated 2018/11/271461 udpIBM Wireless LAN IANA assigned this well-formed service name as a replacement for "ibm_wrless_lan".ibm-wrless-lanlast updated 2018/11/271461 udp (ibm_wrless_lan)IBM Wireless LANibm_wrless_lanlast updated 2018/11/271462 tcpWorld License Managerworld-lmlast updated 2018/11/271462 udpWorld License Managerworld-lmlast updated 2018/11/271463 tcpNucleusnucleuslast updated 2018/11/271463 udpNucleusnucleuslast updated 2018/11/271464 tcpMSL License Manager IANA assigned this well-formed service name as a replacement for "msl_lmd".msl-lmdlast updated 2018/11/271464 tcp (msl_lmd)MSL License Managermsl_lmdlast updated 2018/11/271464 udpMSL License Manager IANA assigned this well-formed service name as a replacement for "msl_lmd".msl-lmdlast updated 2018/11/271464 udp (msl_lmd)MSL License Managermsl_lmdlast updated 2018/11/271465 tcpPipes Platformpipeslast updated 2018/11/271465 udpPipes Platformpipeslast updated 2018/11/271466 tcpOcean Software License Manageroceansoft-lmlast updated 2018/11/271466 udpOcean Software License Manageroceansoft-lmlast updated 2018/11/271467 tcpCSDMBASEcsdmbaselast updated 2018/11/271467 udpCSDMBASEcsdmbaselast updated 2018/11/271468 tcpCSDMcsdmlast updated 2018/11/271468 udpCSDMcsdmlast updated 2018/11/271469 tcpActive Analysis Limited License Manageraal-lmlast updated 2018/11/271469 udpActive Analysis Limited License Manageraal-lmlast updated 2018/11/271470 tcpUniversal Analyticsuaiactlast updated 2018/11/271470 udpUniversal Analyticsuaiactlast updated 2018/11/271471 tcpcsdmbasecsdmbaselast updated 2018/11/271471 udpcsdmbasecsdmbaselast updated 2018/11/271472 tcpcsdmcsdmlast updated 2018/11/271472 udpcsdmcsdmlast updated 2018/11/271473 tcpOpenMathopenmathlast updated 2018/11/271473 udpOpenMathopenmathlast updated 2018/11/271474 tcpTelefindertelefinderlast updated 2018/11/271474 udpTelefindertelefinderlast updated 2018/11/271475 tcpTaligent License Managertaligent-lmlast updated 2018/11/271475 udpTaligent License Managertaligent-lmlast updated 2018/11/271476 tcpclvm-cfgclvm-cfglast updated 2018/11/271476 udpclvm-cfgclvm-cfglast updated 2018/11/271477 tcpms-sna-serverms-sna-serverlast updated 2018/11/271477 udpms-sna-serverms-sna-serverlast updated 2018/11/271478 tcpms-sna-basems-sna-baselast updated 2018/11/271478 udpms-sna-basems-sna-baselast updated 2018/11/271479 tcpdberegisterdberegisterlast updated 2018/11/271479 udpdberegisterdberegisterlast updated 2018/11/271480 tcpPacerForumpacerforumlast updated 2018/11/271480 udpPacerForumpacerforumlast updated 2018/11/271481 tcpAIRSairslast updated 2018/11/271481 udpAIRSairslast updated 2018/11/271482 tcpMiteksys License Managermiteksys-lmlast updated 2018/11/271482 udpMiteksys License Managermiteksys-lmlast updated 2018/11/271483 tcpAFS License Managerafslast updated 2018/11/271483 udpAFS License Managerafslast updated 2018/11/271484 tcpConfluent License Managerconfluentlast updated 2018/11/271484 udpConfluent License Managerconfluentlast updated 2018/11/271485 tcpLANSourcelansourcelast updated 2018/11/271485 udpLANSourcelansourcelast updated 2018/11/271486 tcpnms_topo_serv IANA assigned this well-formed service name as a replacement for "nms_topo_serv".nms-topo-servlast updated 2018/11/271486 tcp (nms_topo_serv)nms_topo_servnms_topo_servlast updated 2018/11/271486 udpnms_topo_serv IANA assigned this well-formed service name as a replacement for "nms_topo_serv".nms-topo-servlast updated 2018/11/271486 udp (nms_topo_serv)nms_topo_servnms_topo_servlast updated 2018/11/271487 tcpLocalInfoSrvrlocalinfosrvrlast updated 2018/11/271487 udpLocalInfoSrvrlocalinfosrvrlast updated 2018/11/271488 tcpDocStordocstorlast updated 2018/11/271488 udpDocStordocstorlast updated 2018/11/271489 tcpdmdocbrokerdmdocbrokerlast updated 2018/11/271489 udpdmdocbrokerdmdocbrokerlast updated 2018/11/271490 tcpinsitu-confinsitu-conflast updated 2018/11/271490 udpinsitu-confinsitu-conflast updated 2018/11/271491 UnassignedN/Alast updated 2018/11/271492 tcpstone-design-1stone-design-1last updated 2018/11/271492 udpstone-design-1stone-design-1last updated 2018/11/271493 tcpnetmap_lm IANA assigned this well-formed service name as a replacement for "netmap_lm".netmap-lmlast updated 2018/11/271493 tcp (netmap_lm)netmap_lmnetmap_lmlast updated 2018/11/271493 udpnetmap_lm IANA assigned this well-formed service name as a replacement for "netmap_lm".netmap-lmlast updated 2018/11/271493 udp (netmap_lm)netmap_lmnetmap_lmlast updated 2018/11/271494 tcpicaicalast updated 2018/11/271494 udpicaicalast updated 2018/11/271495 tcpcvccvclast updated 2018/11/271495 udpcvccvclast updated 2018/11/271496 tcpliberty-lmliberty-lmlast updated 2018/11/271496 udpliberty-lmliberty-lmlast updated 2018/11/271497 tcprfx-lmrfx-lmlast updated 2018/11/271497 udprfx-lmrfx-lmlast updated 2018/11/271498 tcpSybase SQL Anysybase-sqlanylast updated 2018/11/271498 udpSybase SQL Anysybase-sqlanylast updated 2018/11/271499 tcpFederico Heinz Consultorafhclast updated 2018/11/271499 udpFederico Heinz Consultorafhclast updated 2018/11/271500 tcpVLSI License Managervlsi-lmlast updated 2018/11/271500 udpVLSI License Managervlsi-lmlast updated 2018/11/271501 tcpSatellite-data Acquisition System 3saiscmlast updated 2018/11/271501 udpSatellite-data Acquisition System 3saiscmlast updated 2018/11/271502 tcpShivashivadiscoverylast updated 2018/11/271502 udpShivashivadiscoverylast updated 2018/11/271503 tcpDatabeamimtc-mcslast updated 2018/11/271503 udpDatabeamimtc-mcslast updated 2018/11/271504 tcpEVB Software Engineering License Managerevb-elmlast updated 2018/11/271504 udpEVB Software Engineering License Managerevb-elmlast updated 2018/11/271505 tcpFunk Software, Inc.funkproxylast updated 2018/11/271505 udpFunk Software, Inc.funkproxylast updated 2018/11/271506 tcpUniversal Time daemon (utcd)utcdlast updated 2018/11/271506 udpUniversal Time daemon (utcd)utcdlast updated 2018/11/271507 tcpsymplexsymplexlast updated 2018/11/271507 udpsymplexsymplexlast updated 2018/11/271508 tcpdiagmonddiagmondlast updated 2018/11/271508 udpdiagmonddiagmondlast updated 2018/11/271509 tcpRobcad, Ltd. License Managerrobcad-lmlast updated 2018/11/271509 udpRobcad, Ltd. License Managerrobcad-lmlast updated 2018/11/271510 tcpMidland Valley Exploration Ltd. Lic. Man.mvx-lmlast updated 2018/11/271510 udpMidland Valley Exploration Ltd. Lic. Man.mvx-lmlast updated 2018/11/271511 tcp3l-l13l-l1last updated 2018/11/271511 udp3l-l13l-l1last updated 2018/11/271512 tcpMicrosoft's Windows Internet Name Servicewinslast updated 2018/11/271512 udpMicrosoft's Windows Internet Name Servicewinslast updated 2018/11/271513 tcpFujitsu Systems Business of America, Incfujitsu-dtclast updated 2018/11/271513 udpFujitsu Systems Business of America, Incfujitsu-dtclast updated 2018/11/271514 tcpFujitsu Systems Business of America, Incfujitsu-dtcnslast updated 2018/11/271514 udpFujitsu Systems Business of America, Incfujitsu-dtcnslast updated 2018/11/271515 tcpifor-protocolifor-protocollast updated 2018/11/271515 udpifor-protocolifor-protocollast updated 2018/11/271516 tcpVirtual Places Audio datavpadlast updated 2018/11/271516 udpVirtual Places Audio datavpadlast updated 2018/11/271517 tcpVirtual Places Audio controlvpaclast updated 2018/11/271517 udpVirtual Places Audio controlvpaclast updated 2018/11/271518 tcpVirtual Places Video datavpvdlast updated 2018/11/271518 udpVirtual Places Video datavpvdlast updated 2018/11/271519 tcpVirtual Places Video controlvpvclast updated 2018/11/271519 udpVirtual Places Video controlvpvclast updated 2018/11/271520 tcpatm zip officeatm-zip-officelast updated 2018/11/271520 udpatm zip officeatm-zip-officelast updated 2018/11/271521 tcpnCube License Managerncube-lmlast updated 2018/11/271521 udpnCube License Managerncube-lmlast updated 2018/11/271522 tcpRicardo North America License Managerricardo-lmlast updated 2018/11/271522 udpRicardo North America License Managerricardo-lmlast updated 2018/11/271523 tcpcichildcichild-lmlast updated 2018/11/271523 udpcichildcichild-lmlast updated 2018/11/271524 tcpingresingreslocklast updated 2018/11/271524 udpingresingreslocklast updated 2018/11/271525 tcporacleorasrvlast updated 2018/11/271525 udporacleorasrvlast updated 2018/11/271525 tcp (prospero-np)Prospero Directory Service non-privprospero-nplast updated 2018/11/271525 udp (prospero-np)Prospero Directory Service non-privprospero-nplast updated 2018/11/271526 tcpProspero Data Access Prot non-privpdap-nplast updated 2018/11/271526 udpProspero Data Access Prot non-privpdap-nplast updated 2018/11/271527 tcporacletlisrvlast updated 2018/11/271527 udporacletlisrvlast updated 2018/11/271528 tcpReservedN/Alast updated 2018/11/271528 udpNGR transport protocol for mobile ad-hoc networksngr-tlast updated 2018/11/271529 tcporaclecoauthorlast updated 2018/11/271529 udporaclecoauthorlast updated 2018/11/271530 tcprap-servicerap-servicelast updated 2018/11/271530 udprap-servicerap-servicelast updated 2018/11/271531 tcprap-listenrap-listenlast updated 2018/11/271531 udprap-listenrap-listenlast updated 2018/11/271532 tcpmiroconnectmiroconnectlast updated 2018/11/271532 udpmiroconnectmiroconnectlast updated 2018/11/271533 tcpVirtual Places Softwarevirtual-placeslast updated 2018/11/271533 udpVirtual Places Softwarevirtual-placeslast updated 2018/11/271534 tcpmicromuse-lmmicromuse-lmlast updated 2018/11/271534 udpmicromuse-lmmicromuse-lmlast updated 2018/11/271535 tcpampr-infoampr-infolast updated 2018/11/271535 udpampr-infoampr-infolast updated 2018/11/271536 tcpampr-interampr-interlast updated 2018/11/271536 udpampr-interampr-interlast updated 2018/11/271537 tcpisi-lmsdsc-lmlast updated 2018/11/271537 udpisi-lmsdsc-lmlast updated 2018/11/271538 tcp3ds-lm3ds-lmlast updated 2018/11/271538 udp3ds-lm3ds-lmlast updated 2018/11/271539 tcpIntellistor License Managerintellistor-lmlast updated 2018/11/271539 udpIntellistor License Managerintellistor-lmlast updated 2018/11/271540 tcprdsrdslast updated 2018/11/271540 udprdsrdslast updated 2018/11/271541 tcprds2rds2last updated 2018/11/271541 udprds2rds2last updated 2018/11/271542 tcpgridgen-elmdgridgen-elmdlast updated 2018/11/271542 udpgridgen-elmdgridgen-elmdlast updated 2018/11/271543 tcpsimba-cssimba-cslast updated 2018/11/271543 udpsimba-cssimba-cslast updated 2018/11/271544 tcpaspeclmdaspeclmdlast updated 2018/11/271544 udpaspeclmdaspeclmdlast updated 2018/11/271545 tcpvistium-sharevistium-sharelast updated 2018/11/271545 udpvistium-sharevistium-sharelast updated 2018/11/271546 tcpabbaccurayabbaccuraylast updated 2018/11/271546 udpabbaccurayabbaccuraylast updated 2018/11/271547 tcplaplinklaplinklast updated 2018/11/271547 udplaplinklaplinklast updated 2018/11/271548 tcpAxon License Manageraxon-lmlast updated 2018/11/271548 udpAxon License Manageraxon-lmlast updated 2018/11/271549 tcpShiva Hoseshivahoselast updated 2018/11/271549 udpShiva Soundshivasoundlast updated 2018/11/271550 tcpImage Storage license manager 3M Company3m-image-lmlast updated 2018/11/271550 udpImage Storage license manager 3M Company3m-image-lmlast updated 2018/11/271551 tcpHECMTL-DBhecmtl-dblast updated 2018/11/271551 udpHECMTL-DBhecmtl-dblast updated 2018/11/271552 tcppciarraypciarraylast updated 2018/11/271552 udppciarraypciarraylast updated 2018/11/271553 tcpsna-cssna-cslast updated 2018/11/271553 udpsna-cssna-cslast updated 2018/11/271554 tcpCACI Products Company License Managercaci-lmlast updated 2018/11/271554 udpCACI Products Company License Managercaci-lmlast updated 2018/11/271555 tcplivelanlivelanlast updated 2018/11/271555 udplivelanlivelanlast updated 2018/11/271556 tcpVERITAS Private Branch Exchange IANA assigned this well-formed service name as a replacement for "veritas_pbx".veritas-pbxlast updated 2018/11/271556 tcp (veritas_pbx)VERITAS Private Branch Exchangeveritas_pbxlast updated 2018/11/271556 udpVERITAS Private Branch Exchange IANA assigned this well-formed service name as a replacement for "veritas_pbx".veritas-pbxlast updated 2018/11/271556 udp (veritas_pbx)VERITAS Private Branch Exchangeveritas_pbxlast updated 2018/11/271557 tcpArborText License Managerarbortext-lmlast updated 2018/11/271557 udpArborText License Managerarbortext-lmlast updated 2018/11/271558 tcpxingmpegxingmpeglast updated 2018/11/271558 udpxingmpegxingmpeglast updated 2018/11/271559 tcpweb2hostweb2hostlast updated 2018/11/271559 udpweb2hostweb2hostlast updated 2018/11/271560 tcpASCI-RemoteSHADOWasci-vallast updated 2018/11/271560 udpASCI-RemoteSHADOWasci-vallast updated 2018/11/271561 tcpfacilityviewfacilityviewlast updated 2018/11/271561 udpfacilityviewfacilityviewlast updated 2018/11/271562 tcppconnectmgrpconnectmgrlast updated 2018/11/271562 udppconnectmgrpconnectmgrlast updated 2018/11/271563 tcpCadabra License Managercadabra-lmlast updated 2018/11/271563 udpCadabra License Managercadabra-lmlast updated 2018/11/271564 tcpPay-Per-Viewpay-per-viewlast updated 2018/11/271564 udpPay-Per-Viewpay-per-viewlast updated 2018/11/271565 tcpWinDDwinddlblast updated 2018/11/271565 udpWinDDwinddlblast updated 2018/11/271566 tcpCORELVIDEOcorelvideolast updated 2018/11/271566 udpCORELVIDEOcorelvideolast updated 2018/11/271567 tcpjlicelmdjlicelmdlast updated 2018/11/271567 udpjlicelmdjlicelmdlast updated 2018/11/271568 tcptsspmaptsspmaplast updated 2018/11/271568 udptsspmaptsspmaplast updated 2018/11/271569 tcpetsetslast updated 2018/11/271569 udpetsetslast updated 2018/11/271570 tcporbixdorbixdlast updated 2018/11/271570 udporbixdorbixdlast updated 2018/11/271571 tcpOracle Remote Data Baserdb-dbs-displast updated 2018/11/271571 udpOracle Remote Data Baserdb-dbs-displast updated 2018/11/271572 tcpChipcom License Managerchip-lmlast updated 2018/11/271572 udpChipcom License Managerchip-lmlast updated 2018/11/271573 tcpitscomm-nsitscomm-nslast updated 2018/11/271573 udpitscomm-nsitscomm-nslast updated 2018/11/271574 tcpmvel-lmmvel-lmlast updated 2018/11/271574 udpmvel-lmmvel-lmlast updated 2018/11/271575 tcporaclenamesoraclenameslast updated 2018/11/271575 udporaclenamesoraclenameslast updated 2018/11/271576 tcpMoldflow License Managermoldflow-lmlast updated 2018/11/271576 udpMoldflow License Managermoldflow-lmlast updated 2018/11/271577 tcphypercube-lmhypercube-lmlast updated 2018/11/271577 udphypercube-lmhypercube-lmlast updated 2018/11/271578 tcpJacobus License Managerjacobus-lmlast updated 2018/11/271578 udpJacobus License Managerjacobus-lmlast updated 2018/11/271579 tcpioc-sea-lmioc-sea-lmlast updated 2018/11/271579 udpioc-sea-lmioc-sea-lmlast updated 2018/11/271580 tcptn-tl-r1tn-tl-r1last updated 2018/11/271580 udptn-tl-r2tn-tl-r2last updated 2018/11/271581 tcpMIL-2045-47001mil-2045-47001last updated 2018/11/271581 udpMIL-2045-47001mil-2045-47001last updated 2018/11/271582 tcpMSIMSmsimslast updated 2018/11/271582 udpMSIMSmsimslast updated 2018/11/271583 tcpsimbaexpresssimbaexpresslast updated 2018/11/271583 udpsimbaexpresssimbaexpresslast updated 2018/11/271584 tcptn-tl-fd2tn-tl-fd2last updated 2018/11/271584 udptn-tl-fd2tn-tl-fd2last updated 2018/11/271585 tcpintvintvlast updated 2018/11/271585 udpintvintvlast updated 2018/11/271586 tcpibm-abtactibm-abtactlast updated 2018/11/271586 udpibm-abtactibm-abtactlast updated 2018/11/271587 tcppra_elmd IANA assigned this well-formed service name as a replacement for "pra_elmd".pra-elmdlast updated 2018/11/271587 tcp (pra_elmd)pra_elmdpra_elmdlast updated 2018/11/271587 udppra_elmd IANA assigned this well-formed service name as a replacement for "pra_elmd".pra-elmdlast updated 2018/11/271587 udp (pra_elmd)pra_elmdpra_elmdlast updated 2018/11/271588 tcptriquest-lmtriquest-lmlast updated 2018/11/271588 udptriquest-lmtriquest-lmlast updated 2018/11/271589 tcpVQPvqplast updated 2018/11/271589 udpVQPvqplast updated 2018/11/271590 tcpgemini-lmgemini-lmlast updated 2018/11/271590 udpgemini-lmgemini-lmlast updated 2018/11/271591 tcpncpm-pmncpm-pmlast updated 2018/11/271591 udpncpm-pmncpm-pmlast updated 2018/11/271592 tcpcommonspacecommonspacelast updated 2018/11/271592 udpcommonspacecommonspacelast updated 2018/11/271593 tcpmainsoft-lmmainsoft-lmlast updated 2018/11/271593 udpmainsoft-lmmainsoft-lmlast updated 2018/11/271594 tcpsixtraksixtraklast updated 2018/11/271594 udpsixtraksixtraklast updated 2018/11/271595 tcpradioradiolast updated 2018/11/271595 udpradioradiolast updated 2018/11/271596 tcpradio-smradio-smlast updated 2018/11/271596 udpradio-bcradio-bclast updated 2018/11/271597 tcporbplus-iioporbplus-iioplast updated 2018/11/271597 udporbplus-iioporbplus-iioplast updated 2018/11/271598 tcppicknfspicknfslast updated 2018/11/271598 udppicknfspicknfslast updated 2018/11/271599 tcpsimbaservicessimbaserviceslast updated 2018/11/271599 udpsimbaservicessimbaserviceslast updated 2018/11/271600 tcpissdissdlast updated 2018/11/271600 udpissdissdlast updated 2018/11/271601 tcpaasaaslast updated 2018/11/271601 udpaasaaslast updated 2018/11/271602 tcpinspectinspectlast updated 2018/11/271602 udpinspectinspectlast updated 2018/11/271603 tcppickodbcpicodbclast updated 2018/11/271603 udppickodbcpicodbclast updated 2018/11/271604 tcpicabrowsericabrowserlast updated 2018/11/271604 udpicabrowsericabrowserlast updated 2018/11/271605 tcpSalutation Manager (Salutation Protocol)slplast updated 2018/11/271605 udpSalutation Manager (Salutation Protocol)slplast updated 2018/11/271606 tcpSalutation Manager (SLM-API)slm-apilast updated 2018/11/271606 udpSalutation Manager (SLM-API)slm-apilast updated 2018/11/271607 tcpsttsttlast updated 2018/11/271607 udpsttsttlast updated 2018/11/271608 tcpSmart Corp. License Managersmart-lmlast updated 2018/11/271608 udpSmart Corp. License Managersmart-lmlast updated 2018/11/271609 tcpisysg-lmisysg-lmlast updated 2018/11/271609 udpisysg-lmisysg-lmlast updated 2018/11/271610 tcptaurus-whtaurus-whlast updated 2018/11/271610 udptaurus-whtaurus-whlast updated 2018/11/271611 tcpInter Library Loanilllast updated 2018/11/271611 udpInter Library Loanilllast updated 2018/11/271612 tcpNetBill Transaction Servernetbill-translast updated 2018/11/271612 udpNetBill Transaction Servernetbill-translast updated 2018/11/271613 tcpNetBill Key Repositorynetbill-keyreplast updated 2018/11/271613 udpNetBill Key Repositorynetbill-keyreplast updated 2018/11/271614 tcpNetBill Credential Servernetbill-credlast updated 2018/11/271614 udpNetBill Credential Servernetbill-credlast updated 2018/11/271615 tcpNetBill Authorization Servernetbill-authlast updated 2018/11/271615 udpNetBill Authorization Servernetbill-authlast updated 2018/11/271616 tcpNetBill Product Servernetbill-prodlast updated 2018/11/271616 udpNetBill Product Servernetbill-prodlast updated 2018/11/271617 tcpNimrod Inter-Agent Communicationnimrod-agentlast updated 2018/11/271617 udpNimrod Inter-Agent Communicationnimrod-agentlast updated 2018/11/271618 tcpskytelnetskytelnetlast updated 2018/11/271618 udpskytelnetskytelnetlast updated 2018/11/271619 tcpxs-openstoragexs-openstoragelast updated 2018/11/271619 udpxs-openstoragexs-openstoragelast updated 2018/11/271620 tcpfaxportwinportfaxportwinportlast updated 2018/11/271620 udpfaxportwinportfaxportwinportlast updated 2018/11/271621 tcpsoftdataphonesoftdataphonelast updated 2018/11/271621 udpsoftdataphonesoftdataphonelast updated 2018/11/271622 tcpontimeontimelast updated 2018/11/271622 udpontimeontimelast updated 2018/11/271623 tcpjaleosndjaleosndlast updated 2018/11/271623 udpjaleosndjaleosndlast updated 2018/11/271624 tcpudp-sr-portudp-sr-portlast updated 2018/11/271624 udpudp-sr-portudp-sr-portlast updated 2018/11/271625 tcpsvs-omagentsvs-omagentlast updated 2018/11/271625 udpsvs-omagentsvs-omagentlast updated 2018/11/271626 tcpShockwaveshockwavelast updated 2018/11/271626 udpShockwaveshockwavelast updated 2018/11/271627 tcpT.128 Gatewayt128-gatewaylast updated 2018/11/271627 udpT.128 Gatewayt128-gatewaylast updated 2018/11/271628 tcpLonTalk normallontalk-normlast updated 2018/11/271628 udpLonTalk normallontalk-normlast updated 2018/11/271629 tcpLonTalk urgentlontalk-urgntlast updated 2018/11/271629 udpLonTalk urgentlontalk-urgntlast updated 2018/11/271630 tcpOracle Net8 Cmanoraclenet8cmanlast updated 2018/11/271630 udpOracle Net8 Cmanoraclenet8cmanlast updated 2018/11/271631 tcpVisit viewvisitviewlast updated 2018/11/271631 udpVisit viewvisitviewlast updated 2018/11/271632 tcpPAMMRATCpammratclast updated 2018/11/271632 udpPAMMRATCpammratclast updated 2018/11/271633 tcpPAMMRPCpammrpclast updated 2018/11/271633 udpPAMMRPCpammrpclast updated 2018/11/271634 tcpLog On America Probeloaprobelast updated 2018/11/271634 udpLog On America Probeloaprobelast updated 2018/11/271635 tcpEDB Server 1edb-server1last updated 2018/11/271635 udpEDB Server 1edb-server1last updated 2018/11/271636 tcpISP shared public data controlisdclast updated 2018/11/271636 udpISP shared public data controlisdclast updated 2018/11/271637 tcpISP shared local data controlislclast updated 2018/11/271637 udpISP shared local data controlislclast updated 2018/11/271638 tcpISP shared management controlismclast updated 2018/11/271638 udpISP shared management controlismclast updated 2018/11/271639 tcpcert-initiatorcert-initiatorlast updated 2018/11/271639 udpcert-initiatorcert-initiatorlast updated 2018/11/271640 tcpcert-respondercert-responderlast updated 2018/11/271640 udpcert-respondercert-responderlast updated 2018/11/271641 tcpInVisioninvisionlast updated 2018/11/271641 udpInVisioninvisionlast updated 2018/11/271642 tcpisis-amisis-amlast updated 2018/11/271642 udpisis-amisis-amlast updated 2018/11/271643 tcpisis-ambcisis-ambclast updated 2018/11/271643 udpisis-ambcisis-ambclast updated 2018/11/271644 tcpSatellite-data Acquisition System 4saisehlast updated 2018/11/271644 udpSatellite-data Acquisition System 4saisehlast updated 2018/11/271645 tcpSightLinesightlinelast updated 2018/11/271645 udpSightLinesightlinelast updated 2018/11/271646 tcpsa-msg-portsa-msg-portlast updated 2018/11/271646 udpsa-msg-portsa-msg-portlast updated 2018/11/271647 tcprsaprsaplast updated 2018/11/271647 udprsaprsaplast updated 2018/11/271648 tcpconcurrent-lmconcurrent-lmlast updated 2018/11/271648 udpconcurrent-lmconcurrent-lmlast updated 2018/11/271649 tcpkermitkermitlast updated 2018/11/271649 udpkermitkermitlast updated 2018/11/271650 tcpnkdnnkdlast updated 2018/11/271650 udpnkdnkdlast updated 2018/11/271651 tcpshiva_confsrvr IANA assigned this well-formed service name as a replacement for "shiva_confsrvr".shiva-confsrvrlast updated 2018/11/271651 tcp (shiva_confsrvr)shiva_confsrvrshiva_confsrvrlast updated 2018/11/271651 udpshiva_confsrvr IANA assigned this well-formed service name as a replacement for "shiva_confsrvr".shiva-confsrvrlast updated 2018/11/271651 udp (shiva_confsrvr)shiva_confsrvrshiva_confsrvrlast updated 2018/11/271652 tcpxnmpxnmplast updated 2018/11/271652 udpxnmpxnmplast updated 2018/11/271653 tcpalphatech-lmalphatech-lmlast updated 2018/11/271653 udpalphatech-lmalphatech-lmlast updated 2018/11/271654 tcpstargatealertsstargatealertslast updated 2018/11/271654 udpstargatealertsstargatealertslast updated 2018/11/271655 tcpdec-mbadmindec-mbadminlast updated 2018/11/271655 udpdec-mbadmindec-mbadminlast updated 2018/11/271656 tcpdec-mbadmin-hdec-mbadmin-hlast updated 2018/11/271656 udpdec-mbadmin-hdec-mbadmin-hlast updated 2018/11/271657 tcpfujitsu-mmpdcfujitsu-mmpdclast updated 2018/11/271657 udpfujitsu-mmpdcfujitsu-mmpdclast updated 2018/11/271658 tcpsixnetudrsixnetudrlast updated 2018/11/271658 udpsixnetudrsixnetudrlast updated 2018/11/271659 tcpSilicon Grail License Managersg-lmlast updated 2018/11/271659 udpSilicon Grail License Managersg-lmlast updated 2018/11/271660 tcpskip-mc-gikreqskip-mc-gikreqlast updated 2018/11/271660 udpskip-mc-gikreqskip-mc-gikreqlast updated 2018/11/271661 tcpnetview-aix-1netview-aix-1last updated 2018/11/271661 udpnetview-aix-1netview-aix-1last updated 2018/11/271662 tcpnetview-aix-2netview-aix-2last updated 2018/11/271662 udpnetview-aix-2netview-aix-2last updated 2018/11/271663 tcpnetview-aix-3netview-aix-3last updated 2018/11/271663 udpnetview-aix-3netview-aix-3last updated 2018/11/271664 tcpnetview-aix-4netview-aix-4last updated 2018/11/271664 udpnetview-aix-4netview-aix-4last updated 2018/11/271665 tcpnetview-aix-5netview-aix-5last updated 2018/11/271665 udpnetview-aix-5netview-aix-5last updated 2018/11/271666 tcpnetview-aix-6netview-aix-6last updated 2018/11/271666 udpnetview-aix-6netview-aix-6last updated 2018/11/271667 tcpnetview-aix-7netview-aix-7last updated 2018/11/271667 udpnetview-aix-7netview-aix-7last updated 2018/11/271668 tcpnetview-aix-8netview-aix-8last updated 2018/11/271668 udpnetview-aix-8netview-aix-8last updated 2018/11/271669 tcpnetview-aix-9netview-aix-9last updated 2018/11/271669 udpnetview-aix-9netview-aix-9last updated 2018/11/271670 tcpnetview-aix-10netview-aix-10last updated 2018/11/271670 udpnetview-aix-10netview-aix-10last updated 2018/11/271671 tcpnetview-aix-11netview-aix-11last updated 2018/11/271671 udpnetview-aix-11netview-aix-11last updated 2018/11/271672 tcpnetview-aix-12netview-aix-12last updated 2018/11/271672 udpnetview-aix-12netview-aix-12last updated 2018/11/271673 tcpIntel Proshare Multicastproshare-mc-1last updated 2018/11/271673 udpIntel Proshare Multicastproshare-mc-1last updated 2018/11/271674 tcpIntel Proshare Multicastproshare-mc-2last updated 2018/11/271674 udpIntel Proshare Multicastproshare-mc-2last updated 2018/11/271675 tcpPacific Data Productspdplast updated 2018/11/271675 udpPacific Data Productspdplast updated 2018/11/271676 tcpnetcomm1netcomm1last updated 2018/11/271676 udpnetcomm2netcomm2last updated 2018/11/271677 tcpgroupwisegroupwiselast updated 2018/11/271677 udpgroupwisegroupwiselast updated 2018/11/271678 tcpprolinkprolinklast updated 2018/11/271678 udpprolinkprolinklast updated 2018/11/271679 tcpdarcorp-lmdarcorp-lmlast updated 2018/11/271679 udpdarcorp-lmdarcorp-lmlast updated 2018/11/271680 tcpmicrocom-sbpmicrocom-sbplast updated 2018/11/271680 udpmicrocom-sbpmicrocom-sbplast updated 2018/11/271681 tcpsd-elmdsd-elmdlast updated 2018/11/271681 udpsd-elmdsd-elmdlast updated 2018/11/271682 tcplanyon-lanternlanyon-lanternlast updated 2018/11/271682 udplanyon-lanternlanyon-lanternlast updated 2018/11/271683 tcpncpm-hipncpm-hiplast updated 2018/11/271683 udpncpm-hipncpm-hiplast updated 2018/11/271684 tcpSnareSecuresnaresecurelast updated 2018/11/271684 udpSnareSecuresnaresecurelast updated 2018/11/271685 tcpn2nremoten2nremotelast updated 2018/11/271685 udpn2nremoten2nremotelast updated 2018/11/271686 tcpcvmoncvmonlast updated 2018/11/271686 udpcvmoncvmonlast updated 2018/11/271687 tcpnsjtp-ctrlnsjtp-ctrllast updated 2018/11/271687 udpnsjtp-ctrlnsjtp-ctrllast updated 2018/11/271688 tcpnsjtp-datansjtp-datalast updated 2018/11/271688 udpnsjtp-datansjtp-datalast updated 2018/11/271689 tcpfirefoxfirefoxlast updated 2018/11/271689 udpfirefoxfirefoxlast updated 2018/11/271690 tcpng-umdsng-umdslast updated 2018/11/271690 udpng-umdsng-umdslast updated 2018/11/271691 tcpempire-empumaempire-empumalast updated 2018/11/271691 udpempire-empumaempire-empumalast updated 2018/11/271692 tcpsstsys-lmsstsys-lmlast updated 2018/11/271692 udpsstsys-lmsstsys-lmlast updated 2018/11/271693 tcprrirtrrrirtrlast updated 2018/11/271693 udprrirtrrrirtrlast updated 2018/11/271694 tcprrimwmrrimwmlast updated 2018/11/271694 udprrimwmrrimwmlast updated 2018/11/271695 tcprrilwmrrilwmlast updated 2018/11/271695 udprrilwmrrilwmlast updated 2018/11/271696 tcprrifmmrrifmmlast updated 2018/11/271696 udprrifmmrrifmmlast updated 2018/11/271697 tcprrisatrrisatlast updated 2018/11/271697 udprrisatrrisatlast updated 2018/11/271698 tcpRSVP-ENCAPSULATION-1rsvp-encap-1last updated 2018/11/271698 udpRSVP-ENCAPSULATION-1rsvp-encap-1last updated 2018/11/271699 tcpRSVP-ENCAPSULATION-2rsvp-encap-2last updated 2018/11/271699 udpRSVP-ENCAPSULATION-2rsvp-encap-2last updated 2018/11/271700 tcpmps-raftmps-raftlast updated 2018/11/271700 udpmps-raftmps-raftlast updated 2018/11/271701 tcpl2fl2flast updated 2018/11/271701 udpl2fl2flast updated 2018/11/271701 tcp (l2tp)l2tpl2tplast updated 2018/11/271701 udp (l2tp)l2tpl2tplast updated 2018/11/271702 tcpdesksharedesksharelast updated 2018/11/271702 udpdesksharedesksharelast updated 2018/11/271703 tcphb-enginehb-enginelast updated 2018/11/271703 udphb-enginehb-enginelast updated 2018/11/271704 tcpbcs-brokerbcs-brokerlast updated 2018/11/271704 udpbcs-brokerbcs-brokerlast updated 2018/11/271705 tcpslingshotslingshotlast updated 2018/11/271705 udpslingshotslingshotlast updated 2018/11/271706 tcpjetformjetformlast updated 2018/11/271706 udpjetformjetformlast updated 2018/11/271707 tcpvdmplayvdmplaylast updated 2018/11/271707 udpvdmplayvdmplaylast updated 2018/11/271708 tcpgat-lmdgat-lmdlast updated 2018/11/271708 udpgat-lmdgat-lmdlast updated 2018/11/271709 tcpcentracentralast updated 2018/11/271709 udpcentracentralast updated 2018/11/271710 tcpimperaimperalast updated 2018/11/271710 udpimperaimperalast updated 2018/11/271711 tcppptconferencepptconferencelast updated 2018/11/271711 udppptconferencepptconferencelast updated 2018/11/271712 tcpresource monitoring serviceregistrarlast updated 2018/11/271712 udpresource monitoring serviceregistrarlast updated 2018/11/271713 tcpConferenceTalkconferencetalklast updated 2018/11/271713 udpConferenceTalkconferencetalklast updated 2018/11/271714 tcpsesi-lmsesi-lmlast updated 2018/11/271714 udpsesi-lmsesi-lmlast updated 2018/11/271715 tcphoudini-lmhoudini-lmlast updated 2018/11/271715 udphoudini-lmhoudini-lmlast updated 2018/11/271716 tcpxmsgxmsglast updated 2018/11/271716 udpxmsgxmsglast updated 2018/11/271717 tcpfj-hdnetfj-hdnetlast updated 2018/11/271717 udpfj-hdnetfj-hdnetlast updated 2018/11/271718 tcpH.323 Multicast Gatekeeper Discoverh323gatedisclast updated 2018/11/271718 udpH.323 Multicast Gatekeeper Discoverh323gatedisclast updated 2018/11/271719 tcpH.323 Unicast Gatekeeper Signalingh323gatestatlast updated 2018/11/271719 udpH.323 Unicast Gatekeeper Signalingh323gatestatlast updated 2018/11/271720 tcpH.323 Call Control Signallingh323hostcalllast updated 2018/11/271720 udpH.323 Call Control Signallingh323hostcalllast updated 2018/11/271720 sctpH.323 Call Controlh323hostcalllast updated 2018/11/271721 tcpcaiccicaiccilast updated 2018/11/271721 udpcaiccicaiccilast updated 2018/11/271722 tcpHKS License Managerhks-lmlast updated 2018/11/271722 udpHKS License Managerhks-lmlast updated 2018/11/271723 tcppptppptplast updated 2018/11/271723 udppptppptplast updated 2018/11/271724 tcpcsbphonemastercsbphonemasterlast updated 2018/11/271724 udpcsbphonemastercsbphonemasterlast updated 2018/11/271725 tcpiden-ralpiden-ralplast updated 2018/11/271725 udpiden-ralpiden-ralplast updated 2018/11/271726 tcpIBERIAGAMESiberiagameslast updated 2018/11/271726 udpIBERIAGAMESiberiagameslast updated 2018/11/271727 tcpwinddxwinddxlast updated 2018/11/271727 udpwinddxwinddxlast updated 2018/11/271728 tcpTELINDUStelinduslast updated 2018/11/271728 udpTELINDUStelinduslast updated 2018/11/271729 tcpCityNL License Managementcitynllast updated 2018/11/271729 udpCityNL License Managementcitynllast updated 2018/11/271730 tcproketzroketzlast updated 2018/11/271730 udproketzroketzlast updated 2018/11/271731 tcpMSICCPmsiccplast updated 2018/11/271731 udpMSICCPmsiccplast updated 2018/11/271732 tcpproximproximlast updated 2018/11/271732 udpproximproximlast updated 2018/11/271733 tcpSIMS - SIIPAT Protocol for Alarm Transmissionsiipatlast updated 2018/11/271733 udpSIMS - SIIPAT Protocol for Alarm Transmissionsiipatlast updated 2018/11/271734 tcpCamber Corporation License Managementcambertx-lmlast updated 2018/11/271734 udpCamber Corporation License Managementcambertx-lmlast updated 2018/11/271735 tcpPrivateChatprivatechatlast updated 2018/11/271735 udpPrivateChatprivatechatlast updated 2018/11/271736 tcpstreet-streamstreet-streamlast updated 2018/11/271736 udpstreet-streamstreet-streamlast updated 2018/11/271737 tcpultimadultimadlast updated 2018/11/271737 udpultimadultimadlast updated 2018/11/271738 tcpGameGen1gamegen1last updated 2018/11/271738 udpGameGen1gamegen1last updated 2018/11/271739 tcpwebaccesswebaccesslast updated 2018/11/271739 udpwebaccesswebaccesslast updated 2018/11/271740 tcpencoreencorelast updated 2018/11/271740 udpencoreencorelast updated 2018/11/271741 tcpcisco-net-mgmtcisco-net-mgmtlast updated 2018/11/271741 udpcisco-net-mgmtcisco-net-mgmtlast updated 2018/11/271742 tcp3Com-nsd3Com-nsdlast updated 2018/11/271742 udp3Com-nsd3Com-nsdlast updated 2018/11/271743 tcpCinema Graphics License Managercinegrfx-lmlast updated 2018/11/271743 udpCinema Graphics License Managercinegrfx-lmlast updated 2018/11/271744 tcpncpm-ftncpm-ftlast updated 2018/11/271744 udpncpm-ftncpm-ftlast updated 2018/11/271745 tcpremote-winsockremote-winsocklast updated 2018/11/271745 udpremote-winsockremote-winsocklast updated 2018/11/271746 tcpftrapid-1ftrapid-1last updated 2018/11/271746 udpftrapid-1ftrapid-1last updated 2018/11/271747 tcpftrapid-2ftrapid-2last updated 2018/11/271747 udpftrapid-2ftrapid-2last updated 2018/11/271748 tcporacle-em1oracle-em1last updated 2018/11/271748 udporacle-em1oracle-em1last updated 2018/11/271749 tcpaspen-servicesaspen-serviceslast updated 2018/11/271749 udpaspen-servicesaspen-serviceslast updated 2018/11/271750 tcpSimple Socket Library's PortMastersslplast updated 2018/11/271750 udpSimple Socket Library's PortMastersslplast updated 2018/11/271751 tcpSwiftNetswiftnetlast updated 2018/11/271751 udpSwiftNetswiftnetlast updated 2018/11/271752 tcpLeap of Faith Research License Managerlofr-lmlast updated 2018/11/271752 udpLeap of Faith Research License Managerlofr-lmlast updated 2018/11/271753 tcpPredatar Comms Servicepredatar-commslast updated 2018/11/271753 udpReservedN/Alast updated 2018/11/271754 tcporacle-em2oracle-em2last updated 2018/11/271754 udporacle-em2oracle-em2last updated 2018/11/271755 tcpms-streamingms-streaminglast updated 2018/11/271755 udpms-streamingms-streaminglast updated 2018/11/271756 tcpcapfast-lmdcapfast-lmdlast updated 2018/11/271756 udpcapfast-lmdcapfast-lmdlast updated 2018/11/271757 tcpcnhrpcnhrplast updated 2018/11/271757 udpcnhrpcnhrplast updated 2018/11/271758 tcptftp-mcasttftp-mcastlast updated 2018/11/271758 udptftp-mcasttftp-mcastlast updated 2018/11/271759 tcpSPSS License Managerspss-lmlast updated 2018/11/271759 udpSPSS License Managerspss-lmlast updated 2018/11/271760 tcpwww-ldap-gwwww-ldap-gwlast updated 2018/11/271760 udpwww-ldap-gwwww-ldap-gwlast updated 2018/11/271761 tcpcft-0cft-0last updated 2018/11/271761 udpcft-0cft-0last updated 2018/11/271762 tcpcft-1cft-1last updated 2018/11/271762 udpcft-1cft-1last updated 2018/11/271763 tcpcft-2cft-2last updated 2018/11/271763 udpcft-2cft-2last updated 2018/11/271764 tcpcft-3cft-3last updated 2018/11/271764 udpcft-3cft-3last updated 2018/11/271765 tcpcft-4cft-4last updated 2018/11/271765 udpcft-4cft-4last updated 2018/11/271766 tcpcft-5cft-5last updated 2018/11/271766 udpcft-5cft-5last updated 2018/11/271767 tcpcft-6cft-6last updated 2018/11/271767 udpcft-6cft-6last updated 2018/11/271768 tcpcft-7cft-7last updated 2018/11/271768 udpcft-7cft-7last updated 2018/11/271769 tcpbmc-net-admbmc-net-admlast updated 2018/11/271769 udpbmc-net-admbmc-net-admlast updated 2018/11/271770 tcpbmc-net-svcbmc-net-svclast updated 2018/11/271770 udpbmc-net-svcbmc-net-svclast updated 2018/11/271771 tcpvaultbasevaultbaselast updated 2018/11/271771 udpvaultbasevaultbaselast updated 2018/11/271772 tcpEssWeb Gatewayessweb-gwlast updated 2018/11/271772 udpEssWeb Gatewayessweb-gwlast updated 2018/11/271773 tcpKMSControlkmscontrollast updated 2018/11/271773 udpKMSControlkmscontrollast updated 2018/11/271774 tcpglobal-dtservglobal-dtservlast updated 2018/11/271774 udpglobal-dtservglobal-dtservlast updated 2018/11/271775 tcpdata interchange between visual processing containersvdablast updated 2018/11/271775 udpReservedN/Alast updated 2018/11/271776 tcpFederal Emergency Management Information Systemfemislast updated 2018/11/271776 udpFederal Emergency Management Information Systemfemislast updated 2018/11/271777 tcppowerguardianpowerguardianlast updated 2018/11/271777 udppowerguardianpowerguardianlast updated 2018/11/271778 tcpprodigy-internetprodigy-intrnetlast updated 2018/11/271778 udpprodigy-internetprodigy-intrnetlast updated 2018/11/271779 tcppharmasoftpharmasoftlast updated 2018/11/271779 udppharmasoftpharmasoftlast updated 2018/11/271780 tcpdpkeyservdpkeyservlast updated 2018/11/271780 udpdpkeyservdpkeyservlast updated 2018/11/271781 tcpanswersoft-lmanswersoft-lmlast updated 2018/11/271781 udpanswersoft-lmanswersoft-lmlast updated 2018/11/271782 tcphp-hciphp-hciplast updated 2018/11/271782 udphp-hciphp-hciplast updated 2018/11/271783 Decomissioned Port 04/14/00, msN/Alast updated 2018/11/271784 tcpFinle License Managerfinle-lmlast updated 2018/11/271784 udpFinle License Managerfinle-lmlast updated 2018/11/271785 tcpWind River Systems License Managerwindlmlast updated 2018/11/271785 udpWind River Systems License Managerwindlmlast updated 2018/11/271786 tcpfunk-loggerfunk-loggerlast updated 2018/11/271786 udpfunk-loggerfunk-loggerlast updated 2018/11/271787 tcpfunk-licensefunk-licenselast updated 2018/11/271787 udpfunk-licensefunk-licenselast updated 2018/11/271788 tcppsmondpsmondlast updated 2018/11/271788 udppsmondpsmondlast updated 2018/11/271789 tcphellohellolast updated 2018/11/271789 udphellohellolast updated 2018/11/271790 tcpNarrative Media Streaming Protocolnmsplast updated 2018/11/271790 udpNarrative Media Streaming Protocolnmsplast updated 2018/11/271791 tcpEA1ea1last updated 2018/11/271791 udpEA1ea1last updated 2018/11/271792 tcpibm-dt-2ibm-dt-2last updated 2018/11/271792 udpibm-dt-2ibm-dt-2last updated 2018/11/271793 tcprsc-robotrsc-robotlast updated 2018/11/271793 udprsc-robotrsc-robotlast updated 2018/11/271794 tcpcera-bcmcera-bcmlast updated 2018/11/271794 udpcera-bcmcera-bcmlast updated 2018/11/271795 tcpdpi-proxydpi-proxylast updated 2018/11/271795 udpdpi-proxydpi-proxylast updated 2018/11/271796 tcpVocaltec Server Administrationvocaltec-adminlast updated 2018/11/271796 udpVocaltec Server Administrationvocaltec-adminlast updated 2018/11/271797 tcpUMAumalast updated 2018/11/271797 udpUMAumalast updated 2018/11/271798 tcpEvent Transfer Protocoletplast updated 2018/11/271798 udpEvent Transfer Protocoletplast updated 2018/11/271799 tcpNETRISKnetrisklast updated 2018/11/271799 udpNETRISKnetrisklast updated 2018/11/271800 tcpANSYS-License manageransys-lmlast updated 2018/11/271800 udpANSYS-License manageransys-lmlast updated 2018/11/271801 tcpMicrosoft Message Quemsmqlast updated 2018/11/271801 udpMicrosoft Message Quemsmqlast updated 2018/11/271802 tcpConComp1concomp1last updated 2018/11/271802 udpConComp1concomp1last updated 2018/11/271803 tcpHP-HCIP-GWYhp-hcip-gwylast updated 2018/11/271803 udpHP-HCIP-GWYhp-hcip-gwylast updated 2018/11/271804 tcpENLenllast updated 2018/11/271804 udpENLenllast updated 2018/11/271805 tcpENL-Nameenl-namelast updated 2018/11/271805 udpENL-Nameenl-namelast updated 2018/11/271806 tcpMusiconlinemusiconlinelast updated 2018/11/271806 udpMusiconlinemusiconlinelast updated 2018/11/271807 tcpFujitsu Hot Standby Protocolfhsplast updated 2018/11/271807 udpFujitsu Hot Standby Protocolfhsplast updated 2018/11/271808 tcpOracle-VP2oracle-vp2last updated 2018/11/271808 udpOracle-VP2oracle-vp2last updated 2018/11/271809 tcpOracle-VP1oracle-vp1last updated 2018/11/271809 udpOracle-VP1oracle-vp1last updated 2018/11/271810 tcpJerand License Managerjerand-lmlast updated 2018/11/271810 udpJerand License Managerjerand-lmlast updated 2018/11/271811 tcpScientia-SDBscientia-sdblast updated 2018/11/271811 udpScientia-SDBscientia-sdblast updated 2018/11/271812 tcpRADIUSradiuslast updated 2018/11/271812 udpRADIUSradiuslast updated 2018/11/271813 tcpRADIUS Accountingradius-acctlast updated 2018/11/271813 udpRADIUS Accountingradius-acctlast updated 2018/11/271814 tcpTDP Suitetdp-suitelast updated 2018/11/271814 udpTDP Suitetdp-suitelast updated 2018/11/271815 tcpMMPFTmmpftlast updated 2018/11/271815 udpMMPFTmmpftlast updated 2018/11/271816 tcpHARPharplast updated 2018/11/271816 udpHARPharplast updated 2018/11/271817 tcpRKB-OSCSrkb-oscslast updated 2018/11/271817 udpRKB-OSCSrkb-oscslast updated 2018/11/271818 tcpEnhanced Trivial File Transfer Protocoletftplast updated 2018/11/271818 udpEnhanced Trivial File Transfer Protocoletftplast updated 2018/11/271819 tcpPlato License Managerplato-lmlast updated 2018/11/271819 udpPlato License Managerplato-lmlast updated 2018/11/271820 tcpmcagentmcagentlast updated 2018/11/271820 udpmcagentmcagentlast updated 2018/11/271821 tcpdonnyworlddonnyworldlast updated 2018/11/271821 udpdonnyworlddonnyworldlast updated 2018/11/271822 tcpes-elmdes-elmdlast updated 2018/11/271822 udpes-elmdes-elmdlast updated 2018/11/271823 tcpUnisys Natural Language License Managerunisys-lmlast updated 2018/11/271823 udpUnisys Natural Language License Managerunisys-lmlast updated 2018/11/271824 tcpmetrics-pasmetrics-paslast updated 2018/11/271824 udpmetrics-pasmetrics-paslast updated 2018/11/271825 tcpDirecPC Videodirecpc-videolast updated 2018/11/271825 udpDirecPC Videodirecpc-videolast updated 2018/11/271826 tcpARDTardtlast updated 2018/11/271826 udpARDTardtlast updated 2018/11/271827 tcpASIasilast updated 2018/11/271827 udpASIasilast updated 2018/11/271828 tcpitm-mcell-uitm-mcell-ulast updated 2018/11/271828 udpitm-mcell-uitm-mcell-ulast updated 2018/11/271829 tcpOptika eMediaoptika-emedialast updated 2018/11/271829 udpOptika eMediaoptika-emedialast updated 2018/11/271830 tcpOracle Net8 CMan Adminnet8-cmanlast updated 2018/11/271830 udpOracle Net8 CMan Adminnet8-cmanlast updated 2018/11/271831 tcpMyrtlemyrtlelast updated 2018/11/271831 udpMyrtlemyrtlelast updated 2018/11/271832 tcpThoughtTreasuretht-treasurelast updated 2018/11/271832 udpThoughtTreasuretht-treasurelast updated 2018/11/271833 tcpudpradioudpradiolast updated 2018/11/271833 udpudpradioudpradiolast updated 2018/11/271834 tcpARDUS Unicastardusunilast updated 2018/11/271834 udpARDUS Unicastardusunilast updated 2018/11/271835 tcpARDUS Multicastardusmullast updated 2018/11/271835 udpARDUS Multicastardusmullast updated 2018/11/271836 tcpste-smscste-smsclast updated 2018/11/271836 udpste-smscste-smsclast updated 2018/11/271837 tcpcsoft1csoft1last updated 2018/11/271837 udpcsoft1csoft1last updated 2018/11/271838 tcpTALNETtalnetlast updated 2018/11/271838 udpTALNETtalnetlast updated 2018/11/271839 tcpnetopia-vo1netopia-vo1last updated 2018/11/271839 udpnetopia-vo1netopia-vo1last updated 2018/11/271840 tcpnetopia-vo2netopia-vo2last updated 2018/11/271840 udpnetopia-vo2netopia-vo2last updated 2018/11/271841 tcpnetopia-vo3netopia-vo3last updated 2018/11/271841 udpnetopia-vo3netopia-vo3last updated 2018/11/271842 tcpnetopia-vo4netopia-vo4last updated 2018/11/271842 udpnetopia-vo4netopia-vo4last updated 2018/11/271843 tcpnetopia-vo5netopia-vo5last updated 2018/11/271843 udpnetopia-vo5netopia-vo5last updated 2018/11/271844 tcpDirecPC-DLLdirecpc-dlllast updated 2018/11/271844 udpDirecPC-DLLdirecpc-dlllast updated 2018/11/271845 tcpaltalinkaltalinklast updated 2018/11/271845 udpaltalinkaltalinklast updated 2018/11/271846 tcpTunstall PNCtunstall-pnclast updated 2018/11/271846 udpTunstall PNCtunstall-pnclast updated 2018/11/271847 tcpSLP Notificationslp-notifylast updated 2018/11/271847 udpSLP Notificationslp-notifylast updated 2018/11/271848 tcpfjdocdistfjdocdistlast updated 2018/11/271848 udpfjdocdistfjdocdistlast updated 2018/11/271849 tcpALPHA-SMSalpha-smslast updated 2018/11/271849 udpALPHA-SMSalpha-smslast updated 2018/11/271850 tcpGSIgsilast updated 2018/11/271850 udpGSIgsilast updated 2018/11/271851 tcpctcdctcdlast updated 2018/11/271851 udpctcdctcdlast updated 2018/11/271852 tcpVirtual Timevirtual-timelast updated 2018/11/271852 udpVirtual Timevirtual-timelast updated 2018/11/271853 tcpVIDS-AVTPvids-avtplast updated 2018/11/271853 udpVIDS-AVTPvids-avtplast updated 2018/11/271854 tcpBuddy Drawbuddy-drawlast updated 2018/11/271854 udpBuddy Drawbuddy-drawlast updated 2018/11/271855 tcpFiorano RtrSvcfiorano-rtrsvclast updated 2018/11/271855 udpFiorano RtrSvcfiorano-rtrsvclast updated 2018/11/271856 tcpFiorano MsgSvcfiorano-msgsvclast updated 2018/11/271856 udpFiorano MsgSvcfiorano-msgsvclast updated 2018/11/271857 tcpDataCaptordatacaptorlast updated 2018/11/271857 udpDataCaptordatacaptorlast updated 2018/11/271858 tcpPrivateArkprivatearklast updated 2018/11/271858 udpPrivateArkprivatearklast updated 2018/11/271859 tcpGamma Fetcher Servergammafetchsvrlast updated 2018/11/271859 udpGamma Fetcher Servergammafetchsvrlast updated 2018/11/271860 tcpSunSCALAR Servicessunscalar-svclast updated 2018/11/271860 udpSunSCALAR Servicessunscalar-svclast updated 2018/11/271861 tcpLeCroy VICPlecroy-vicplast updated 2018/11/271861 udpLeCroy VICPlecroy-vicplast updated 2018/11/271862 tcpMySQL Cluster Manager Agentmysql-cm-agentlast updated 2018/11/271862 udpMySQL Cluster Manager Agentmysql-cm-agentlast updated 2018/11/271863 tcpMSNPmsnplast updated 2018/11/271863 udpMSNPmsnplast updated 2018/11/271864 tcpParadym 31 Portparadym-31portlast updated 2018/11/271864 udpParadym 31 Portparadym-31portlast updated 2018/11/271865 tcpENTPentplast updated 2018/11/271865 udpENTPentplast updated 2018/11/271866 tcpswrmiswrmilast updated 2018/11/271866 udpswrmiswrmilast updated 2018/11/271867 tcpUDRIVEudrivelast updated 2018/11/271867 udpUDRIVEudrivelast updated 2018/11/271868 tcpVizibleBrowserviziblebrowserlast updated 2018/11/271868 udpVizibleBrowserviziblebrowserlast updated 2018/11/271869 tcpTransActtransactlast updated 2018/11/271869 udpTransActtransactlast updated 2018/11/271870 tcpSunSCALAR DNS Servicesunscalar-dnslast updated 2018/11/271870 udpSunSCALAR DNS Servicesunscalar-dnslast updated 2018/11/271871 tcpCano Central 0canocentral0last updated 2018/11/271871 udpCano Central 0canocentral0last updated 2018/11/271872 tcpCano Central 1canocentral1last updated 2018/11/271872 udpCano Central 1canocentral1last updated 2018/11/271873 tcpFjmpjpsfjmpjpslast updated 2018/11/271873 udpFjmpjpsfjmpjpslast updated 2018/11/271874 tcpFjswapsnpfjswapsnplast updated 2018/11/271874 udpFjswapsnpfjswapsnplast updated 2018/11/271875 tcpwestell statswestell-statslast updated 2018/11/271875 udpwestell statswestell-statslast updated 2018/11/271876 tcpewcappsrvewcappsrvlast updated 2018/11/271876 udpewcappsrvewcappsrvlast updated 2018/11/271877 tcphp-webqosdbhp-webqosdblast updated 2018/11/271877 udphp-webqosdbhp-webqosdblast updated 2018/11/271878 tcpdrmsmcdrmsmclast updated 2018/11/271878 udpdrmsmcdrmsmclast updated 2018/11/271879 tcpNettGain NMSnettgain-nmslast updated 2018/11/271879 udpNettGain NMSnettgain-nmslast updated 2018/11/271880 tcpGilat VSAT Controlvsat-controllast updated 2018/11/271880 udpGilat VSAT Controlvsat-controllast updated 2018/11/271881 tcpIBM WebSphere MQ Everyplaceibm-mqseries2last updated 2018/11/271881 udpIBM WebSphere MQ Everyplaceibm-mqseries2last updated 2018/11/271882 tcpCA eTrust Common Servicesecsqdmnlast updated 2018/11/271882 udpCA eTrust Common Servicesecsqdmnlast updated 2018/11/271883 tcpMessage Queuing Telemetry Transport Protocolmqttlast updated 2018/11/271883 udpMessage Queuing Telemetry Transport Protocolmqttlast updated 2018/11/271884 tcpInternet Distance Map Svcidmapslast updated 2018/11/271884 udpInternet Distance Map Svcidmapslast updated 2018/11/271885 tcpVeritas Trap Servervrtstrapserverlast updated 2018/11/271885 udpVeritas Trap Servervrtstrapserverlast updated 2018/11/271886 tcpLeonardo over IPleoiplast updated 2018/11/271886 udpLeonardo over IPleoiplast updated 2018/11/271887 tcpFileX Listening Portfilex-lportlast updated 2018/11/271887 udpFileX Listening Portfilex-lportlast updated 2018/11/271888 tcpNC Config Portncconfiglast updated 2018/11/271888 udpNC Config Portncconfiglast updated 2018/11/271889 tcpUnify Web Adapter Serviceunify-adapterlast updated 2018/11/271889 udpUnify Web Adapter Serviceunify-adapterlast updated 2018/11/271890 tcpwilkenListenerwilkenlistenerlast updated 2018/11/271890 udpwilkenListenerwilkenlistenerlast updated 2018/11/271891 tcpChildKey Notificationchildkey-notiflast updated 2018/11/271891 udpChildKey Notificationchildkey-notiflast updated 2018/11/271892 tcpChildKey Controlchildkey-ctrllast updated 2018/11/271892 udpChildKey Controlchildkey-ctrllast updated 2018/11/271893 tcpELAD Protocoleladlast updated 2018/11/271893 udpELAD Protocoleladlast updated 2018/11/271894 tcpO2Server Porto2server-portlast updated 2018/11/271894 udpO2Server Porto2server-portlast updated 2018/11/271895 tcpunassignedN/Alast updated 2018/11/271895 udpunassignedN/Alast updated 2018/11/271896 tcpb-novative license serverb-novative-lslast updated 2018/11/271896 udpb-novative license serverb-novative-lslast updated 2018/11/271897 tcpMetaAgentmetaagentlast updated 2018/11/271897 udpMetaAgentmetaagentlast updated 2018/11/271898 tcpCymtec secure managementcymtec-portlast updated 2018/11/271898 udpCymtec secure managementcymtec-portlast updated 2018/11/271899 tcpMC2Studiosmc2studioslast updated 2018/11/271899 udpMC2Studiosmc2studioslast updated 2018/11/271900 tcpSSDPssdplast updated 2018/11/271900 udpSSDPssdplast updated 2018/11/271901 tcpFujitsu ICL Terminal Emulator Program Afjicl-tep-alast updated 2018/11/271901 udpFujitsu ICL Terminal Emulator Program Afjicl-tep-alast updated 2018/11/271902 tcpFujitsu ICL Terminal Emulator Program Bfjicl-tep-blast updated 2018/11/271902 udpFujitsu ICL Terminal Emulator Program Bfjicl-tep-blast updated 2018/11/271903 tcpLocal Link Name Resolutionlinknamelast updated 2018/11/271903 udpLocal Link Name Resolutionlinknamelast updated 2018/11/271904 tcpFujitsu ICL Terminal Emulator Program Cfjicl-tep-clast updated 2018/11/271904 udpFujitsu ICL Terminal Emulator Program Cfjicl-tep-clast updated 2018/11/271905 tcpSecure UP.Link Gateway Protocolsugplast updated 2018/11/271905 udpSecure UP.Link Gateway Protocolsugplast updated 2018/11/271906 tcpTPortMapperReqtpmdlast updated 2018/11/271906 udpTPortMapperReqtpmdlast updated 2018/11/271907 tcpIntraSTARintrastarlast updated 2018/11/271907 udpIntraSTARintrastarlast updated 2018/11/271908 tcpDawndawnlast updated 2018/11/271908 udpDawndawnlast updated 2018/11/271909 tcpGlobal World Linkglobal-wlinklast updated 2018/11/271909 udpGlobal World Linkglobal-wlinklast updated 2018/11/271910 tcpUltraBac Software communications portultrabaclast updated 2018/11/271910 udpUltraBac Software communications portultrabaclast updated 2018/11/271911 tcpStarlight Networks Multimedia Transport Protocolmtplast updated 2018/11/271911 udpStarlight Networks Multimedia Transport Protocolmtplast updated 2018/11/271912 tcprhp-iibprhp-iibplast updated 2018/11/271912 udprhp-iibprhp-iibplast updated 2018/11/271913 tcparmadparmadplast updated 2018/11/271913 udparmadparmadplast updated 2018/11/271914 tcpElm-Momentumelm-momentumlast updated 2018/11/271914 udpElm-Momentumelm-momentumlast updated 2018/11/271915 tcpFACELINKfacelinklast updated 2018/11/271915 udpFACELINKfacelinklast updated 2018/11/271916 tcpPersoft Personapersonalast updated 2018/11/271916 udpPersoft Personapersonalast updated 2018/11/271917 tcpnOAgentnoagentlast updated 2018/11/271917 udpnOAgentnoagentlast updated 2018/11/271918 tcpIBM Tivole Directory Service - NDScan-ndslast updated 2018/11/271918 udpIBM Tivole Directory Service - NDScan-ndslast updated 2018/11/271919 tcpIBM Tivoli Directory Service - DCHcan-dchlast updated 2018/11/271919 udpIBM Tivoli Directory Service - DCHcan-dchlast updated 2018/11/271920 tcpIBM Tivoli Directory Service - FERRETcan-ferretlast updated 2018/11/271920 udpIBM Tivoli Directory Service - FERRETcan-ferretlast updated 2018/11/271921 tcpNoAdminnoadminlast updated 2018/11/271921 udpNoAdminnoadminlast updated 2018/11/271922 tcpTapestrytapestrylast updated 2018/11/271922 udpTapestrytapestrylast updated 2018/11/271923 tcpSPICEspicelast updated 2018/11/271923 udpSPICEspicelast updated 2018/11/271924 tcpXIIPxiiplast updated 2018/11/271924 udpXIIPxiiplast updated 2018/11/271925 tcpSurrogate Discovery Portdiscovery-portlast updated 2018/11/271925 udpSurrogate Discovery Portdiscovery-portlast updated 2018/11/271926 tcpEvolution Game Serveregslast updated 2018/11/271926 udpEvolution Game Serveregslast updated 2018/11/271927 tcpVidete CIPC Portvidete-cipclast updated 2018/11/271927 udpVidete CIPC Portvidete-cipclast updated 2018/11/271928 tcpExpnd Maui Srvr Dscovremsd-portlast updated 2018/11/271928 udpExpnd Maui Srvr Dscovremsd-portlast updated 2018/11/271929 tcpBandwiz System - Serverbandwiz-systemlast updated 2018/11/271929 udpBandwiz System - Serverbandwiz-systemlast updated 2018/11/271930 tcpDrive AppServerdriveappserverlast updated 2018/11/271930 udpDrive AppServerdriveappserverlast updated 2018/11/271931 tcpAMD SCHEDamdschedlast updated 2018/11/271931 udpAMD SCHEDamdschedlast updated 2018/11/271932 tcpCTT Brokerctt-brokerlast updated 2018/11/271932 udpCTT Brokerctt-brokerlast updated 2018/11/271933 tcpIBM LM MT Agentxmapilast updated 2018/11/271933 udpIBM LM MT Agentxmapilast updated 2018/11/271934 tcpIBM LM Appl Agentxaapilast updated 2018/11/271934 udpIBM LM Appl Agentxaapilast updated 2018/11/271935 tcpMacromedia Flash Communications Server MXmacromedia-fcslast updated 2018/11/271935 udpMacromedia Flash Communications server MXmacromedia-fcslast updated 2018/11/271936 tcpJetCmeServer Server Portjetcmeserverlast updated 2018/11/271936 udpJetCmeServer Server Portjetcmeserverlast updated 2018/11/271937 tcpJetVWay Server Portjwserverlast updated 2018/11/271937 udpJetVWay Server Portjwserverlast updated 2018/11/271938 tcpJetVWay Client Portjwclientlast updated 2018/11/271938 udpJetVWay Client Portjwclientlast updated 2018/11/271939 tcpJetVision Server Portjvserverlast updated 2018/11/271939 udpJetVision Server Portjvserverlast updated 2018/11/271940 tcpJetVision Client Portjvclientlast updated 2018/11/271940 udpJetVision Client Portjvclientlast updated 2018/11/271941 tcpDIC-Aidadic-aidalast updated 2018/11/271941 udpDIC-Aidadic-aidalast updated 2018/11/271942 tcpReal Enterprise Servicereslast updated 2018/11/271942 udpReal Enterprise Servicereslast updated 2018/11/271943 tcpBeeyond Mediabeeyond-medialast updated 2018/11/271943 udpBeeyond Mediabeeyond-medialast updated 2018/11/271944 tcpclose-combatclose-combatlast updated 2018/11/271944 udpclose-combatclose-combatlast updated 2018/11/271945 tcpdialogic-elmddialogic-elmdlast updated 2018/11/271945 udpdialogic-elmddialogic-elmdlast updated 2018/11/271946 tcptekplstekplslast updated 2018/11/271946 udptekplstekplslast updated 2018/11/271947 tcpSentinelSRMsentinelsrmlast updated 2018/11/271947 udpSentinelSRMsentinelsrmlast updated 2018/11/271948 tcpeye2eyeeye2eyelast updated 2018/11/271948 udpeye2eyeeye2eyelast updated 2018/11/271949 tcpISMA Easdaq Liveismaeasdaqlivelast updated 2018/11/271949 udpISMA Easdaq Liveismaeasdaqlivelast updated 2018/11/271950 tcpISMA Easdaq Testismaeasdaqtestlast updated 2018/11/271950 udpISMA Easdaq Testismaeasdaqtestlast updated 2018/11/271951 tcpbcs-lmserverbcs-lmserverlast updated 2018/11/271951 udpbcs-lmserverbcs-lmserverlast updated 2018/11/271952 tcpmpnjscmpnjsclast updated 2018/11/271952 udpmpnjscmpnjsclast updated 2018/11/271953 tcpRapid Baserapidbaselast updated 2018/11/271953 udpRapid Baserapidbaselast updated 2018/11/271954 tcpABR-API (diskbridge)abr-apilast updated 2018/11/271954 udpABR-API (diskbridge)abr-apilast updated 2018/11/271955 tcpABR-Secure Data (diskbridge)abr-securelast updated 2018/11/271955 udpABR-Secure Data (diskbridge)abr-securelast updated 2018/11/271956 tcpVertel VMF DSvrtl-vmf-dslast updated 2018/11/271956 udpVertel VMF DSvrtl-vmf-dslast updated 2018/11/271957 tcpunix-statusunix-statuslast updated 2018/11/271957 udpunix-statusunix-statuslast updated 2018/11/271958 tcpCA Administration Daemondxadmindlast updated 2018/11/271958 udpCA Administration Daemondxadmindlast updated 2018/11/271959 tcpSIMP Channelsimp-alllast updated 2018/11/271959 udpSIMP Channelsimp-alllast updated 2018/11/271960 tcpMerit DAC NASmanagernasmanagerlast updated 2018/11/271960 udpMerit DAC NASmanagernasmanagerlast updated 2018/11/271961 tcpBTS APPSERVERbts-appserverlast updated 2018/11/271961 udpBTS APPSERVERbts-appserverlast updated 2018/11/271962 tcpBIAP-MPbiap-mplast updated 2018/11/271962 udpBIAP-MPbiap-mplast updated 2018/11/271963 tcpWebMachinewebmachinelast updated 2018/11/271963 udpWebMachinewebmachinelast updated 2018/11/271964 tcpSOLID E ENGINEsolid-e-enginelast updated 2018/11/271964 udpSOLID E ENGINEsolid-e-enginelast updated 2018/11/271965 tcpTivoli NPMtivoli-npmlast updated 2018/11/271965 udpTivoli NPMtivoli-npmlast updated 2018/11/271966 tcpSlushslushlast updated 2018/11/271966 udpSlushslushlast updated 2018/11/271967 tcpSNS Quotesns-quotelast updated 2018/11/271967 udpSNS Quotesns-quotelast updated 2018/11/271968 tcpLIPSinclipsinclast updated 2018/11/271968 udpLIPSinclipsinclast updated 2018/11/271969 tcpLIPSinc 1lipsinc1last updated 2018/11/271969 udpLIPSinc 1lipsinc1last updated 2018/11/271970 tcpNetOp Remote Controlnetop-rclast updated 2018/11/271970 udpNetOp Remote Controlnetop-rclast updated 2018/11/271971 tcpNetOp Schoolnetop-schoollast updated 2018/11/271971 udpNetOp Schoolnetop-schoollast updated 2018/11/271972 tcpCacheintersys-cachelast updated 2018/11/271972 udpCacheintersys-cachelast updated 2018/11/271973 tcpData Link Switching Remote Access Protocoldlsraplast updated 2018/11/271973 udpData Link Switching Remote Access Protocoldlsraplast updated 2018/11/271974 tcpDRPdrplast updated 2018/11/271974 udpDRPdrplast updated 2018/11/271975 tcpTCO Flash Agenttcoflashagentlast updated 2018/11/271975 udpTCO Flash Agenttcoflashagentlast updated 2018/11/271976 tcpTCO Reg Agenttcoregagentlast updated 2018/11/271976 udpTCO Reg Agenttcoregagentlast updated 2018/11/271977 tcpTCO Address Booktcoaddressbooklast updated 2018/11/271977 udpTCO Address Booktcoaddressbooklast updated 2018/11/271978 tcpUniSQLunisqllast updated 2018/11/271978 udpUniSQLunisqllast updated 2018/11/271979 tcpUniSQL Javaunisql-javalast updated 2018/11/271979 udpUniSQL Javaunisql-javalast updated 2018/11/271980 tcpPearlDoc XACTpearldoc-xactlast updated 2018/11/271980 udpPearlDoc XACTpearldoc-xactlast updated 2018/11/271981 tcpp2pQp2pqlast updated 2018/11/271981 udpp2pQp2pqlast updated 2018/11/271982 tcpEvidentiary Timestampestamplast updated 2018/11/271982 udpEvidentiary Timestampestamplast updated 2018/11/271983 tcpLoophole Test Protocollhtplast updated 2018/11/271983 udpLoophole Test Protocollhtplast updated 2018/11/271984 tcpBBbblast updated 2018/11/271984 udpBBbblast updated 2018/11/271985 tcpHot Standby Router Protocolhsrplast updated 2018/11/271985 udpHot Standby Router Protocolhsrplast updated 2018/11/271986 tcpcisco license managementlicensedaemonlast updated 2018/11/271986 udpcisco license managementlicensedaemonlast updated 2018/11/271987 tcpcisco RSRB Priority 1 porttr-rsrb-p1last updated 2018/11/271987 udpcisco RSRB Priority 1 porttr-rsrb-p1last updated 2018/11/271988 tcpcisco RSRB Priority 2 porttr-rsrb-p2last updated 2018/11/271988 udpcisco RSRB Priority 2 porttr-rsrb-p2last updated 2018/11/271989 tcpcisco RSRB Priority 3 porttr-rsrb-p3last updated 2018/11/271989 udpcisco RSRB Priority 3 porttr-rsrb-p3last updated 2018/11/271989 tcp (mshnet)MHSnet systemmshnetlast updated 2018/11/271989 udp (mshnet)MHSnet systemmshnetlast updated 2018/11/271990 tcpcisco STUN Priority 1 portstun-p1last updated 2018/11/271990 udpcisco STUN Priority 1 portstun-p1last updated 2018/11/271991 tcpcisco STUN Priority 2 portstun-p2last updated 2018/11/271991 udpcisco STUN Priority 2 portstun-p2last updated 2018/11/271992 tcpcisco STUN Priority 3 portstun-p3last updated 2018/11/271992 udpcisco STUN Priority 3 portstun-p3last updated 2018/11/271992 tcp (ipsendmsg)IPsendmsgipsendmsglast updated 2018/11/271992 udp (ipsendmsg)IPsendmsgipsendmsglast updated 2018/11/271993 tcpcisco SNMP TCP portsnmp-tcp-portlast updated 2018/11/271993 udpcisco SNMP TCP portsnmp-tcp-portlast updated 2018/11/271994 tcpcisco serial tunnel portstun-portlast updated 2018/11/271994 udpcisco serial tunnel portstun-portlast updated 2018/11/271995 tcpcisco perf portperf-portlast updated 2018/11/271995 udpcisco perf portperf-portlast updated 2018/11/271996 tcpcisco Remote SRB porttr-rsrb-portlast updated 2018/11/271996 udpcisco Remote SRB porttr-rsrb-portlast updated 2018/11/271997 tcpcisco Gateway Discovery Protocolgdp-portlast updated 2018/11/271997 udpcisco Gateway Discovery Protocolgdp-portlast updated 2018/11/271998 tcpcisco X.25 service (XOT)x25-svc-portlast updated 2018/11/271998 udpcisco X.25 service (XOT)x25-svc-portlast updated 2018/11/271999 tcpcisco identification porttcp-id-portlast updated 2018/11/271999 udpcisco identification porttcp-id-portlast updated 2018/11/272000 tcpCisco SCCPcisco-sccplast updated 2018/11/272000 udpCisco SCCpcisco-sccplast updated 2018/11/272001 tcpdclast updated 2018/11/272001 udpcurrywizardlast updated 2018/11/272002 tcpglobelast updated 2018/11/272002 udpglobelast updated 2018/11/272003 tcpBrutus Serverbrutuslast updated 2018/11/272003 udpBrutus Serverbrutuslast updated 2018/11/272004 tcpmailboxlast updated 2018/11/272004 udpCCWS mm confemcelast updated 2018/11/272005 tcpberknetlast updated 2018/11/272005 udporaclelast updated 2018/11/272006 tcpinvokatorlast updated 2018/11/272006 udpraidraid-cdlast updated 2018/11/272007 tcpdectalklast updated 2018/11/272007 udpraid-amlast updated 2018/11/272008 tcpconflast updated 2018/11/272008 udpterminaldblast updated 2018/11/272009 tcpnewslast updated 2018/11/272009 udpwhosockamilast updated 2018/11/272010 tcpsearchlast updated 2018/11/272010 udpIANA assigned this well-formed service name as a replacement for "pipe_server".pipe-serverlast updated 2018/11/272010 udp (pipe_server)pipe_serverlast updated 2018/11/272011 tcpraidraid-cclast updated 2018/11/272011 udpservservlast updated 2018/11/272012 tcpttyinfolast updated 2018/11/272012 udpraid-aclast updated 2018/11/272013 tcpraid-amlast updated 2018/11/272013 udpraid-cdlast updated 2018/11/272014 tcptrofflast updated 2018/11/272014 udpraid-sflast updated 2018/11/272015 tcpcypresslast updated 2018/11/272015 udpraid-cslast updated 2018/11/272016 tcpbootserverlast updated 2018/11/272016 udpbootserverlast updated 2018/11/272017 tcpcypress-statlast updated 2018/11/272017 udpbootclientlast updated 2018/11/272018 tcpterminaldblast updated 2018/11/272018 udprellpacklast updated 2018/11/272019 tcpwhosockamilast updated 2018/11/272019 udpaboutlast updated 2018/11/272020 tcpxinupageserverlast updated 2018/11/272020 udpxinupageserverlast updated 2018/11/272021 tcpservexeclast updated 2018/11/272021 udpxinuexpansion1last updated 2018/11/272022 tcpdownlast updated 2018/11/272022 udpxinuexpansion2last updated 2018/11/272023 tcpxinuexpansion3last updated 2018/11/272023 udpxinuexpansion3last updated 2018/11/272024 tcpxinuexpansion4last updated 2018/11/272024 udpxinuexpansion4last updated 2018/11/272025 tcpellpacklast updated 2018/11/272025 udpxribslast updated 2018/11/272026 tcpscrabblelast updated 2018/11/272026 udpscrabblelast updated 2018/11/272027 tcpshadowserverlast updated 2018/11/272027 udpshadowserverlast updated 2018/11/272028 tcpsubmitserverlast updated 2018/11/272028 udpsubmitserverlast updated 2018/11/272029 tcpHot Standby Router Protocol IPv6hsrpv6last updated 2018/11/272029 udpHot Standby Router Protocol IPv6hsrpv6last updated 2018/11/272030 tcpdevice2last updated 2018/11/272030 udpdevice2last updated 2018/11/272031 tcpmobrien-chatmobrien-chatlast updated 2018/11/272031 udpmobrien-chatmobrien-chatlast updated 2018/11/272032 tcpblackboardlast updated 2018/11/272032 udpblackboardlast updated 2018/11/272033 tcpgloggerlast updated 2018/11/272033 udpgloggerlast updated 2018/11/272034 tcpscoremgrlast updated 2018/11/272034 udpscoremgrlast updated 2018/11/272035 tcpimsldoclast updated 2018/11/272035 udpimsldoclast updated 2018/11/272036 tcpEthernet WS DP networke-dpnetlast updated 2018/11/272036 udpEthernet WS DP networke-dpnetlast updated 2018/11/272037 tcpAPplus Application Serverappluslast updated 2018/11/272037 udpAPplus Application Serverappluslast updated 2018/11/272038 tcpobjectmanagerlast updated 2018/11/272038 udpobjectmanagerlast updated 2018/11/272039 tcpPrizma Monitoring Serviceprizmalast updated 2018/11/272039 udpPrizma Monitoring Serviceprizmalast updated 2018/11/272040 tcplamlast updated 2018/11/272040 udplamlast updated 2018/11/272041 tcpinterbaselast updated 2018/11/272041 udpinterbaselast updated 2018/11/272042 tcpisisisislast updated 2018/11/272042 udpisisisislast updated 2018/11/272043 tcpisis-bcastisis-bcastlast updated 2018/11/272043 udpisis-bcastisis-bcastlast updated 2018/11/272044 tcprimsllast updated 2018/11/272044 udprimsllast updated 2018/11/272045 tcpcdfunclast updated 2018/11/272045 udpcdfunclast updated 2018/11/272046 tcpsdfunclast updated 2018/11/272046 udpsdfunclast updated 2018/11/272047 tcpdlslast updated 2018/11/272047 udpdlslast updated 2018/11/272048 tcpdls-monitorlast updated 2018/11/272048 udpdls-monitorlast updated 2018/11/272049 tcp (shilp)shilplast updated 2018/11/272049 udp (shilp)shilplast updated 2018/11/272049 tcpNetwork File System - Sun Microsystemsnfslast updated 2018/11/272049 udpNetwork File System - Sun Microsystemsnfslast updated 2018/11/272049 sctpNetwork File Systemnfslast updated 2018/11/272050 tcpAvaya EMB Config Portav-emb-configlast updated 2018/11/272050 udpAvaya EMB Config Portav-emb-configlast updated 2018/11/272051 tcpEPNSDPepnsdplast updated 2018/11/272051 udpEPNSDPepnsdplast updated 2018/11/272052 tcpclearVisn Services Portclearvisnlast updated 2018/11/272052 udpclearVisn Services Portclearvisnlast updated 2018/11/272053 tcpLot105 DSuper Updateslot105-ds-updlast updated 2018/11/272053 udpLot105 DSuper Updateslot105-ds-updlast updated 2018/11/272054 tcpWeblogin Portwebloginlast updated 2018/11/272054 udpWeblogin Portwebloginlast updated 2018/11/272055 tcpIliad-Odyssey Protocolioplast updated 2018/11/272055 udpIliad-Odyssey Protocolioplast updated 2018/11/272056 tcpOmniSky Portomniskylast updated 2018/11/272056 udpOmniSky Portomniskylast updated 2018/11/272057 tcpRich Content Protocolrich-cplast updated 2018/11/272057 udpRich Content Protocolrich-cplast updated 2018/11/272058 tcpNewWaveSearchables RMInewwavesearchlast updated 2018/11/272058 udpNewWaveSearchables RMInewwavesearchlast updated 2018/11/272059 tcpBMC Messaging Servicebmc-messaginglast updated 2018/11/272059 udpBMC Messaging Servicebmc-messaginglast updated 2018/11/272060 tcpTelenium Daemon IFteleniumdaemonlast updated 2018/11/272060 udpTelenium Daemon IFteleniumdaemonlast updated 2018/11/272061 tcpNetMountnetmountlast updated 2018/11/272061 udpNetMountnetmountlast updated 2018/11/272062 tcpICG SWP Porticg-swplast updated 2018/11/272062 udpICG SWP Porticg-swplast updated 2018/11/272063 tcpICG Bridge Porticg-bridgelast updated 2018/11/272063 udpICG Bridge Porticg-bridgelast updated 2018/11/272064 tcpICG IP Relay Porticg-iprelaylast updated 2018/11/272064 udpICG IP Relay Porticg-iprelaylast updated 2018/11/272065 tcpData Link Switch Read Port Numberdlsrpnlast updated 2018/11/272065 udpData Link Switch Read Port Numberdlsrpnlast updated 2018/11/272066 tcpAVM USB Remote Architectureauralast updated 2018/11/272066 udpAVM USB Remote Architectureauralast updated 2018/11/272067 tcpData Link Switch Write Port Numberdlswpnlast updated 2018/11/272067 udpData Link Switch Write Port Numberdlswpnlast updated 2018/11/272068 tcpAvocent AuthSrv Protocolavauthsrvprtcllast updated 2018/11/272068 udpAvocent AuthSrv Protocolavauthsrvprtcllast updated 2018/11/272069 tcpHTTP Event Portevent-portlast updated 2018/11/272069 udpHTTP Event Portevent-portlast updated 2018/11/272070 tcpAH and ESP Encapsulated in UDP packetah-esp-encaplast updated 2018/11/272070 udpAH and ESP Encapsulated in UDP packetah-esp-encaplast updated 2018/11/272071 tcpAxon Control Protocolacp-portlast updated 2018/11/272071 udpAxon Control Protocolacp-portlast updated 2018/11/272072 tcpGlobeCast mSyncmsynclast updated 2018/11/272072 udpGlobeCast mSyncmsynclast updated 2018/11/272073 tcpDataReel Database Socketgxs-data-portlast updated 2018/11/272073 udpDataReel Database Socketgxs-data-portlast updated 2018/11/272074 tcpVertel VMF SAvrtl-vmf-salast updated 2018/11/272074 udpVertel VMF SAvrtl-vmf-salast updated 2018/11/272075 tcpNewlix ServerWare Enginenewlixenginelast updated 2018/11/272075 udpNewlix ServerWare Enginenewlixenginelast updated 2018/11/272076 tcpNewlix JSPConfignewlixconfiglast updated 2018/11/272076 udpNewlix JSPConfignewlixconfiglast updated 2018/11/272077 tcpOld Tivoli Storage Managertsrmagtlast updated 2018/11/272077 udpOld Tivoli Storage Managertsrmagtlast updated 2018/11/272078 tcpIBM Total Productivity Center Servertpcsrvrlast updated 2018/11/272078 udpIBM Total Productivity Center Servertpcsrvrlast updated 2018/11/272079 tcpIDWARE Router Portidware-routerlast updated 2018/11/272079 udpIDWARE Router Portidware-routerlast updated 2018/11/272080 tcpAutodesk NLM (FLEXlm)autodesk-nlmlast updated 2018/11/272080 udpAutodesk NLM (FLEXlm)autodesk-nlmlast updated 2018/11/272081 tcpKME PRINTER TRAP PORTkme-trap-portlast updated 2018/11/272081 udpKME PRINTER TRAP PORTkme-trap-portlast updated 2018/11/272082 tcpInfowave Mobility Serverinfowavelast updated 2018/11/272082 udpInfowave Mobility Serverinfowavelast updated 2018/11/272083 tcpSecure Radius Serviceradseclast updated 2018/11/272083 udpSecure Radius Serviceradseclast updated 2018/11/272084 tcpSunCluster Geographicsunclustergeolast updated 2018/11/272084 udpSunCluster Geographicsunclustergeolast updated 2018/11/272085 tcpADA Controlada-ciplast updated 2018/11/272085 udpADA Controlada-ciplast updated 2018/11/272086 tcpGNUnetgnunetlast updated 2018/11/272086 udpGNUnetgnunetlast updated 2018/11/272087 tcpELI - Event Logging Integrationelilast updated 2018/11/272087 udpELI - Event Logging Integrationelilast updated 2018/11/272088 tcpIP Busy Lamp Fieldip-blflast updated 2018/11/272088 udpIP Busy Lamp Fieldip-blflast updated 2018/11/272089 tcpSecurity Encapsulation Protocol - SEPseplast updated 2018/11/272089 udpSecurity Encapsulation Protocol - SEPseplast updated 2018/11/272090 tcpLoad Report Protocollrplast updated 2018/11/272090 udpLoad Report Protocollrplast updated 2018/11/272091 tcpPRPprplast updated 2018/11/272091 udpPRPprplast updated 2018/11/272092 tcpDescent 3descent3last updated 2018/11/272092 udpDescent 3descent3last updated 2018/11/272093 tcpNBX CCnbx-cclast updated 2018/11/272093 udpNBX CCnbx-cclast updated 2018/11/272094 tcpNBX AUnbx-aulast updated 2018/11/272094 udpNBX AUnbx-aulast updated 2018/11/272095 tcpNBX SERnbx-serlast updated 2018/11/272095 udpNBX SERnbx-serlast updated 2018/11/272096 tcpNBX DIRnbx-dirlast updated 2018/11/272096 udpNBX DIRnbx-dirlast updated 2018/11/272097 tcpJet Form Previewjetformpreviewlast updated 2018/11/272097 udpJet Form Previewjetformpreviewlast updated 2018/11/272098 tcpDialog Portdialog-portlast updated 2018/11/272098 udpDialog Portdialog-portlast updated 2018/11/272099 tcpH.225.0 Annex G Signallingh2250-annex-glast updated 2018/11/272099 udpH.225.0 Annex G Signallingh2250-annex-glast updated 2018/11/272100 tcpAmiga Network Filesystemamiganetfslast updated 2018/11/272100 udpAmiga Network Filesystemamiganetfslast updated 2018/11/272101 tcprtcm-sc104rtcm-sc104last updated 2018/11/272101 udprtcm-sc104rtcm-sc104last updated 2018/11/272102 tcpZephyr serverzephyr-srvlast updated 2018/11/272102 udpZephyr serverzephyr-srvlast updated 2018/11/272103 tcpZephyr serv-hm connectionzephyr-cltlast updated 2018/11/272103 udpZephyr serv-hm connectionzephyr-cltlast updated 2018/11/272104 tcpZephyr hostmanagerzephyr-hmlast updated 2018/11/272104 udpZephyr hostmanagerzephyr-hmlast updated 2018/11/272105 tcpMiniPayminipaylast updated 2018/11/272105 udpMiniPayminipaylast updated 2018/11/272106 tcpMZAPmzaplast updated 2018/11/272106 udpMZAPmzaplast updated 2018/11/272107 tcpBinTec Adminbintec-adminlast updated 2018/11/272107 udpBinTec Adminbintec-adminlast updated 2018/11/272108 tcpComcamcomcamlast updated 2018/11/272108 udpComcamcomcamlast updated 2018/11/272109 tcpErgolightergolightlast updated 2018/11/272109 udpErgolightergolightlast updated 2018/11/272110 tcpUMSPumsplast updated 2018/11/272110 udpUMSPumsplast updated 2018/11/272111 tcpOPNET Dynamic Sampling Agent Transaction Protocoldsatplast updated 2018/11/272111 udpOPNET Dynamic Sampling Agent Transaction Protocoldsatplast updated 2018/11/272112 tcpIdonix MetaNetidonix-metanetlast updated 2018/11/272112 udpIdonix MetaNetidonix-metanetlast updated 2018/11/272113 tcpHSL StoRMhsl-stormlast updated 2018/11/272113 udpHSL StoRMhsl-stormlast updated 2018/11/272114 tcpClassical Music Meta-Data Access and Enhancementariascribelast updated 2018/11/272114 udpClassical Music Meta-Data Access and Enhancementariascribelast updated 2018/11/272115 tcpKey Distribution Managerkdmlast updated 2018/11/272115 udpKey Distribution Managerkdmlast updated 2018/11/272116 tcpCCOWCMRccowcmrlast updated 2018/11/272116 udpCCOWCMRccowcmrlast updated 2018/11/272117 tcpMENTACLIENTmentaclientlast updated 2018/11/272117 udpMENTACLIENTmentaclientlast updated 2018/11/272118 tcpMENTASERVERmentaserverlast updated 2018/11/272118 udpMENTASERVERmentaserverlast updated 2018/11/272119 tcpGSIGATEKEEPERgsigatekeeperlast updated 2018/11/272119 udpGSIGATEKEEPERgsigatekeeperlast updated 2018/11/272120 tcpQuick Eagle Networks CPqencplast updated 2018/11/272120 udpQuick Eagle Networks CPqencplast updated 2018/11/272121 tcpSCIENTIA-SSDBscientia-ssdblast updated 2018/11/272121 udpSCIENTIA-SSDBscientia-ssdblast updated 2018/11/272122 tcpCauPC Remote Controlcaupc-remotelast updated 2018/11/272122 udpCauPC Remote Controlcaupc-remotelast updated 2018/11/272123 tcpGTP-Control Plane (3GPP)gtp-controllast updated 2018/11/272123 udpGTP-Control Plane (3GPP)gtp-controllast updated 2018/11/272124 tcpELATELINKelatelinklast updated 2018/11/272124 udpELATELINKelatelinklast updated 2018/11/272125 tcpLOCKSTEPlocksteplast updated 2018/11/272125 udpLOCKSTEPlocksteplast updated 2018/11/272126 tcpPktCable-COPSpktcable-copslast updated 2018/11/272126 udpPktCable-COPSpktcable-copslast updated 2018/11/272127 tcpINDEX-PC-WBindex-pc-wblast updated 2018/11/272127 udpINDEX-PC-WBindex-pc-wblast updated 2018/11/272128 tcpNet Steward Controlnet-stewardlast updated 2018/11/272128 udpNet Steward Controlnet-stewardlast updated 2018/11/272129 tcpcs-live.comcs-livelast updated 2018/11/272129 udpcs-live.comcs-livelast updated 2018/11/272130 tcpXDSxdslast updated 2018/11/272130 udpXDSxdslast updated 2018/11/272131 tcpAvantageb2bavantageb2blast updated 2018/11/272131 udpAvantageb2bavantageb2blast updated 2018/11/272132 tcpSoleraTec End Point Mapsolera-epmaplast updated 2018/11/272132 udpSoleraTec End Point Mapsolera-epmaplast updated 2018/11/272133 tcpZYMED-ZPPzymed-zpplast updated 2018/11/272133 udpZYMED-ZPPzymed-zpplast updated 2018/11/272134 tcpAVENUEavenuelast updated 2018/11/272134 udpAVENUEavenuelast updated 2018/11/272135 tcpGrid Resource Information Servergrislast updated 2018/11/272135 udpGrid Resource Information Servergrislast updated 2018/11/272136 tcpAPPWORXSRVappworxsrvlast updated 2018/11/272136 udpAPPWORXSRVappworxsrvlast updated 2018/11/272137 tcpCONNECTconnectlast updated 2018/11/272137 udpCONNECTconnectlast updated 2018/11/272138 tcpUNBIND-CLUSTERunbind-clusterlast updated 2018/11/272138 udpUNBIND-CLUSTERunbind-clusterlast updated 2018/11/272139 tcpIAS-AUTHias-authlast updated 2018/11/272139 udpIAS-AUTHias-authlast updated 2018/11/272140 tcpIAS-REGias-reglast updated 2018/11/272140 udpIAS-REGias-reglast updated 2018/11/272141 tcpIAS-ADMINDias-admindlast updated 2018/11/272141 udpIAS-ADMINDias-admindlast updated 2018/11/272142 tcpTDM OVER IPtdmoiplast updated 2018/11/272142 udpTDM OVER IPtdmoiplast updated 2018/11/272143 tcpLive Vault Job Controllv-jclast updated 2018/11/272143 udpLive Vault Job Controllv-jclast updated 2018/11/272144 tcpLive Vault Fast Object Transferlv-ffxlast updated 2018/11/272144 udpLive Vault Fast Object Transferlv-ffxlast updated 2018/11/272145 tcpLive Vault Remote Diagnostic Console Supportlv-picilast updated 2018/11/272145 udpLive Vault Remote Diagnostic Console Supportlv-picilast updated 2018/11/272146 tcpLive Vault Admin Event Notificationlv-notlast updated 2018/11/272146 udpLive Vault Admin Event Notificationlv-notlast updated 2018/11/272147 tcpLive Vault Authenticationlv-authlast updated 2018/11/272147 udpLive Vault Authenticationlv-authlast updated 2018/11/272148 tcpVERITAS UNIVERSAL COMMUNICATION LAYERveritas-ucllast updated 2018/11/272148 udpVERITAS UNIVERSAL COMMUNICATION LAYERveritas-ucllast updated 2018/11/272149 tcpACPTSYSacptsyslast updated 2018/11/272149 udpACPTSYSacptsyslast updated 2018/11/272150 tcpDYNAMIC3Ddynamic3dlast updated 2018/11/272150 udpDYNAMIC3Ddynamic3dlast updated 2018/11/272151 tcpDOCENTdocentlast updated 2018/11/272151 udpDOCENTdocentlast updated 2018/11/272152 tcpGTP-User Plane (3GPP)gtp-userlast updated 2018/11/272152 udpGTP-User Plane (3GPP)gtp-userlast updated 2018/11/272153 tcpControl Protocolctlptclast updated 2018/11/272153 udpControl Protocolctlptclast updated 2018/11/272154 tcpStandard Protocolstdptclast updated 2018/11/272154 udpStandard Protocolstdptclast updated 2018/11/272155 tcpBridge Protocolbrdptclast updated 2018/11/272155 udpBridge Protocolbrdptclast updated 2018/11/272156 tcpTalari Reliable Protocoltrplast updated 2018/11/272156 udpTalari Reliable Protocoltrplast updated 2018/11/272157 tcpXerox Network Document Scan Protocolxndslast updated 2018/11/272157 udpXerox Network Document Scan Protocolxndslast updated 2018/11/272158 tcpTouchNetPlus Servicetouchnetpluslast updated 2018/11/272158 udpTouchNetPlus Servicetouchnetpluslast updated 2018/11/272159 tcpGDB Remote Debug Portgdbremotelast updated 2018/11/272159 udpGDB Remote Debug Portgdbremotelast updated 2018/11/272160 tcpAPC 2160apc-2160last updated 2018/11/272160 udpAPC 2160apc-2160last updated 2018/11/272161 tcpAPC 2161apc-2161last updated 2018/11/272161 udpAPC 2161apc-2161last updated 2018/11/272162 tcpNavispherenavispherelast updated 2018/11/272162 udpNavispherenavispherelast updated 2018/11/272163 tcpNavisphere Securenavisphere-seclast updated 2018/11/272163 udpNavisphere Securenavisphere-seclast updated 2018/11/272164 tcpDynamic DNS Version 3ddns-v3last updated 2018/11/272164 udpDynamic DNS Version 3ddns-v3last updated 2018/11/272165 tcpX-Bone APIx-bone-apilast updated 2018/11/272165 udpX-Bone APIx-bone-apilast updated 2018/11/272166 tcpiwserveriwserverlast updated 2018/11/272166 udpiwserveriwserverlast updated 2018/11/272167 tcpRaw Async Serial Linkraw-seriallast updated 2018/11/272167 udpRaw Async Serial Linkraw-seriallast updated 2018/11/272168 tcpeasy-soft Multiplexereasy-soft-muxlast updated 2018/11/272168 udpeasy-soft Multiplexereasy-soft-muxlast updated 2018/11/272169 tcpBackbone for Academic Information Notification (BRAIN)brainlast updated 2018/11/272169 udpBackbone for Academic Information Notification (BRAIN)brainlast updated 2018/11/272170 tcpEyeTV Server Porteyetvlast updated 2018/11/272170 udpEyeTV Server Porteyetvlast updated 2018/11/272171 tcpMS Firewall Storagemsfw-storagelast updated 2018/11/272171 udpMS Firewall Storagemsfw-storagelast updated 2018/11/272172 tcpMS Firewall SecureStoragemsfw-s-storagelast updated 2018/11/272172 udpMS Firewall SecureStoragemsfw-s-storagelast updated 2018/11/272173 tcpMS Firewall Replicationmsfw-replicalast updated 2018/11/272173 udpMS Firewall Replicationmsfw-replicalast updated 2018/11/272174 tcpMS Firewall Intra Arraymsfw-arraylast updated 2018/11/272174 udpMS Firewall Intra Arraymsfw-arraylast updated 2018/11/272175 tcpMicrosoft Desktop AirSync Protocolairsynclast updated 2018/11/272175 udpMicrosoft Desktop AirSync Protocolairsynclast updated 2018/11/272176 tcpMicrosoft ActiveSync Remote APIrapilast updated 2018/11/272176 udpMicrosoft ActiveSync Remote APIrapilast updated 2018/11/272177 tcpqWAVE Bandwidth Estimateqwavelast updated 2018/11/272177 udpqWAVE Bandwidth Estimateqwavelast updated 2018/11/272178 tcpPeer Services for BITSbitspeerlast updated 2018/11/272178 udpPeer Services for BITSbitspeerlast updated 2018/11/272179 tcpMicrosoft RDP for virtual machinesvmrdplast updated 2018/11/272179 udpMicrosoft RDP for virtual machinesvmrdplast updated 2018/11/272180 tcpMillicent Vendor Gateway Servermc-gt-srvlast updated 2018/11/272180 udpMillicent Vendor Gateway Servermc-gt-srvlast updated 2018/11/272181 tcpeforwardeforwardlast updated 2018/11/272181 udpeforwardeforwardlast updated 2018/11/272182 tcpCGN statuscgn-statlast updated 2018/11/272182 udpCGN statuscgn-statlast updated 2018/11/272183 tcpCode Green configurationcgn-configlast updated 2018/11/272183 udpCode Green configurationcgn-configlast updated 2018/11/272184 tcpNVD Usernvdlast updated 2018/11/272184 udpNVD Usernvdlast updated 2018/11/272185 tcpOnBase Distributed Disk Servicesonbase-ddslast updated 2018/11/272185 udpOnBase Distributed Disk Servicesonbase-ddslast updated 2018/11/272186 tcpGuy-Tek Automated Update Applicationsgtaualast updated 2018/11/272186 udpGuy-Tek Automated Update Applicationsgtaualast updated 2018/11/272187 tcpSepehr System Management Controlssmclast updated 2018/11/272187 udpSepehr System Management Datassmdlast updated 2018/11/272188 tcpRadware Resource Pool Managerradware-rpmlast updated 2018/11/272188 udpReservedN/Alast updated 2018/11/272189 tcpSecure Radware Resource Pool Managerradware-rpm-slast updated 2018/11/272189 udpReservedN/Alast updated 2018/11/272190 tcpTiVoConnect Beacontivoconnectlast updated 2018/11/272190 udpTiVoConnect Beacontivoconnectlast updated 2018/11/272191 tcpTvBus Messagingtvbuslast updated 2018/11/272191 udpTvBus Messagingtvbuslast updated 2018/11/272192 tcpASDIS software managementasdislast updated 2018/11/272192 udpASDIS software managementasdislast updated 2018/11/272193 tcpDr.Web Enterprise Management Servicedrwcslast updated 2018/11/272193 udpDr.Web Enterprise Management Servicedrwcslast updated 2018/11/272194-2196 UnassignedN/Alast updated 2018/11/272197 tcpMNP data exchangemnp-exchangelast updated 2018/11/272197 udpMNP data exchangemnp-exchangelast updated 2018/11/272198 tcpOneHome Remote Accessonehome-remotelast updated 2018/11/272198 udpOneHome Remote Accessonehome-remotelast updated 2018/11/272199 tcpOneHome Service Portonehome-helplast updated 2018/11/272199 udpOneHome Service Portonehome-helplast updated 2018/11/272200 tcpICIicilast updated 2018/11/272200 udpICIicilast updated 2018/11/272201 tcpAdvanced Training System Programatslast updated 2018/11/272201 udpAdvanced Training System Programatslast updated 2018/11/272202 tcpInt. Multimedia Teleconferencing Cosortiumimtc-maplast updated 2018/11/272202 udpInt. Multimedia Teleconferencing Cosortiumimtc-maplast updated 2018/11/272203 tcpb2 Runtime Protocolb2-runtimelast updated 2018/11/272203 udpb2 Runtime Protocolb2-runtimelast updated 2018/11/272204 tcpb2 License Serverb2-licenselast updated 2018/11/272204 udpb2 License Serverb2-licenselast updated 2018/11/272205 tcpJava Presentation Serverjpslast updated 2018/11/272205 udpJava Presentation Serverjpslast updated 2018/11/272206 tcpHP OpenCall bushpocbuslast updated 2018/11/272206 udpHP OpenCall bushpocbuslast updated 2018/11/272207 tcpHP Status and Serviceshpssdlast updated 2018/11/272207 udpHP Status and Serviceshpssdlast updated 2018/11/272208 tcpHP I/O Backendhpiodlast updated 2018/11/272208 udpHP I/O Backendhpiodlast updated 2018/11/272209 tcpHP RIM for Files Portal Servicerimf-pslast updated 2018/11/272209 udpHP RIM for Files Portal Servicerimf-pslast updated 2018/11/272210 tcpNOAAPORT Broadcast Networknoaaportlast updated 2018/11/272210 udpNOAAPORT Broadcast Networknoaaportlast updated 2018/11/272211 tcpEMWINemwinlast updated 2018/11/272211 udpEMWINemwinlast updated 2018/11/272212 tcpLeeCO POS Server Serviceleecoposserverlast updated 2018/11/272212 udpLeeCO POS Server Serviceleecoposserverlast updated 2018/11/272213 tcpKalikalilast updated 2018/11/272213 udpKalikalilast updated 2018/11/272214 tcpRDQ Protocol Interfacerpilast updated 2018/11/272214 udpRDQ Protocol Interfacerpilast updated 2018/11/272215 GPRSipcorelast updated 2018/11/272215 GPRSipcorelast updated 2018/11/272216 tcpVTU data servicevtu-commslast updated 2018/11/272216 udpVTU data servicevtu-commslast updated 2018/11/272217 tcpGoToDevice Device Managementgotodevicelast updated 2018/11/272217 udpGoToDevice Device Managementgotodevicelast updated 2018/11/272218 tcpBounzza IRC Proxybounzzalast updated 2018/11/272218 udpBounzza IRC Proxybounzzalast updated 2018/11/272219 tcpNetIQ NCAP Protocolnetiq-ncaplast updated 2018/11/272219 udpNetIQ NCAP Protocolnetiq-ncaplast updated 2018/11/272220 tcpNetIQ End2Endnetiqlast updated 2018/11/272220 udpNetIQ End2Endnetiqlast updated 2018/11/272221 tcpEtherNet/IP over TLSethernet-ip-slast updated 2018/11/272221 udpEtherNet/IP over DTLSethernet-ip-slast updated 2018/11/272222 tcpEtherNet/IP I/O IANA assigned this well-formed service name as a replacement for "EtherNet/IP-1".EtherNet-IP-1last updated 2018/11/272222 tcp (EtherNet/IP-1)EtherNet/IP I/OEtherNet/IP-1last updated 2018/11/272222 udpEtherNet/IP I/O IANA assigned this well-formed service name as a replacement for "EtherNet/IP-1".EtherNet-IP-1last updated 2018/11/272222 udp (EtherNet/IP-1)EtherNet/IP I/OEtherNet/IP-1last updated 2018/11/272223 tcpRockwell CSP2rockwell-csp2last updated 2018/11/272223 udpRockwell CSP2rockwell-csp2last updated 2018/11/272224 tcpEasy Flexible Internet/Multiplayer Gamesefi-mglast updated 2018/11/272224 udpEasy Flexible Internet/Multiplayer Gamesefi-mglast updated 2018/11/272225 tcpResource Connection Initiation Protocolrcip-itulast updated 2018/11/272225 udpReservedN/Alast updated 2018/11/272225 sctpResource Connection Initiation Protocolrcip-itulast updated 2018/11/272226 tcpDigital Instinct DRMdi-drmlast updated 2018/11/272226 udpDigital Instinct DRMdi-drmlast updated 2018/11/272227 tcpDI Messaging Servicedi-msglast updated 2018/11/272227 udpDI Messaging Servicedi-msglast updated 2018/11/272228 tcpeHome Message Serverehome-mslast updated 2018/11/272228 udpeHome Message Serverehome-mslast updated 2018/11/272229 tcpDataLens Servicedatalenslast updated 2018/11/272229 udpDataLens Servicedatalenslast updated 2018/11/272230 tcpMetaSoft Job Queue Administration Servicequeueadmlast updated 2018/11/272230 udpMetaSoft Job Queue Administration Servicequeueadmlast updated 2018/11/272231 tcpWiMAX ASN Control Plane Protocolwimaxasncplast updated 2018/11/272231 udpWiMAX ASN Control Plane Protocolwimaxasncplast updated 2018/11/272232 tcpIVS Video defaultivs-videolast updated 2018/11/272232 udpIVS Video defaultivs-videolast updated 2018/11/272233 tcpINFOCRYPTinfocryptlast updated 2018/11/272233 udpINFOCRYPTinfocryptlast updated 2018/11/272234 tcpDirectPlaydirectplaylast updated 2018/11/272234 udpDirectPlaydirectplaylast updated 2018/11/272235 tcpSercomm-WLinksercomm-wlinklast updated 2018/11/272235 udpSercomm-WLinksercomm-wlinklast updated 2018/11/272236 tcpNaninanilast updated 2018/11/272236 udpNaninanilast updated 2018/11/272237 tcpOptech Port1 License Manageroptech-port1-lmlast updated 2018/11/272237 udpOptech Port1 License Manageroptech-port1-lmlast updated 2018/11/272238 tcpAVIVA SNA SERVERaviva-snalast updated 2018/11/272238 udpAVIVA SNA SERVERaviva-snalast updated 2018/11/272239 tcpImage Queryimagequerylast updated 2018/11/272239 udpImage Queryimagequerylast updated 2018/11/272240 tcpRECIPerecipelast updated 2018/11/272240 udpRECIPerecipelast updated 2018/11/272241 tcpIVS Daemonivsdlast updated 2018/11/272241 udpIVS Daemonivsdlast updated 2018/11/272242 tcpFolio Remote Serverfoliocorplast updated 2018/11/272242 udpFolio Remote Serverfoliocorplast updated 2018/11/272243 tcpMagicom Protocolmagicomlast updated 2018/11/272243 udpMagicom Protocolmagicomlast updated 2018/11/272244 tcpNMS Servernmsserverlast updated 2018/11/272244 udpNMS Servernmsserverlast updated 2018/11/272245 tcpHaOhaolast updated 2018/11/272245 udpHaOhaolast updated 2018/11/272246 tcpPacketCable MTA Addr Mappc-mta-addrmaplast updated 2018/11/272246 udpPacketCable MTA Addr Mappc-mta-addrmaplast updated 2018/11/272247 tcpAntidote Deployment Manager Serviceantidotemgrsvrlast updated 2018/11/272247 udpAntidote Deployment Manager Serviceantidotemgrsvrlast updated 2018/11/272248 tcpUser Management Serviceumslast updated 2018/11/272248 udpUser Management Serviceumslast updated 2018/11/272249 tcpRISO File Manager Protocolrfmplast updated 2018/11/272249 udpRISO File Manager Protocolrfmplast updated 2018/11/272250 tcpremote-collabremote-collablast updated 2018/11/272250 udpremote-collabremote-collablast updated 2018/11/272251 tcpDistributed Framework Portdif-portlast updated 2018/11/272251 udpDistributed Framework Portdif-portlast updated 2018/11/272252 tcpNJENET using SSLnjenet-ssllast updated 2018/11/272252 udpNJENET using SSLnjenet-ssllast updated 2018/11/272253 tcpDTV Channel Requestdtv-chan-reqlast updated 2018/11/272253 udpDTV Channel Requestdtv-chan-reqlast updated 2018/11/272254 tcpSeismic P.O.C. Portseispoclast updated 2018/11/272254 udpSeismic P.O.C. Portseispoclast updated 2018/11/272255 tcpVRTP - ViRtue Transfer Protocolvrtplast updated 2018/11/272255 udpVRTP - ViRtue Transfer Protocolvrtplast updated 2018/11/272256 tcpPCC MFPpcc-mfplast updated 2018/11/272256 udpPCC MFPpcc-mfplast updated 2018/11/272257 tcpsimple text/file transfersimple-tx-rxlast updated 2018/11/272257 udpsimple text/file transfersimple-tx-rxlast updated 2018/11/272258 tcpRotorcraft Communications Test Systemrctslast updated 2018/11/272258 udpRotorcraft Communications Test Systemrctslast updated 2018/11/272259 UnassignedN/Alast updated 2018/11/272260 tcpAPC 2260apc-2260last updated 2018/11/272260 udpAPC 2260apc-2260last updated 2018/11/272261 tcpCoMotion Master Servercomotionmasterlast updated 2018/11/272261 udpCoMotion Master Servercomotionmasterlast updated 2018/11/272262 tcpCoMotion Backup Servercomotionbacklast updated 2018/11/272262 udpCoMotion Backup Servercomotionbacklast updated 2018/11/272263 tcpECweb Configuration Serviceecwcfglast updated 2018/11/272263 udpECweb Configuration Serviceecwcfglast updated 2018/11/272264 tcpAudio Precision Apx500 API Port 1apx500api-1last updated 2018/11/272264 udpAudio Precision Apx500 API Port 1apx500api-1last updated 2018/11/272265 tcpAudio Precision Apx500 API Port 2apx500api-2last updated 2018/11/272265 udpAudio Precision Apx500 API Port 2apx500api-2last updated 2018/11/272266 tcpM-Files Servermfserverlast updated 2018/11/272266 udpM-files Servermfserverlast updated 2018/11/272267 tcpOntoBrokerontobrokerlast updated 2018/11/272267 udpOntoBrokerontobrokerlast updated 2018/11/272268 tcpAMTamtlast updated 2018/11/272268 udpAMTamtlast updated 2018/11/272269 tcpMIKEYmikeylast updated 2018/11/272269 udpMIKEYmikeylast updated 2018/11/272270 tcpstarSchoolstarschoollast updated 2018/11/272270 udpstarSchoolstarschoollast updated 2018/11/272271 tcpSecure Meeting Maker Schedulingmmcalslast updated 2018/11/272271 udpSecure Meeting Maker Schedulingmmcalslast updated 2018/11/272272 tcpMeeting Maker Schedulingmmcallast updated 2018/11/272272 udpMeeting Maker Schedulingmmcallast updated 2018/11/272273 tcpMySQL Instance Managermysql-imlast updated 2018/11/272273 udpMySQL Instance Managermysql-imlast updated 2018/11/272274 tcpPCTTunnellerpcttunnelllast updated 2018/11/272274 udpPCTTunnellerpcttunnelllast updated 2018/11/272275 tcpiBridge Conferencingibridge-datalast updated 2018/11/272275 udpiBridge Conferencingibridge-datalast updated 2018/11/272276 tcpiBridge Managementibridge-mgmtlast updated 2018/11/272276 udpiBridge Managementibridge-mgmtlast updated 2018/11/272277 tcpBt device control proxybluectrlproxylast updated 2018/11/272277 udpBt device control proxybluectrlproxylast updated 2018/11/272278 tcpSimple Stacked Sequences Databases3dblast updated 2018/11/272278 udpSimple Stacked Sequences Databases3dblast updated 2018/11/272279 tcpxmqueryxmquerylast updated 2018/11/272279 udpxmqueryxmquerylast updated 2018/11/272280 tcpLNVPOLLERlnvpollerlast updated 2018/11/272280 udpLNVPOLLERlnvpollerlast updated 2018/11/272281 tcpLNVCONSOLElnvconsolelast updated 2018/11/272281 udpLNVCONSOLElnvconsolelast updated 2018/11/272282 tcpLNVALARMlnvalarmlast updated 2018/11/272282 udpLNVALARMlnvalarmlast updated 2018/11/272283 tcpLNVSTATUSlnvstatuslast updated 2018/11/272283 udpLNVSTATUSlnvstatuslast updated 2018/11/272284 tcpLNVMAPSlnvmapslast updated 2018/11/272284 udpLNVMAPSlnvmapslast updated 2018/11/272285 tcpLNVMAILMONlnvmailmonlast updated 2018/11/272285 udpLNVMAILMONlnvmailmonlast updated 2018/11/272286 tcpNAS-Meteringnas-meteringlast updated 2018/11/272286 udpNAS-Meteringnas-meteringlast updated 2018/11/272287 tcpDNAdnalast updated 2018/11/272287 udpDNAdnalast updated 2018/11/272288 tcpNETMLnetmllast updated 2018/11/272288 udpNETMLnetmllast updated 2018/11/272289 tcpLookup dict serverdict-lookuplast updated 2018/11/272289 udpLookup dict serverdict-lookuplast updated 2018/11/272290 tcpSonus Logging Servicessonus-logginglast updated 2018/11/272290 udpSonus Logging Servicessonus-logginglast updated 2018/11/272291 tcpEPSON Advanced Printer Share Protocoleapsplast updated 2018/11/272291 udpEPSON Advanced Printer Share Protocoleapsplast updated 2018/11/272292 tcpSonus Element Management Servicesmib-streaminglast updated 2018/11/272292 udpSonus Element Management Servicesmib-streaminglast updated 2018/11/272293 tcpNetwork Platform Debug Managernpdbgmngrlast updated 2018/11/272293 udpNetwork Platform Debug Managernpdbgmngrlast updated 2018/11/272294 tcpKonshus License Manager (FLEX)konshus-lmlast updated 2018/11/272294 udpKonshus License Manager (FLEX)konshus-lmlast updated 2018/11/272295 tcpAdvant License Manageradvant-lmlast updated 2018/11/272295 udpAdvant License Manageradvant-lmlast updated 2018/11/272296 tcpTheta License Manager (Rainbow)theta-lmlast updated 2018/11/272296 udpTheta License Manager (Rainbow)theta-lmlast updated 2018/11/272297 tcpD2K DataMover 1d2k-datamover1last updated 2018/11/272297 udpD2K DataMover 1d2k-datamover1last updated 2018/11/272298 tcpD2K DataMover 2d2k-datamover2last updated 2018/11/272298 udpD2K DataMover 2d2k-datamover2last updated 2018/11/272299 tcpPC Telecommutepc-telecommutelast updated 2018/11/272299 udpPC Telecommutepc-telecommutelast updated 2018/11/272300 tcpCVMMONcvmmonlast updated 2018/11/272300 udpCVMMONcvmmonlast updated 2018/11/272301 tcpCompaq HTTPcpq-wbemlast updated 2018/11/272301 udpCompaq HTTPcpq-wbemlast updated 2018/11/272302 tcpBindery Supportbinderysupportlast updated 2018/11/272302 udpBindery Supportbinderysupportlast updated 2018/11/272303 tcpProxy Gatewayproxy-gatewaylast updated 2018/11/272303 udpProxy Gatewayproxy-gatewaylast updated 2018/11/272304 tcpAttachmate UTSattachmate-utslast updated 2018/11/272304 udpAttachmate UTSattachmate-utslast updated 2018/11/272305 tcpMT ScaleServermt-scaleserverlast updated 2018/11/272305 udpMT ScaleServermt-scaleserverlast updated 2018/11/272306 tcpTAPPI BoxNettappi-boxnetlast updated 2018/11/272306 udpTAPPI BoxNettappi-boxnetlast updated 2018/11/272307 tcppehelppehelplast updated 2018/11/272307 udppehelppehelplast updated 2018/11/272308 tcpsdhelpsdhelplast updated 2018/11/272308 udpsdhelpsdhelplast updated 2018/11/272309 tcpSD Serversdserverlast updated 2018/11/272309 udpSD Serversdserverlast updated 2018/11/272310 tcpSD Clientsdclientlast updated 2018/11/272310 udpSD Clientsdclientlast updated 2018/11/272311 tcpMessage Servicemessageservicelast updated 2018/11/272311 udpMessage Servicemessageservicelast updated 2018/11/272312 tcpWANScaler Communication Servicewanscalerlast updated 2018/11/272312 udpWANScaler Communication Servicewanscalerlast updated 2018/11/272313 tcpIAPP (Inter Access Point Protocol)iapplast updated 2018/11/272313 udpIAPP (Inter Access Point Protocol)iapplast updated 2018/11/272314 tcpCR WebSystemscr-websystemslast updated 2018/11/272314 udpCR WebSystemscr-websystemslast updated 2018/11/272315 tcpPrecise Sft.precise-sftlast updated 2018/11/272315 udpPrecise Sft.precise-sftlast updated 2018/11/272316 tcpSENT License Managersent-lmlast updated 2018/11/272316 udpSENT License Managersent-lmlast updated 2018/11/272317 tcpAttachmate G32attachmate-g32last updated 2018/11/272317 udpAttachmate G32attachmate-g32last updated 2018/11/272318 tcpCadence Controlcadencecontrollast updated 2018/11/272318 udpCadence Controlcadencecontrollast updated 2018/11/272319 tcpInfoLibriainfolibrialast updated 2018/11/272319 udpInfoLibriainfolibrialast updated 2018/11/272320 tcpSiebel NSsiebel-nslast updated 2018/11/272320 udpSiebel NSsiebel-nslast updated 2018/11/272321 tcpRDLAPrdlaplast updated 2018/11/272321 udpRDLAPrdlaplast updated 2018/11/272322 tcpofsdofsdlast updated 2018/11/272322 udpofsdofsdlast updated 2018/11/272323 tcp3d-nfsd3d-nfsdlast updated 2018/11/272323 udp3d-nfsd3d-nfsdlast updated 2018/11/272324 tcpCosmocallcosmocalllast updated 2018/11/272324 udpCosmocallcosmocalllast updated 2018/11/272325 tcpANSYS Licensing Interconnectansyslilast updated 2018/11/272325 udpANSYS Licensing Interconnectansyslilast updated 2018/11/272326 tcpIDCPidcplast updated 2018/11/272326 udpIDCPidcplast updated 2018/11/272327 tcpxingcsmxingcsmlast updated 2018/11/272327 udpxingcsmxingcsmlast updated 2018/11/272328 tcpNetrix SFTMnetrix-sftmlast updated 2018/11/272328 udpNetrix SFTMnetrix-sftmlast updated 2018/11/272329 tcpNVDnvdlast updated 2018/11/272329 udpNVDnvdlast updated 2018/11/272330 tcpTSCCHATtscchatlast updated 2018/11/272330 udpTSCCHATtscchatlast updated 2018/11/272331 tcpAGENTVIEWagentviewlast updated 2018/11/272331 udpAGENTVIEWagentviewlast updated 2018/11/272332 tcpRCC Hostrcc-hostlast updated 2018/11/272332 udpRCC Hostrcc-hostlast updated 2018/11/272333 tcpSNAPPsnapplast updated 2018/11/272333 udpSNAPPsnapplast updated 2018/11/272334 tcpACE Client Authace-clientlast updated 2018/11/272334 udpACE Client Authace-clientlast updated 2018/11/272335 tcpACE Proxyace-proxylast updated 2018/11/272335 udpACE Proxyace-proxylast updated 2018/11/272336 tcpApple UG Controlappleugcontrollast updated 2018/11/272336 udpApple UG Controlappleugcontrollast updated 2018/11/272337 tcpideesrvideesrvlast updated 2018/11/272337 udpideesrvideesrvlast updated 2018/11/272338 tcpNorton Lambertnorton-lambertlast updated 2018/11/272338 udpNorton Lambertnorton-lambertlast updated 2018/11/272339 tcp3Com WebView3com-webviewlast updated 2018/11/272339 udp3Com WebView3com-webviewlast updated 2018/11/272340 tcpWRS Registry IANA assigned this well-formed service name as a replacement for "wrs_registry".wrs-registrylast updated 2018/11/272340 tcp (wrs_registry)WRS Registrywrs_registrylast updated 2018/11/272340 udpWRS Registry IANA assigned this well-formed service name as a replacement for "wrs_registry".wrs-registrylast updated 2018/11/272340 udp (wrs_registry)WRS Registrywrs_registrylast updated 2018/11/272341 tcpXIO Statusxiostatuslast updated 2018/11/272341 udpXIO Statusxiostatuslast updated 2018/11/272342 tcpSeagate Manage Execmanage-execlast updated 2018/11/272342 udpSeagate Manage Execmanage-execlast updated 2018/11/272343 tcpnati logosnati-logoslast updated 2018/11/272343 udpnati logosnati-logoslast updated 2018/11/272344 tcpfcmsysfcmsyslast updated 2018/11/272344 udpfcmsysfcmsyslast updated 2018/11/272345 tcpdbmdbmlast updated 2018/11/272345 udpdbmdbmlast updated 2018/11/272346 tcpGame Connection Port IANA assigned this well-formed service name as a replacement for "redstorm_join".redstorm-joinlast updated 2018/11/272346 tcp (redstorm_join)Game Connection Portredstorm_joinlast updated 2018/11/272346 udpGame Connection Port IANA assigned this well-formed service name as a replacement for "redstorm_join".redstorm-joinlast updated 2018/11/272346 udp (redstorm_join)Game Connection Portredstorm_joinlast updated 2018/11/272347 tcpGame Announcement and Location IANA assigned this well-formed service name as a replacement for "redstorm_find".redstorm-findlast updated 2018/11/272347 tcp (redstorm_find)Game Announcement and Locationredstorm_findlast updated 2018/11/272347 udpGame Announcement and Location IANA assigned this well-formed service name as a replacement for "redstorm_find".redstorm-findlast updated 2018/11/272347 udp (redstorm_find)Game Announcement and Locationredstorm_findlast updated 2018/11/272348 tcpInformation to query for game status IANA assigned this well-formed service name as a replacement for "redstorm_info".redstorm-infolast updated 2018/11/272348 tcp (redstorm_info)Information to query for game statusredstorm_infolast updated 2018/11/272348 udpInformation to query for game status IANA assigned this well-formed service name as a replacement for "redstorm_info".redstorm-infolast updated 2018/11/272348 udp (redstorm_info)Information to query for game statusredstorm_infolast updated 2018/11/272349 tcpDiagnostics Port IANA assigned this well-formed service name as a replacement for "redstorm_diag".redstorm-diaglast updated 2018/11/272349 tcp (redstorm_diag)Diagnostics Portredstorm_diaglast updated 2018/11/272349 udpDiagnostics Port IANA assigned this well-formed service name as a replacement for "redstorm_diag".redstorm-diaglast updated 2018/11/272349 udp (redstorm_diag)Diagnostics Portredstorm_diaglast updated 2018/11/272350 tcpPharos Booking Serverpsbserverlast updated 2018/11/272350 udpPharos Booking Serverpsbserverlast updated 2018/11/272351 tcppsrserverpsrserverlast updated 2018/11/272351 udppsrserverpsrserverlast updated 2018/11/272352 tcppslserverpslserverlast updated 2018/11/272352 udppslserverpslserverlast updated 2018/11/272353 tcppspserverpspserverlast updated 2018/11/272353 udppspserverpspserverlast updated 2018/11/272354 tcppsprserverpsprserverlast updated 2018/11/272354 udppsprserverpsprserverlast updated 2018/11/272355 tcppsdbserverpsdbserverlast updated 2018/11/272355 udppsdbserverpsdbserverlast updated 2018/11/272356 tcpGXT License Managemantgxtelmdlast updated 2018/11/272356 udpGXT License Managemantgxtelmdlast updated 2018/11/272357 tcpUniHub Serverunihub-serverlast updated 2018/11/272357 udpUniHub Serverunihub-serverlast updated 2018/11/272358 tcpFutrixfutrixlast updated 2018/11/272358 udpFutrixfutrixlast updated 2018/11/272359 tcpFlukeServerflukeserverlast updated 2018/11/272359 udpFlukeServerflukeserverlast updated 2018/11/272360 tcpNexstorIndLtdnexstorindltdlast updated 2018/11/272360 udpNexstorIndLtdnexstorindltdlast updated 2018/11/272361 tcpTL1tl1last updated 2018/11/272361 udpTL1tl1last updated 2018/11/272362 tcpdigimandigimanlast updated 2018/11/272362 udpdigimandigimanlast updated 2018/11/272363 tcpMedia Central NFSDmediacntrlnfsdlast updated 2018/11/272363 udpMedia Central NFSDmediacntrlnfsdlast updated 2018/11/272364 tcpOI-2000oi-2000last updated 2018/11/272364 udpOI-2000oi-2000last updated 2018/11/272365 tcpdbrefdbreflast updated 2018/11/272365 udpdbrefdbreflast updated 2018/11/272366 tcpqip-loginqip-loginlast updated 2018/11/272366 udpqip-loginqip-loginlast updated 2018/11/272367 tcpService Controlservice-ctrllast updated 2018/11/272367 udpService Controlservice-ctrllast updated 2018/11/272368 tcpOpenTableopentablelast updated 2018/11/272368 udpOpenTableopentablelast updated 2018/11/272369 UnassignedN/Alast updated 2018/11/272370 tcpL3-HBMonl3-hbmonlast updated 2018/11/272370 udpL3-HBMonl3-hbmonlast updated 2018/11/272371 tcpRemote Device Accessrdalast updated 2018/11/272371 udpReservedN/Alast updated 2018/11/272372 tcpLanMessengerlanmessengerlast updated 2018/11/272372 udpLanMessengerlanmessengerlast updated 2018/11/272373 tcpRemograph License Managerremographlmlast updated 2018/11/272373 udpReservedN/Alast updated 2018/11/272374 tcpHydra RPChydralast updated 2018/11/272374 udpReservedN/Alast updated 2018/11/272375 tcpDocker REST API (plain text)dockerlast updated 2018/11/272375 udpReservedN/Alast updated 2018/11/272376 tcpDocker REST API (ssl)docker-slast updated 2018/11/272377 tcpRPC interface for Docker Swarmswarmlast updated 2018/11/272377 udpReservedN/Alast updated 2018/11/272378 UnassignedN/Alast updated 2018/11/272379 tcpetcd client communicationetcd-clientlast updated 2018/11/272379 udpReservedN/Alast updated 2018/11/272380 tcpetcd server to server communicationetcd-serverlast updated 2018/11/272380 udpReservedN/Alast updated 2018/11/272381 tcpCompaq HTTPScompaq-httpslast updated 2018/11/272381 udpCompaq HTTPScompaq-httpslast updated 2018/11/272382 tcpMicrosoft OLAPms-olap3last updated 2018/11/272382 udpMicrosoft OLAPms-olap3last updated 2018/11/272383 tcpMicrosoft OLAPms-olap4last updated 2018/11/272383 udpMicrosoft OLAPms-olap4last updated 2018/11/272384 tcpSD-REQUESTsd-requestlast updated 2018/11/272384 udpSD-CAPACITYsd-capacitylast updated 2018/11/272385 tcpSD-DATAsd-datalast updated 2018/11/272385 udpSD-DATAsd-datalast updated 2018/11/272386 tcpVirtual Tapevirtualtapelast updated 2018/11/272386 udpVirtual Tapevirtualtapelast updated 2018/11/272387 tcpVSAM Redirectorvsamredirectorlast updated 2018/11/272387 udpVSAM Redirectorvsamredirectorlast updated 2018/11/272388 tcpMYNAH AutoStartmynahautostartlast updated 2018/11/272388 udpMYNAH AutoStartmynahautostartlast updated 2018/11/272389 tcpOpenView Session Mgrovsessionmgrlast updated 2018/11/272389 udpOpenView Session Mgrovsessionmgrlast updated 2018/11/272390 tcpRSMTPrsmtplast updated 2018/11/272390 udpRSMTPrsmtplast updated 2018/11/272391 tcp3COM Net Management3com-net-mgmtlast updated 2018/11/272391 udp3COM Net Management3com-net-mgmtlast updated 2018/11/272392 tcpTactical Authtacticalauthlast updated 2018/11/272392 udpTactical Authtacticalauthlast updated 2018/11/272393 tcpMS OLAP 1ms-olap1last updated 2018/11/272393 udpMS OLAP 1ms-olap1last updated 2018/11/272394 tcpMS OLAP 2ms-olap2last updated 2018/11/272394 udpMS OLAP 2ms-olap2last updated 2018/11/272395 tcpLAN900 Remote IANA assigned this well-formed service name as a replacement for "lan900_remote".lan900-remotelast updated 2018/11/272395 tcp (lan900_remote)LAN900 Remotelan900_remotelast updated 2018/11/272395 udpLAN900 Remote IANA assigned this well-formed service name as a replacement for "lan900_remote".lan900-remotelast updated 2018/11/272395 udp (lan900_remote)LAN900 Remotelan900_remotelast updated 2018/11/272396 tcpWusagewusagelast updated 2018/11/272396 udpWusagewusagelast updated 2018/11/272397 tcpNCLncllast updated 2018/11/272397 udpNCLncllast updated 2018/11/272398 tcpOrbiterorbiterlast updated 2018/11/272398 udpOrbiterorbiterlast updated 2018/11/272399 tcpFileMaker, Inc. - Data Access Layerfmpro-fdallast updated 2018/11/272399 udpFileMaker, Inc. - Data Access Layerfmpro-fdallast updated 2018/11/272400 tcpOpEquus Serveropequus-serverlast updated 2018/11/272400 udpOpEquus Serveropequus-serverlast updated 2018/11/272401 tcpcvspservercvspserverlast updated 2018/11/272401 udpcvspservercvspserverlast updated 2018/11/272402 tcpTaskMaster 2000 Servertaskmaster2000last updated 2018/11/272402 udpTaskMaster 2000 Servertaskmaster2000last updated 2018/11/272403 tcpTaskMaster 2000 Webtaskmaster2000last updated 2018/11/272403 udpTaskMaster 2000 Webtaskmaster2000last updated 2018/11/272404 tcpIEC 60870-5-104 process control over IPiec-104last updated 2018/11/272404 udpIEC 60870-5-104 process control over IPiec-104last updated 2018/11/272405 tcpTRC Netpolltrc-netpolllast updated 2018/11/272405 udpTRC Netpolltrc-netpolllast updated 2018/11/272406 tcpJediServerjediserverlast updated 2018/11/272406 udpJediServerjediserverlast updated 2018/11/272407 tcpOrionorionlast updated 2018/11/272407 udpOrionorionlast updated 2018/11/272408 tcpCloudFlare Railgun Web Acceleration Protocolrailgun-webaccllast updated 2018/11/272408 udpReservedN/Alast updated 2018/11/272409 tcpSNS Protocolsns-protocollast updated 2018/11/272409 udpSNS Protocolsns-protocollast updated 2018/11/272410 tcpVRTS Registryvrts-registrylast updated 2018/11/272410 udpVRTS Registryvrts-registrylast updated 2018/11/272411 tcpNetwave AP Managementnetwave-ap-mgmtlast updated 2018/11/272411 udpNetwave AP Managementnetwave-ap-mgmtlast updated 2018/11/272412 tcpCDNcdnlast updated 2018/11/272412 udpCDNcdnlast updated 2018/11/272413 tcporion-rmi-regorion-rmi-reglast updated 2018/11/272413 udporion-rmi-regorion-rmi-reglast updated 2018/11/272414 tcpBeeyondbeeyondlast updated 2018/11/272414 udpBeeyondbeeyondlast updated 2018/11/272415 tcpCodima Remote Transaction Protocolcodima-rtplast updated 2018/11/272415 udpCodima Remote Transaction Protocolcodima-rtplast updated 2018/11/272416 tcpRMT Serverrmtserverlast updated 2018/11/272416 udpRMT Serverrmtserverlast updated 2018/11/272417 tcpComposit Servercomposit-serverlast updated 2018/11/272417 udpComposit Servercomposit-serverlast updated 2018/11/272418 tcpcascaslast updated 2018/11/272418 udpcascaslast updated 2018/11/272419 tcpAttachmate S2Sattachmate-s2slast updated 2018/11/272419 udpAttachmate S2Sattachmate-s2slast updated 2018/11/272420 tcpDSL Remote Managementdslremote-mgmtlast updated 2018/11/272420 udpDSL Remote Managementdslremote-mgmtlast updated 2018/11/272421 tcpG-Talkg-talklast updated 2018/11/272421 udpG-Talkg-talklast updated 2018/11/272422 tcpCRMSBITScrmsbitslast updated 2018/11/272422 udpCRMSBITScrmsbitslast updated 2018/11/272423 tcpRNRPrnrplast updated 2018/11/272423 udpRNRPrnrplast updated 2018/11/272424 tcpKOFAX-SVRkofax-svrlast updated 2018/11/272424 udpKOFAX-SVRkofax-svrlast updated 2018/11/272425 tcpFujitsu App Managerfjitsuappmgrlast updated 2018/11/272425 udpFujitsu App Managerfjitsuappmgrlast updated 2018/11/272426 tcpVeloCloud MultiPath Protocolvcmplast updated 2018/11/272426 udpVeloCloud MultiPath Protocolvcmplast updated 2018/11/272427 tcpMedia Gateway Control Protocol Gatewaymgcp-gatewaylast updated 2018/11/272427 udpMedia Gateway Control Protocol Gatewaymgcp-gatewaylast updated 2018/11/272428 tcpOne Way Trip Timeottlast updated 2018/11/272428 udpOne Way Trip Timeottlast updated 2018/11/272429 tcpFT-ROLEft-rolelast updated 2018/11/272429 udpFT-ROLEft-rolelast updated 2018/11/272430 tcpvenusvenuslast updated 2018/11/272430 udpvenusvenuslast updated 2018/11/272431 tcpvenus-sevenus-selast updated 2018/11/272431 udpvenus-sevenus-selast updated 2018/11/272432 tcpcodasrvcodasrvlast updated 2018/11/272432 udpcodasrvcodasrvlast updated 2018/11/272433 tcpcodasrv-secodasrv-selast updated 2018/11/272433 udpcodasrv-secodasrv-selast updated 2018/11/272434 tcppxc-epmappxc-epmaplast updated 2018/11/272434 udppxc-epmappxc-epmaplast updated 2018/11/272435 tcpOptiLogicoptilogiclast updated 2018/11/272435 udpOptiLogicoptilogiclast updated 2018/11/272436 tcpTOP/Xtopxlast updated 2018/11/272436 udpTOP/Xtopxlast updated 2018/11/272437 tcpUniControlunicontrollast updated 2018/11/272437 udpUniControlunicontrollast updated 2018/11/272438 tcpMSPmsplast updated 2018/11/272438 udpMSPmsplast updated 2018/11/272439 tcpSybaseDBSynchsybasedbsynchlast updated 2018/11/272439 udpSybaseDBSynchsybasedbsynchlast updated 2018/11/272440 tcpSpearway Lockersspearwaylast updated 2018/11/272440 udpSpearway Lockersspearwaylast updated 2018/11/272441 tcpPervasive I*net Data Serverpvsw-inetlast updated 2018/11/272441 udpPervasive I*net Data Serverpvsw-inetlast updated 2018/11/272442 tcpNetangelnetangellast updated 2018/11/272442 udpNetangelnetangellast updated 2018/11/272443 tcpPowerClient Central Storage Facilitypowerclientcsflast updated 2018/11/272443 udpPowerClient Central Storage Facilitypowerclientcsflast updated 2018/11/272444 tcpBT PP2 Sectransbtpp2sectranslast updated 2018/11/272444 udpBT PP2 Sectransbtpp2sectranslast updated 2018/11/272445 tcpDTN1dtn1last updated 2018/11/272445 udpDTN1dtn1last updated 2018/11/272446 tcpbues_service IANA assigned this well-formed service name as a replacement for "bues_service".bues-servicelast updated 2018/11/272446 tcp (bues_service)bues_servicebues_servicelast updated 2018/11/272446 udpbues_service IANA assigned this well-formed service name as a replacement for "bues_service".bues-servicelast updated 2018/11/272446 udp (bues_service)bues_servicebues_servicelast updated 2018/11/272447 tcpOpenView NNM daemonovwdblast updated 2018/11/272447 udpOpenView NNM daemonovwdblast updated 2018/11/272448 tcphpppsvrhpppssvrlast updated 2018/11/272448 udphpppsvrhpppssvrlast updated 2018/11/272449 tcpRATLratllast updated 2018/11/272449 udpRATLratllast updated 2018/11/272450 tcpnetadminnetadminlast updated 2018/11/272450 udpnetadminnetadminlast updated 2018/11/272451 tcpnetchatnetchatlast updated 2018/11/272451 udpnetchatnetchatlast updated 2018/11/272452 tcpSnifferClientsnifferclientlast updated 2018/11/272452 udpSnifferClientsnifferclientlast updated 2018/11/272453 tcpmadge ltdmadge-ltdlast updated 2018/11/272453 udpmadge ltdmadge-ltdlast updated 2018/11/272454 tcpIndX-DDSindx-ddslast updated 2018/11/272454 udpIndX-DDSindx-ddslast updated 2018/11/272455 tcpWAGO-IO-SYSTEMwago-io-systemlast updated 2018/11/272455 udpWAGO-IO-SYSTEMwago-io-systemlast updated 2018/11/272456 tcpaltav-remmgtaltav-remmgtlast updated 2018/11/272456 udpaltav-remmgtaltav-remmgtlast updated 2018/11/272457 tcpRapido_IPrapido-iplast updated 2018/11/272457 udpRapido_IPrapido-iplast updated 2018/11/272458 tcpgriffingriffinlast updated 2018/11/272458 udpgriffingriffinlast updated 2018/11/272459 tcpCommunitycommunitylast updated 2018/11/272459 udpCommunitycommunitylast updated 2018/11/272460 tcpms-theaterms-theaterlast updated 2018/11/272460 udpms-theaterms-theaterlast updated 2018/11/272461 tcpqadmifoperqadmifoperlast updated 2018/11/272461 udpqadmifoperqadmifoperlast updated 2018/11/272462 tcpqadmifeventqadmifeventlast updated 2018/11/272462 udpqadmifeventqadmifeventlast updated 2018/11/272463 tcpLSI RAID Managementlsi-raid-mgmtlast updated 2018/11/272463 udpLSI RAID Managementlsi-raid-mgmtlast updated 2018/11/272464 tcpDirecPC SIdirecpc-silast updated 2018/11/272464 udpDirecPC SIdirecpc-silast updated 2018/11/272465 tcpLoad Balance Managementlbmlast updated 2018/11/272465 udpLoad Balance Managementlbmlast updated 2018/11/272466 tcpLoad Balance Forwardinglbflast updated 2018/11/272466 udpLoad Balance Forwardinglbflast updated 2018/11/272467 tcpHigh Criteriahigh-criterialast updated 2018/11/272467 udpHigh Criteriahigh-criterialast updated 2018/11/272468 tcpqip_msgdqip-msgdlast updated 2018/11/272468 udpqip_msgdqip-msgdlast updated 2018/11/272469 tcpMTI-TCS-COMMmti-tcs-commlast updated 2018/11/272469 udpMTI-TCS-COMMmti-tcs-commlast updated 2018/11/272470 tcptaskman porttaskman-portlast updated 2018/11/272470 udptaskman porttaskman-portlast updated 2018/11/272471 tcpSeaODBCseaodbclast updated 2018/11/272471 udpSeaODBCseaodbclast updated 2018/11/272472 tcpC3c3last updated 2018/11/272472 udpC3c3last updated 2018/11/272473 tcpAker-cdpaker-cdplast updated 2018/11/272473 udpAker-cdpaker-cdplast updated 2018/11/272474 tcpVital Analysisvitalanalysislast updated 2018/11/272474 udpVital Analysisvitalanalysislast updated 2018/11/272475 tcpACE Serverace-serverlast updated 2018/11/272475 udpACE Serverace-serverlast updated 2018/11/272476 tcpACE Server Propagationace-svr-proplast updated 2018/11/272476 udpACE Server Propagationace-svr-proplast updated 2018/11/272477 tcpSecurSight Certificate Valifation Servicessm-cvslast updated 2018/11/272477 udpSecurSight Certificate Valifation Servicessm-cvslast updated 2018/11/272478 tcpSecurSight Authentication Server (SSL)ssm-csspslast updated 2018/11/272478 udpSecurSight Authentication Server (SSL)ssm-csspslast updated 2018/11/272479 tcpSecurSight Event Logging Server (SSL)ssm-elslast updated 2018/11/272479 udpSecurSight Event Logging Server (SSL)ssm-elslast updated 2018/11/272480 tcpInformatica PowerExchange Listenerpowerexchangelast updated 2018/11/272480 udpInformatica PowerExchange Listenerpowerexchangelast updated 2018/11/272481 tcpOracle GIOPgioplast updated 2018/11/272481 udpOracle GIOPgioplast updated 2018/11/272482 tcpOracle GIOP SSLgiop-ssllast updated 2018/11/272482 udpOracle GIOP SSLgiop-ssllast updated 2018/11/272483 tcpOracle TTCttclast updated 2018/11/272483 udpOracle TTCttclast updated 2018/11/272484 tcpOracle TTC SSLttc-ssllast updated 2018/11/272484 udpOracle TTC SSLttc-ssllast updated 2018/11/272485 tcpNet Objects1netobjects1last updated 2018/11/272485 udpNet Objects1netobjects1last updated 2018/11/272486 tcpNet Objects2netobjects2last updated 2018/11/272486 udpNet Objects2netobjects2last updated 2018/11/272487 tcpPolicy Notice Servicepnslast updated 2018/11/272487 udpPolicy Notice Servicepnslast updated 2018/11/272488 tcpMoy Corporationmoy-corplast updated 2018/11/272488 udpMoy Corporationmoy-corplast updated 2018/11/272489 tcpTSILBtsilblast updated 2018/11/272489 udpTSILBtsilblast updated 2018/11/272490 tcpqip_qdhcpqip-qdhcplast updated 2018/11/272490 udpqip_qdhcpqip-qdhcplast updated 2018/11/272491 tcpConclave CPPconclave-cpplast updated 2018/11/272491 udpConclave CPPconclave-cpplast updated 2018/11/272492 tcpGROOVEgroovelast updated 2018/11/272492 udpGROOVEgroovelast updated 2018/11/272493 tcpTalarian MQStalarian-mqslast updated 2018/11/272493 udpTalarian MQStalarian-mqslast updated 2018/11/272494 tcpBMC ARbmc-arlast updated 2018/11/272494 udpBMC ARbmc-arlast updated 2018/11/272495 tcpFast Remote Servicesfast-rem-servlast updated 2018/11/272495 udpFast Remote Servicesfast-rem-servlast updated 2018/11/272496 tcpDIRGISdirgislast updated 2018/11/272496 udpDIRGISdirgislast updated 2018/11/272497 tcpQuad DBquaddblast updated 2018/11/272497 udpQuad DBquaddblast updated 2018/11/272498 tcpODN-CasTraqodn-castraqlast updated 2018/11/272498 udpODN-CasTraqodn-castraqlast updated 2018/11/272499 tcpUniControlunicontrollast updated 2018/11/272499 udpUniControlunicontrollast updated 2018/11/272500 tcpResource Tracking system serverrtsservlast updated 2018/11/272500 udpResource Tracking system serverrtsservlast updated 2018/11/272501 tcpResource Tracking system clientrtsclientlast updated 2018/11/272501 udpResource Tracking system clientrtsclientlast updated 2018/11/272502 tcpKentrox Protocolkentrox-protlast updated 2018/11/272502 udpKentrox Protocolkentrox-protlast updated 2018/11/272503 tcpNMS-DPNSSnms-dpnsslast updated 2018/11/272503 udpNMS-DPNSSnms-dpnsslast updated 2018/11/272504 tcpWLBSwlbslast updated 2018/11/272504 udpWLBSwlbslast updated 2018/11/272505 tcpPowerPlay Controlppcontrollast updated 2018/11/272505 udpPowerPlay Controlppcontrollast updated 2018/11/272506 tcpjbrokerjbrokerlast updated 2018/11/272506 udpjbrokerjbrokerlast updated 2018/11/272507 tcpspockspocklast updated 2018/11/272507 udpspockspocklast updated 2018/11/272508 tcpJDataStorejdatastorelast updated 2018/11/272508 udpJDataStorejdatastorelast updated 2018/11/272509 tcpfjmpssfjmpsslast updated 2018/11/272509 udpfjmpssfjmpsslast updated 2018/11/272510 tcpfjappmgrbulkfjappmgrbulklast updated 2018/11/272510 udpfjappmgrbulkfjappmgrbulklast updated 2018/11/272511 tcpMetastormmetastormlast updated 2018/11/272511 udpMetastormmetastormlast updated 2018/11/272512 tcpCitrix IMAcitriximalast updated 2018/11/272512 udpCitrix IMAcitriximalast updated 2018/11/272513 tcpCitrix ADMINcitrixadminlast updated 2018/11/272513 udpCitrix ADMINcitrixadminlast updated 2018/11/272514 tcpFacsys NTPfacsys-ntplast updated 2018/11/272514 udpFacsys NTPfacsys-ntplast updated 2018/11/272515 tcpFacsys Routerfacsys-routerlast updated 2018/11/272515 udpFacsys Routerfacsys-routerlast updated 2018/11/272516 tcpMain Controlmaincontrollast updated 2018/11/272516 udpMain Controlmaincontrollast updated 2018/11/272517 tcpH.323 Annex E Call Control Signalling Transportcall-sig-translast updated 2018/11/272517 udpH.323 Annex E Call Control Signalling Transportcall-sig-translast updated 2018/11/272518 tcpWillywillylast updated 2018/11/272518 udpWillywillylast updated 2018/11/272519 tcpglobmsgsvcglobmsgsvclast updated 2018/11/272519 udpglobmsgsvcglobmsgsvclast updated 2018/11/272520 tcpPervasive Listenerpvswlast updated 2018/11/272520 udpPervasive Listenerpvswlast updated 2018/11/272521 tcpAdaptec Manageradaptecmgrlast updated 2018/11/272521 udpAdaptec Manageradaptecmgrlast updated 2018/11/272522 tcpWinDbwindblast updated 2018/11/272522 udpWinDbwindblast updated 2018/11/272523 tcpQke LLC V.3qke-llc-v3last updated 2018/11/272523 udpQke LLC V.3qke-llc-v3last updated 2018/11/272524 tcpOptiwave License Managementoptiwave-lmlast updated 2018/11/272524 udpOptiwave License Managementoptiwave-lmlast updated 2018/11/272525 tcpMS V-Worldsms-v-worldslast updated 2018/11/272525 udpMS V-Worldsms-v-worldslast updated 2018/11/272526 tcpEMA License Managerema-sent-lmlast updated 2018/11/272526 udpEMA License Managerema-sent-lmlast updated 2018/11/272527 tcpIQ Serveriqserverlast updated 2018/11/272527 udpIQ Serveriqserverlast updated 2018/11/272528 tcpNCR CCL IANA assigned this well-formed service name as a replacement for "ncr_ccl".ncr-ccllast updated 2018/11/272528 tcp (ncr_ccl)NCR CCLncr_ccllast updated 2018/11/272528 udpNCR CCL IANA assigned this well-formed service name as a replacement for "ncr_ccl".ncr-ccllast updated 2018/11/272528 udp (ncr_ccl)NCR CCLncr_ccllast updated 2018/11/272529 tcpUTS FTPutsftplast updated 2018/11/272529 udpUTS FTPutsftplast updated 2018/11/272530 tcpVR Commercevrcommercelast updated 2018/11/272530 udpVR Commercevrcommercelast updated 2018/11/272531 tcpITO-E GUIito-e-guilast updated 2018/11/272531 udpITO-E GUIito-e-guilast updated 2018/11/272532 tcpOVTOPMDovtopmdlast updated 2018/11/272532 udpOVTOPMDovtopmdlast updated 2018/11/272533 tcpSnifferServersnifferserverlast updated 2018/11/272533 udpSnifferServersnifferserverlast updated 2018/11/272534 tcpCombox Web Accesscombox-web-acclast updated 2018/11/272534 udpCombox Web Accesscombox-web-acclast updated 2018/11/272535 tcpMADCAPmadcaplast updated 2018/11/272535 udpMADCAPmadcaplast updated 2018/11/272536 tcpbtpp2audctr1btpp2audctr1last updated 2018/11/272536 udpbtpp2audctr1btpp2audctr1last updated 2018/11/272537 tcpUpgrade Protocolupgradelast updated 2018/11/272537 udpUpgrade Protocolupgradelast updated 2018/11/272538 tcpvnwk-prapivnwk-prapilast updated 2018/11/272538 udpvnwk-prapivnwk-prapilast updated 2018/11/272539 tcpVSI Adminvsiadminlast updated 2018/11/272539 udpVSI Adminvsiadminlast updated 2018/11/272540 tcpLonWorkslonworkslast updated 2018/11/272540 udpLonWorkslonworkslast updated 2018/11/272541 tcpLonWorks2lonworks2last updated 2018/11/272541 udpLonWorks2lonworks2last updated 2018/11/272542 tcpuDraw(Graph)udrawgraphlast updated 2018/11/272542 udpuDraw(Graph)udrawgraphlast updated 2018/11/272543 tcpREFTEKrefteklast updated 2018/11/272543 udpREFTEKrefteklast updated 2018/11/272544 tcpManagement Daemon Refreshnovell-zenlast updated 2018/11/272544 udpManagement Daemon Refreshnovell-zenlast updated 2018/11/272545 tcpsis-emtsis-emtlast updated 2018/11/272545 udpsis-emtsis-emtlast updated 2018/11/272546 tcpvytalvaultbrtpvytalvaultbrtplast updated 2018/11/272546 udpvytalvaultbrtpvytalvaultbrtplast updated 2018/11/272547 tcpvytalvaultvsmpvytalvaultvsmplast updated 2018/11/272547 udpvytalvaultvsmpvytalvaultvsmplast updated 2018/11/272548 tcpvytalvaultpipevytalvaultpipelast updated 2018/11/272548 udpvytalvaultpipevytalvaultpipelast updated 2018/11/272549 tcpIPASSipasslast updated 2018/11/272549 udpIPASSipasslast updated 2018/11/272550 tcpADSadslast updated 2018/11/272550 udpADSadslast updated 2018/11/272551 tcpISG UDA Serverisg-uda-serverlast updated 2018/11/272551 udpISG UDA Serverisg-uda-serverlast updated 2018/11/272552 tcpCall Loggingcall-logginglast updated 2018/11/272552 udpCall Loggingcall-logginglast updated 2018/11/272553 tcpefidiningportefidiningportlast updated 2018/11/272553 udpefidiningportefidiningportlast updated 2018/11/272554 tcpVCnet-Link v10vcnet-link-v10last updated 2018/11/272554 udpVCnet-Link v10vcnet-link-v10last updated 2018/11/272555 tcpCompaq WCPcompaq-wcplast updated 2018/11/272555 udpCompaq WCPcompaq-wcplast updated 2018/11/272556 tcpnicetec-nmsvcnicetec-nmsvclast updated 2018/11/272556 udpnicetec-nmsvcnicetec-nmsvclast updated 2018/11/272557 tcpnicetec-mgmtnicetec-mgmtlast updated 2018/11/272557 udpnicetec-mgmtnicetec-mgmtlast updated 2018/11/272558 tcpPCLE Multi Mediapclemultimedialast updated 2018/11/272558 udpPCLE Multi Mediapclemultimedialast updated 2018/11/272559 tcpLSTPlstplast updated 2018/11/272559 udpLSTPlstplast updated 2018/11/272560 tcplabratlabratlast updated 2018/11/272560 udplabratlabratlast updated 2018/11/272561 tcpMosaixCCmosaixcclast updated 2018/11/272561 udpMosaixCCmosaixcclast updated 2018/11/272562 tcpDelibodelibolast updated 2018/11/272562 udpDelibodelibolast updated 2018/11/272563 tcpCTI Redwoodcti-redwoodlast updated 2018/11/272563 udpCTI Redwoodcti-redwoodlast updated 2018/11/272564 tcpHP 3000 NS/VT block mode telnethp-3000-telnetlast updated 2018/11/272564 udpHP 3000 NS/VT block mode telnethp-3000-telnetlast updated 2018/11/272565 tcpCoordinator Servercoord-svrlast updated 2018/11/272565 udpCoordinator Servercoord-svrlast updated 2018/11/272566 tcppcs-pcwpcs-pcwlast updated 2018/11/272566 udppcs-pcwpcs-pcwlast updated 2018/11/272567 tcpCisco Line Protocolclplast updated 2018/11/272567 udpCisco Line Protocolclplast updated 2018/11/272568 tcpSPAM TRAPspamtraplast updated 2018/11/272568 udpSPAM TRAPspamtraplast updated 2018/11/272569 tcpSonus Call Signalsonuscallsiglast updated 2018/11/272569 udpSonus Call Signalsonuscallsiglast updated 2018/11/272570 tcpHS Porths-portlast updated 2018/11/272570 udpHS Porths-portlast updated 2018/11/272571 tcpCECSVCcecsvclast updated 2018/11/272571 udpCECSVCcecsvclast updated 2018/11/272572 tcpIBPibplast updated 2018/11/272572 udpIBPibplast updated 2018/11/272573 tcpTrust Establishtrustestablishlast updated 2018/11/272573 udpTrust Establishtrustestablishlast updated 2018/11/272574 tcpBlockade BPSPblockade-bpsplast updated 2018/11/272574 udpBlockade BPSPblockade-bpsplast updated 2018/11/272575 tcpHL7hl7last updated 2018/11/272575 udpHL7hl7last updated 2018/11/272576 tcpTCL Pro Debuggertclprodebuggerlast updated 2018/11/272576 udpTCL Pro Debuggertclprodebuggerlast updated 2018/11/272577 tcpScriptics Lsrvrscipticslsrvrlast updated 2018/11/272577 udpScriptics Lsrvrscipticslsrvrlast updated 2018/11/272578 tcpRVS ISDN DCPrvs-isdn-dcplast updated 2018/11/272578 udpRVS ISDN DCPrvs-isdn-dcplast updated 2018/11/272579 tcpmpfonclmpfoncllast updated 2018/11/272579 udpmpfonclmpfoncllast updated 2018/11/272580 tcpTributarytributarylast updated 2018/11/272580 udpTributarytributarylast updated 2018/11/272581 tcpARGIS TEargis-telast updated 2018/11/272581 udpARGIS TEargis-telast updated 2018/11/272582 tcpARGIS DSargis-dslast updated 2018/11/272582 udpARGIS DSargis-dslast updated 2018/11/272583 tcpMONmonlast updated 2018/11/272583 udpMONmonlast updated 2018/11/272584 tcpcyaservcyaservlast updated 2018/11/272584 udpcyaservcyaservlast updated 2018/11/272585 tcpNETX Servernetx-serverlast updated 2018/11/272585 udpNETX Servernetx-serverlast updated 2018/11/272586 tcpNETX Agentnetx-agentlast updated 2018/11/272586 udpNETX Agentnetx-agentlast updated 2018/11/272587 tcpMASCmasclast updated 2018/11/272587 udpMASCmasclast updated 2018/11/272588 tcpPrivilegeprivilegelast updated 2018/11/272588 udpPrivilegeprivilegelast updated 2018/11/272589 tcpquartus tclquartus-tcllast updated 2018/11/272589 udpquartus tclquartus-tcllast updated 2018/11/272590 tcpidotdistidotdistlast updated 2018/11/272590 udpidotdistidotdistlast updated 2018/11/272591 tcpMaytag Shufflemaytagshufflelast updated 2018/11/272591 udpMaytag Shufflemaytagshufflelast updated 2018/11/272592 tcpnetreknetreklast updated 2018/11/272592 udpnetreknetreklast updated 2018/11/272593 tcpMNS Mail Notice Servicemns-maillast updated 2018/11/272593 udpMNS Mail Notice Servicemns-maillast updated 2018/11/272594 tcpData Base Serverdtslast updated 2018/11/272594 udpData Base Serverdtslast updated 2018/11/272595 tcpWorld Fusion 1worldfusion1last updated 2018/11/272595 udpWorld Fusion 1worldfusion1last updated 2018/11/272596 tcpWorld Fusion 2worldfusion2last updated 2018/11/272596 udpWorld Fusion 2worldfusion2last updated 2018/11/272597 tcpHomestead Gloryhomesteadglorylast updated 2018/11/272597 udpHomestead Gloryhomesteadglorylast updated 2018/11/272598 tcpCitrix MA Clientcitriximaclientlast updated 2018/11/272598 udpCitrix MA Clientcitriximaclientlast updated 2018/11/272599 tcpSnap Discoverysnapdlast updated 2018/11/272599 udpSnap Discoverysnapdlast updated 2018/11/272600 tcpHPSTGMGRhpstgmgrlast updated 2018/11/272600 udpHPSTGMGRhpstgmgrlast updated 2018/11/272601 tcpdiscp clientdiscp-clientlast updated 2018/11/272601 udpdiscp clientdiscp-clientlast updated 2018/11/272602 tcpdiscp serverdiscp-serverlast updated 2018/11/272602 udpdiscp serverdiscp-serverlast updated 2018/11/272603 tcpService Meterservicemeterlast updated 2018/11/272603 udpService Meterservicemeterlast updated 2018/11/272604 tcpNSC CCSnsc-ccslast updated 2018/11/272604 udpNSC CCSnsc-ccslast updated 2018/11/272605 tcpNSC POSAnsc-posalast updated 2018/11/272605 udpNSC POSAnsc-posalast updated 2018/11/272606 tcpDell Netmonnetmonlast updated 2018/11/272606 udpDell Netmonnetmonlast updated 2018/11/272607 tcpDell Connectionconnectionlast updated 2018/11/272607 udpDell Connectionconnectionlast updated 2018/11/272608 tcpWag Servicewag-servicelast updated 2018/11/272608 udpWag Servicewag-servicelast updated 2018/11/272609 tcpSystem Monitorsystem-monitorlast updated 2018/11/272609 udpSystem Monitorsystem-monitorlast updated 2018/11/272610 tcpVersaTekversa-teklast updated 2018/11/272610 udpVersaTekversa-teklast updated 2018/11/272611 tcpLIONHEADlionheadlast updated 2018/11/272611 udpLIONHEADlionheadlast updated 2018/11/272612 tcpQpasa Agentqpasa-agentlast updated 2018/11/272612 udpQpasa Agentqpasa-agentlast updated 2018/11/272613 tcpSMNTUBootstrapsmntubootstraplast updated 2018/11/272613 udpSMNTUBootstrapsmntubootstraplast updated 2018/11/272614 tcpNever Offlineneverofflinelast updated 2018/11/272614 udpNever Offlineneverofflinelast updated 2018/11/272615 tcpfirepowerfirepowerlast updated 2018/11/272615 udpfirepowerfirepowerlast updated 2018/11/272616 tcpappswitch-empappswitch-emplast updated 2018/11/272616 udpappswitch-empappswitch-emplast updated 2018/11/272617 tcpClinical Context Managerscmadminlast updated 2018/11/272617 udpClinical Context Managerscmadminlast updated 2018/11/272618 tcpPriority E-Compriority-e-comlast updated 2018/11/272618 udpPriority E-Compriority-e-comlast updated 2018/11/272619 tcpbrucebrucelast updated 2018/11/272619 udpbrucebrucelast updated 2018/11/272620 tcpLPSRecommenderlpsrecommenderlast updated 2018/11/272620 udpLPSRecommenderlpsrecommenderlast updated 2018/11/272621 tcpMiles Apart Jukebox Servermiles-apartlast updated 2018/11/272621 udpMiles Apart Jukebox Servermiles-apartlast updated 2018/11/272622 tcpMetricaDBCmetricadbclast updated 2018/11/272622 udpMetricaDBCmetricadbclast updated 2018/11/272623 tcpLMDPlmdplast updated 2018/11/272623 udpLMDPlmdplast updated 2018/11/272624 tcpAriaarialast updated 2018/11/272624 udpAriaarialast updated 2018/11/272625 tcpBlwnkl Portblwnkl-portlast updated 2018/11/272625 udpBlwnkl Portblwnkl-portlast updated 2018/11/272626 tcpgbjd816gbjd816last updated 2018/11/272626 udpgbjd816gbjd816last updated 2018/11/272627 tcpMoshe Beerimoshebeerilast updated 2018/11/272627 udpMoshe Beerimoshebeerilast updated 2018/11/272628 tcpDICTdictlast updated 2018/11/272628 udpDICTdictlast updated 2018/11/272629 tcpSitara Serversitaraserverlast updated 2018/11/272629 udpSitara Serversitaraserverlast updated 2018/11/272630 tcpSitara Managementsitaramgmtlast updated 2018/11/272630 udpSitara Managementsitaramgmtlast updated 2018/11/272631 tcpSitara Dirsitaradirlast updated 2018/11/272631 udpSitara Dirsitaradirlast updated 2018/11/272632 tcpIRdg Postirdg-postlast updated 2018/11/272632 udpIRdg Postirdg-postlast updated 2018/11/272633 tcpInterIntelliinterintellilast updated 2018/11/272633 udpInterIntelliinterintellilast updated 2018/11/272634 tcpPK Electronicspk-electronicslast updated 2018/11/272634 udpPK Electronicspk-electronicslast updated 2018/11/272635 tcpBack Burnerbackburnerlast updated 2018/11/272635 udpBack Burnerbackburnerlast updated 2018/11/272636 tcpSolvesolvelast updated 2018/11/272636 udpSolvesolvelast updated 2018/11/272637 tcpImport Document Serviceimdocsvclast updated 2018/11/272637 udpImport Document Serviceimdocsvclast updated 2018/11/272638 tcpSybase Anywheresybaseanywherelast updated 2018/11/272638 udpSybase Anywheresybaseanywherelast updated 2018/11/272639 tcpAMInetaminetlast updated 2018/11/272639 udpAMInetaminetlast updated 2018/11/272640 tcpAlcorn McBride Inc protocol used for device controlami-controllast updated 2018/11/272640 udpAlcorn McBride Inc protocol used for device controlami-controllast updated 2018/11/272641 tcpHDL Serverhdl-srvlast updated 2018/11/272641 udpHDL Serverhdl-srvlast updated 2018/11/272642 tcpTragictragiclast updated 2018/11/272642 udpTragictragiclast updated 2018/11/272643 tcpGTE-SAMPgte-samplast updated 2018/11/272643 udpGTE-SAMPgte-samplast updated 2018/11/272644 tcpTravsoft IPX Tunneltravsoft-ipx-tlast updated 2018/11/272644 udpTravsoft IPX Tunneltravsoft-ipx-tlast updated 2018/11/272645 tcpNovell IPX CMDnovell-ipx-cmdlast updated 2018/11/272645 udpNovell IPX CMDnovell-ipx-cmdlast updated 2018/11/272646 tcpAND License Managerand-lmlast updated 2018/11/272646 udpAND License Managerand-lmlast updated 2018/11/272647 tcpSyncServersyncserverlast updated 2018/11/272647 udpSyncServersyncserverlast updated 2018/11/272648 tcpUpsnotifyprotupsnotifyprotlast updated 2018/11/272648 udpUpsnotifyprotupsnotifyprotlast updated 2018/11/272649 tcpVPSIPPORTvpsipportlast updated 2018/11/272649 udpVPSIPPORTvpsipportlast updated 2018/11/272650 tcperistwogunseristwogunslast updated 2018/11/272650 udperistwogunseristwogunslast updated 2018/11/272651 tcpEBInSiteebinsitelast updated 2018/11/272651 udpEBInSiteebinsitelast updated 2018/11/272652 tcpInterPathPanelinterpathpanellast updated 2018/11/272652 udpInterPathPanelinterpathpanellast updated 2018/11/272653 tcpSonussonuslast updated 2018/11/272653 udpSonussonuslast updated 2018/11/272654 tcpCorel VNC Admin IANA assigned this well-formed service name as a replacement for "corel_vncadmin".corel-vncadminlast updated 2018/11/272654 tcp (corel_vncadmin)Corel VNC Admincorel_vncadminlast updated 2018/11/272654 udpCorel VNC Admin IANA assigned this well-formed service name as a replacement for "corel_vncadmin".corel-vncadminlast updated 2018/11/272654 udp (corel_vncadmin)Corel VNC Admincorel_vncadminlast updated 2018/11/272655 tcpUNIX Nt Glueungluelast updated 2018/11/272655 udpUNIX Nt Glueungluelast updated 2018/11/272656 tcpKanakanalast updated 2018/11/272656 udpKanakanalast updated 2018/11/272657 tcpSNS Dispatchersns-dispatcherlast updated 2018/11/272657 udpSNS Dispatchersns-dispatcherlast updated 2018/11/272658 tcpSNS Adminsns-adminlast updated 2018/11/272658 udpSNS Adminsns-adminlast updated 2018/11/272659 tcpSNS Querysns-querylast updated 2018/11/272659 udpSNS Querysns-querylast updated 2018/11/272660 tcpGC Monitorgcmonitorlast updated 2018/11/272660 udpGC Monitorgcmonitorlast updated 2018/11/272661 tcpOLHOSTolhostlast updated 2018/11/272661 udpOLHOSTolhostlast updated 2018/11/272662 tcpBinTec-CAPIbintec-capilast updated 2018/11/272662 udpBinTec-CAPIbintec-capilast updated 2018/11/272663 tcpBinTec-TAPIbintec-tapilast updated 2018/11/272663 udpBinTec-TAPIbintec-tapilast updated 2018/11/272664 tcpPatrol for MQ GMpatrol-mq-gmlast updated 2018/11/272664 udpPatrol for MQ GMpatrol-mq-gmlast updated 2018/11/272665 tcpPatrol for MQ NMpatrol-mq-nmlast updated 2018/11/272665 udpPatrol for MQ NMpatrol-mq-nmlast updated 2018/11/272666 tcpextensisextensislast updated 2018/11/272666 udpextensisextensislast updated 2018/11/272667 tcpAlarm Clock Serveralarm-clock-slast updated 2018/11/272667 udpAlarm Clock Serveralarm-clock-slast updated 2018/11/272668 tcpAlarm Clock Clientalarm-clock-clast updated 2018/11/272668 udpAlarm Clock Clientalarm-clock-clast updated 2018/11/272669 tcpTOADtoadlast updated 2018/11/272669 udpTOADtoadlast updated 2018/11/272670 tcpTVE Announcetve-announcelast updated 2018/11/272670 udpTVE Announcetve-announcelast updated 2018/11/272671 tcpnewlixregnewlixreglast updated 2018/11/272671 udpnewlixregnewlixreglast updated 2018/11/272672 tcpnhservernhserverlast updated 2018/11/272672 udpnhservernhserverlast updated 2018/11/272673 tcpFirst Call 42firstcall42last updated 2018/11/272673 udpFirst Call 42firstcall42last updated 2018/11/272674 tcpewnnewnnlast updated 2018/11/272674 udpewnnewnnlast updated 2018/11/272675 tcpTTC ETAPttc-etaplast updated 2018/11/272675 udpTTC ETAPttc-etaplast updated 2018/11/272676 tcpSIMSLinksimslinklast updated 2018/11/272676 udpSIMSLinksimslinklast updated 2018/11/272677 tcpGadget Gate 1 Waygadgetgate1waylast updated 2018/11/272677 udpGadget Gate 1 Waygadgetgate1waylast updated 2018/11/272678 tcpGadget Gate 2 Waygadgetgate2waylast updated 2018/11/272678 udpGadget Gate 2 Waygadgetgate2waylast updated 2018/11/272679 tcpSync Server SSLsyncserverssllast updated 2018/11/272679 udpSync Server SSLsyncserverssllast updated 2018/11/272680 tcppxc-sapxompxc-sapxomlast updated 2018/11/272680 udppxc-sapxompxc-sapxomlast updated 2018/11/272681 tcpmpnjsombmpnjsomblast updated 2018/11/272681 udpmpnjsombmpnjsomblast updated 2018/11/272682 RemovedN/Alast updated 2018/11/272683 tcpNCDLoadBalancencdloadbalancelast updated 2018/11/272683 udpNCDLoadBalancencdloadbalancelast updated 2018/11/272684 tcpmpnjsosvmpnjsosvlast updated 2018/11/272684 udpmpnjsosvmpnjsosvlast updated 2018/11/272685 tcpmpnjsoclmpnjsocllast updated 2018/11/272685 udpmpnjsoclmpnjsocllast updated 2018/11/272686 tcpmpnjsomgmpnjsomglast updated 2018/11/272686 udpmpnjsomgmpnjsomglast updated 2018/11/272687 tcppq-lic-mgmtpq-lic-mgmtlast updated 2018/11/272687 udppq-lic-mgmtpq-lic-mgmtlast updated 2018/11/272688 tcpmd-cf-httpmd-cg-httplast updated 2018/11/272688 udpmd-cf-httpmd-cg-httplast updated 2018/11/272689 tcpFastLynxfastlynxlast updated 2018/11/272689 udpFastLynxfastlynxlast updated 2018/11/272690 tcpHP NNM Embedded Databasehp-nnm-datalast updated 2018/11/272690 udpHP NNM Embedded Databasehp-nnm-datalast updated 2018/11/272691 tcpITInternet ISM Serveritinternetlast updated 2018/11/272691 udpITInternet ISM Serveritinternetlast updated 2018/11/272692 tcpAdmins LMSadmins-lmslast updated 2018/11/272692 udpAdmins LMSadmins-lmslast updated 2018/11/272693 tcpUnassignedN/Alast updated 2018/11/272693 udpUnassignedN/Alast updated 2018/11/272694 tcppwrseventpwrseventlast updated 2018/11/272694 udppwrseventpwrseventlast updated 2018/11/272695 tcpVSPREADvspreadlast updated 2018/11/272695 udpVSPREADvspreadlast updated 2018/11/272696 tcpUnify Adminunifyadminlast updated 2018/11/272696 udpUnify Adminunifyadminlast updated 2018/11/272697 tcpOce SNMP Trap Portoce-snmp-traplast updated 2018/11/272697 udpOce SNMP Trap Portoce-snmp-traplast updated 2018/11/272698 tcpMCK-IVPIPmck-ivpiplast updated 2018/11/272698 udpMCK-IVPIPmck-ivpiplast updated 2018/11/272699 tcpCsoft Plus Clientcsoft-plusclntlast updated 2018/11/272699 udpCsoft Plus Clientcsoft-plusclntlast updated 2018/11/272700 tcptqdatatqdatalast updated 2018/11/272700 udptqdatatqdatalast updated 2018/11/272701 tcpSMS RCINFOsms-rcinfolast updated 2018/11/272701 udpSMS RCINFOsms-rcinfolast updated 2018/11/272702 tcpSMS XFERsms-xferlast updated 2018/11/272702 udpSMS XFERsms-xferlast updated 2018/11/272703 tcpSMS CHATsms-chatlast updated 2018/11/272703 udpSMS CHATsms-chatlast updated 2018/11/272704 tcpSMS REMCTRLsms-remctrllast updated 2018/11/272704 udpSMS REMCTRLsms-remctrllast updated 2018/11/272705 tcpSDS Adminsds-adminlast updated 2018/11/272705 udpSDS Adminsds-adminlast updated 2018/11/272706 tcpNCD Mirroringncdmirroringlast updated 2018/11/272706 udpNCD Mirroringncdmirroringlast updated 2018/11/272707 tcpEMCSYMAPIPORTemcsymapiportlast updated 2018/11/272707 udpEMCSYMAPIPORTemcsymapiportlast updated 2018/11/272708 tcpBanyan-Netbanyan-netlast updated 2018/11/272708 udpBanyan-Netbanyan-netlast updated 2018/11/272709 tcpSupermonsupermonlast updated 2018/11/272709 udpSupermonsupermonlast updated 2018/11/272710 tcpSSO Servicesso-servicelast updated 2018/11/272710 udpSSO Servicesso-servicelast updated 2018/11/272711 tcpSSO Controlsso-controllast updated 2018/11/272711 udpSSO Controlsso-controllast updated 2018/11/272712 tcpAxapta Object Communication Protocolaocplast updated 2018/11/272712 udpAxapta Object Communication Protocolaocplast updated 2018/11/272713 tcpRaven Trinity Broker Serviceraventbslast updated 2018/11/272713 udpRaven Trinity Broker Serviceraventbslast updated 2018/11/272714 tcpRaven Trinity Data Moverraventdmlast updated 2018/11/272714 udpRaven Trinity Data Moverraventdmlast updated 2018/11/272715 tcpHPSTGMGR2hpstgmgr2last updated 2018/11/272715 udpHPSTGMGR2hpstgmgr2last updated 2018/11/272716 tcpInova IP Discoinova-ip-discolast updated 2018/11/272716 udpInova IP Discoinova-ip-discolast updated 2018/11/272717 tcpPN REQUESTERpn-requesterlast updated 2018/11/272717 udpPN REQUESTERpn-requesterlast updated 2018/11/272718 tcpPN REQUESTER 2pn-requester2last updated 2018/11/272718 udpPN REQUESTER 2pn-requester2last updated 2018/11/272719 tcpScan & Changescan-changelast updated 2018/11/272719 udpScan & Changescan-changelast updated 2018/11/272720 tcpwkarswkarslast updated 2018/11/272720 udpwkarswkarslast updated 2018/11/272721 tcpSmart Diagnosesmart-diagnoselast updated 2018/11/272721 udpSmart Diagnosesmart-diagnoselast updated 2018/11/272722 tcpProactive Serverproactivesrvrlast updated 2018/11/272722 udpProactive Serverproactivesrvrlast updated 2018/11/272723 tcpWatchDog NT Protocolwatchdog-ntlast updated 2018/11/272723 udpWatchDog NT Protocolwatchdog-ntlast updated 2018/11/272724 tcpqotpsqotpslast updated 2018/11/272724 udpqotpsqotpslast updated 2018/11/272725 tcpMSOLAP PTP2msolap-ptp2last updated 2018/11/272725 udpMSOLAP PTP2msolap-ptp2last updated 2018/11/272726 tcpTAMStamslast updated 2018/11/272726 udpTAMStamslast updated 2018/11/272727 tcpMedia Gateway Control Protocol Call Agentmgcp-callagentlast updated 2018/11/272727 udpMedia Gateway Control Protocol Call Agentmgcp-callagentlast updated 2018/11/272728 tcpSQDRsqdrlast updated 2018/11/272728 udpSQDRsqdrlast updated 2018/11/272729 tcpTCIM Controltcim-controllast updated 2018/11/272729 udpTCIM Controltcim-controllast updated 2018/11/272730 tcpNEC RaidPlusnec-raidpluslast updated 2018/11/272730 udpNEC RaidPlusnec-raidpluslast updated 2018/11/272731 tcpFyre Messangerfyre-messangerlast updated 2018/11/272731 udpFyre Messagnerfyre-messangerlast updated 2018/11/272732 tcpG5Mg5mlast updated 2018/11/272732 udpG5Mg5mlast updated 2018/11/272733 tcpSignet CTFsignet-ctflast updated 2018/11/272733 udpSignet CTFsignet-ctflast updated 2018/11/272734 tcpCCS Softwareccs-softwarelast updated 2018/11/272734 udpCCS Softwareccs-softwarelast updated 2018/11/272735 tcpNetIQ Monitor Consolenetiq-mclast updated 2018/11/272735 udpNetIQ Monitor Consolenetiq-mclast updated 2018/11/272736 tcpRADWIZ NMS SRVradwiz-nms-srvlast updated 2018/11/272736 udpRADWIZ NMS SRVradwiz-nms-srvlast updated 2018/11/272737 tcpSRP Feedbacksrp-feedbacklast updated 2018/11/272737 udpSRP Feedbacksrp-feedbacklast updated 2018/11/272738 tcpNDL TCP-OSI Gatewayndl-tcp-ois-gwlast updated 2018/11/272738 udpNDL TCP-OSI Gatewayndl-tcp-ois-gwlast updated 2018/11/272739 tcpTN Timingtn-timinglast updated 2018/11/272739 udpTN Timingtn-timinglast updated 2018/11/272740 tcpAlarmalarmlast updated 2018/11/272740 udpAlarmalarmlast updated 2018/11/272741 tcpTSBtsblast updated 2018/11/272741 udpTSBtsblast updated 2018/11/272742 tcpTSB2tsb2last updated 2018/11/272742 udpTSB2tsb2last updated 2018/11/272743 tcpmurxmurxlast updated 2018/11/272743 udpmurxmurxlast updated 2018/11/272744 tcphonyakuhonyakulast updated 2018/11/272744 udphonyakuhonyakulast updated 2018/11/272745 tcpURBISNETurbisnetlast updated 2018/11/272745 udpURBISNETurbisnetlast updated 2018/11/272746 tcpCPUDPENCAPcpudpencaplast updated 2018/11/272746 udpCPUDPENCAPcpudpencaplast updated 2018/11/272747 tcpfjippol-swrlylast updated 2018/11/272747 udpfjippol-swrlylast updated 2018/11/272748 tcpfjippol-polsvrlast updated 2018/11/272748 udpfjippol-polsvrlast updated 2018/11/272749 tcpfjippol-cnsllast updated 2018/11/272749 udpfjippol-cnsllast updated 2018/11/272750 tcpfjippol-port1last updated 2018/11/272750 udpfjippol-port1last updated 2018/11/272751 tcpfjippol-port2last updated 2018/11/272751 udpfjippol-port2last updated 2018/11/272752 tcpRSISYS ACCESSrsisysaccesslast updated 2018/11/272752 udpRSISYS ACCESSrsisysaccesslast updated 2018/11/272753 tcpde-spotde-spotlast updated 2018/11/272753 udpde-spotde-spotlast updated 2018/11/272754 tcpAPOLLO CCapollo-cclast updated 2018/11/272754 udpAPOLLO CCapollo-cclast updated 2018/11/272755 tcpExpress Payexpresspaylast updated 2018/11/272755 udpExpress Payexpresspaylast updated 2018/11/272756 tcpsimplement-tiesimplement-tielast updated 2018/11/272756 udpsimplement-tiesimplement-tielast updated 2018/11/272757 tcpCNRPcnrplast updated 2018/11/272757 udpCNRPcnrplast updated 2018/11/272758 tcpAPOLLO Statusapollo-statuslast updated 2018/11/272758 udpAPOLLO Statusapollo-statuslast updated 2018/11/272759 tcpAPOLLO GMSapollo-gmslast updated 2018/11/272759 udpAPOLLO GMSapollo-gmslast updated 2018/11/272760 tcpSaba MSsabamslast updated 2018/11/272760 udpSaba MSsabamslast updated 2018/11/272761 tcpDICOM ISCLdicom-iscllast updated 2018/11/272761 udpDICOM ISCLdicom-iscllast updated 2018/11/272762 tcpDICOM TLSdicom-tlslast updated 2018/11/272762 udpDICOM TLSdicom-tlslast updated 2018/11/272763 tcpDesktop DNAdesktop-dnalast updated 2018/11/272763 udpDesktop DNAdesktop-dnalast updated 2018/11/272764 tcpData Insurancedata-insurancelast updated 2018/11/272764 udpData Insurancedata-insurancelast updated 2018/11/272765 tcpqip-audupqip-auduplast updated 2018/11/272765 udpqip-audupqip-auduplast updated 2018/11/272766 tcpCompaq SCPcompaq-scplast updated 2018/11/272766 udpCompaq SCPcompaq-scplast updated 2018/11/272767 tcpUADTCuadtclast updated 2018/11/272767 udpUADTCuadtclast updated 2018/11/272768 tcpUACSuacslast updated 2018/11/272768 udpUACSuacslast updated 2018/11/272769 tcpeXcEexcelast updated 2018/11/272769 udpeXcEexcelast updated 2018/11/272770 tcpVeronicaveronicalast updated 2018/11/272770 udpVeronicaveronicalast updated 2018/11/272771 tcpVergence CMvergencecmlast updated 2018/11/272771 udpVergence CMvergencecmlast updated 2018/11/272772 tcpaurisaurislast updated 2018/11/272772 udpaurisaurislast updated 2018/11/272773 tcpRBackup Remote Backuprbakcup1last updated 2018/11/272773 udpRBackup Remote Backuprbakcup1last updated 2018/11/272774 tcpRBackup Remote Backuprbakcup2last updated 2018/11/272774 udpRBackup Remote Backuprbakcup2last updated 2018/11/272775 tcpSMPPsmpplast updated 2018/11/272775 udpSMPPsmpplast updated 2018/11/272776 tcpRidgeway Systems & Softwareridgeway1last updated 2018/11/272776 udpRidgeway Systems & Softwareridgeway1last updated 2018/11/272777 tcpRidgeway Systems & Softwareridgeway2last updated 2018/11/272777 udpRidgeway Systems & Softwareridgeway2last updated 2018/11/272778 tcpGwen-Sonyagwen-sonyalast updated 2018/11/272778 udpGwen-Sonyagwen-sonyalast updated 2018/11/272779 tcpLBC Synclbc-synclast updated 2018/11/272779 udpLBC Synclbc-synclast updated 2018/11/272780 tcpLBC Controllbc-controllast updated 2018/11/272780 udpLBC Controllbc-controllast updated 2018/11/272781 tcpwhosellswhosellslast updated 2018/11/272781 udpwhosellswhosellslast updated 2018/11/272782 tcpeverydayrceverydayrclast updated 2018/11/272782 udpeverydayrceverydayrclast updated 2018/11/272783 tcpAISESaiseslast updated 2018/11/272783 udpAISESaiseslast updated 2018/11/272784 tcpworld wide web - developmentwww-devlast updated 2018/11/272784 udpworld wide web - developmentwww-devlast updated 2018/11/272785 tcpaic-npaic-nplast updated 2018/11/272785 udpaic-npaic-nplast updated 2018/11/272786 tcpaic-oncrpc - Destiny MCD databaseaic-oncrpclast updated 2018/11/272786 udpaic-oncrpc - Destiny MCD databaseaic-oncrpclast updated 2018/11/272787 tcppiccolo - Cornerstone Softwarepiccololast updated 2018/11/272787 udppiccolo - Cornerstone Softwarepiccololast updated 2018/11/272788 tcpNetWare Loadable Module - Seagate Softwarefryeservlast updated 2018/11/272788 udpNetWare Loadable Module - Seagate Softwarefryeservlast updated 2018/11/272789 tcpMedia Agentmedia-agentlast updated 2018/11/272789 udpMedia Agentmedia-agentlast updated 2018/11/272790 tcpPLG Proxyplgproxylast updated 2018/11/272790 udpPLG Proxyplgproxylast updated 2018/11/272791 tcpMT Port Registratormtport-registlast updated 2018/11/272791 udpMT Port Registratormtport-registlast updated 2018/11/272792 tcpf5-globalsitef5-globalsitelast updated 2018/11/272792 udpf5-globalsitef5-globalsitelast updated 2018/11/272793 tcpinitlsmsadinitlsmsadlast updated 2018/11/272793 udpinitlsmsadinitlsmsadlast updated 2018/11/272794 UnassignedN/Alast updated 2018/11/272795 tcpLiveStatslivestatslast updated 2018/11/272795 udpLiveStatslivestatslast updated 2018/11/272796 tcpac-techac-techlast updated 2018/11/272796 udpac-techac-techlast updated 2018/11/272797 tcpesp-encapesp-encaplast updated 2018/11/272797 udpesp-encapesp-encaplast updated 2018/11/272798 tcpTMESIS-UPShottmesis-upshotlast updated 2018/11/272798 udpTMESIS-UPShottmesis-upshotlast updated 2018/11/272799 tcpICON Discovericon-discoverlast updated 2018/11/272799 udpICON Discovericon-discoverlast updated 2018/11/272800 tcpACC RAIDacc-raidlast updated 2018/11/272800 udpACC RAIDacc-raidlast updated 2018/11/272801 tcpIGCPigcplast updated 2018/11/272801 udpIGCPigcplast updated 2018/11/272802 tcpVeritas TCP1veritas-tcp1last updated 2018/11/272802 udpVeritas UDP1veritas-udp1last updated 2018/11/272803 tcpbtprjctrlbtprjctrllast updated 2018/11/272803 udpbtprjctrlbtprjctrllast updated 2018/11/272804 tcpMarch Networks Digital Video Recorders and Enterprise Service Manager productsdvr-esmlast updated 2018/11/272804 udpMarch Networks Digital Video Recorders and Enterprise Service Manager productsdvr-esmlast updated 2018/11/272805 tcpWTA WSP-Swta-wsp-slast updated 2018/11/272805 udpWTA WSP-Swta-wsp-slast updated 2018/11/272806 tcpcspunicspunilast updated 2018/11/272806 udpcspunicspunilast updated 2018/11/272807 tcpcspmulticspmultilast updated 2018/11/272807 udpcspmulticspmultilast updated 2018/11/272808 tcpJ-LAN-Pj-lan-plast updated 2018/11/272808 udpJ-LAN-Pj-lan-plast updated 2018/11/272809 tcpCORBA LOCcorbaloclast updated 2018/11/272809 udpCORBA LOCcorbaloclast updated 2018/11/272810 tcpActive Net Stewardnetstewardlast updated 2018/11/272810 udpActive Net Stewardnetstewardlast updated 2018/11/272811 tcpGSI FTPgsiftplast updated 2018/11/272811 udpGSI FTPgsiftplast updated 2018/11/272812 tcpatmtcpatmtcplast updated 2018/11/272812 udpatmtcpatmtcplast updated 2018/11/272813 tcpllm-passllm-passlast updated 2018/11/272813 udpllm-passllm-passlast updated 2018/11/272814 tcpllm-csvllm-csvlast updated 2018/11/272814 udpllm-csvllm-csvlast updated 2018/11/272815 tcpLBC Measurementlbc-measurelast updated 2018/11/272815 udpLBC Measurementlbc-measurelast updated 2018/11/272816 tcpLBC Watchdoglbc-watchdoglast updated 2018/11/272816 udpLBC Watchdoglbc-watchdoglast updated 2018/11/272817 tcpNMSig Portnmsigportlast updated 2018/11/272817 udpNMSig Portnmsigportlast updated 2018/11/272818 tcprmlnkrmlnklast updated 2018/11/272818 udprmlnkrmlnklast updated 2018/11/272819 tcpFC Fault Notificationfc-faultnotifylast updated 2018/11/272819 udpFC Fault Notificationfc-faultnotifylast updated 2018/11/272820 tcpUniVisionunivisionlast updated 2018/11/272820 udpUniVisionunivisionlast updated 2018/11/272821 tcpVERITAS Authentication Servicevrts-at-portlast updated 2018/11/272821 udpVERITAS Authentication Servicevrts-at-portlast updated 2018/11/272822 tcpka0wucka0wuclast updated 2018/11/272822 udpka0wucka0wuclast updated 2018/11/272823 tcpCQG Net/LANcqg-netlanlast updated 2018/11/272823 udpCQG Net/LANcqg-netlanlast updated 2018/11/272824 tcpCQG Net/LAN 1cqg-netlan-1last updated 2018/11/272824 udpCQG Net/Lan 1cqg-netlan-1last updated 2018/11/272825 (unassigned) Possibly assignedN/Alast updated 2018/11/272826 tcpslc systemlogslc-systemloglast updated 2018/11/272826 udpslc systemlogslc-systemloglast updated 2018/11/272827 tcpslc ctrlrloopsslc-ctrlrloopslast updated 2018/11/272827 udpslc ctrlrloopsslc-ctrlrloopslast updated 2018/11/272828 tcpITM License Manageritm-lmlast updated 2018/11/272828 udpITM License Manageritm-lmlast updated 2018/11/272829 tcpsilkp1silkp1last updated 2018/11/272829 udpsilkp1silkp1last updated 2018/11/272830 tcpsilkp2silkp2last updated 2018/11/272830 udpsilkp2silkp2last updated 2018/11/272831 tcpsilkp3silkp3last updated 2018/11/272831 udpsilkp3silkp3last updated 2018/11/272832 tcpsilkp4silkp4last updated 2018/11/272832 udpsilkp4silkp4last updated 2018/11/272833 tcpglishdglishdlast updated 2018/11/272833 udpglishdglishdlast updated 2018/11/272834 tcpEVTPevtplast updated 2018/11/272834 udpEVTPevtplast updated 2018/11/272835 tcpEVTP-DATAevtp-datalast updated 2018/11/272835 udpEVTP-DATAevtp-datalast updated 2018/11/272836 tcpcatalystcatalystlast updated 2018/11/272836 udpcatalystcatalystlast updated 2018/11/272837 tcpRepliwebrepliweblast updated 2018/11/272837 udpRepliwebrepliweblast updated 2018/11/272838 tcpStarbotstarbotlast updated 2018/11/272838 udpStarbotstarbotlast updated 2018/11/272839 tcpNMSigPortnmsigportlast updated 2018/11/272839 udpNMSigPortnmsigportlast updated 2018/11/272840 tcpl3-exprtl3-exprtlast updated 2018/11/272840 udpl3-exprtl3-exprtlast updated 2018/11/272841 tcpl3-rangerl3-rangerlast updated 2018/11/272841 udpl3-rangerl3-rangerlast updated 2018/11/272842 tcpl3-hawkl3-hawklast updated 2018/11/272842 udpl3-hawkl3-hawklast updated 2018/11/272843 tcpPDnetpdnetlast updated 2018/11/272843 udpPDnetpdnetlast updated 2018/11/272844 tcpBPCP POLLbpcp-polllast updated 2018/11/272844 udpBPCP POLLbpcp-polllast updated 2018/11/272845 tcpBPCP TRAPbpcp-traplast updated 2018/11/272845 udpBPCP TRAPbpcp-traplast updated 2018/11/272846 tcpAIMPP Helloaimpp-hellolast updated 2018/11/272846 udpAIMPP Helloaimpp-hellolast updated 2018/11/272847 tcpAIMPP Port Reqaimpp-port-reqlast updated 2018/11/272847 udpAIMPP Port Reqaimpp-port-reqlast updated 2018/11/272848 tcpAMT-BLC-PORTamt-blc-portlast updated 2018/11/272848 udpAMT-BLC-PORTamt-blc-portlast updated 2018/11/272849 tcpFXPfxplast updated 2018/11/272849 udpFXPfxplast updated 2018/11/272850 tcpMetaConsolemetaconsolelast updated 2018/11/272850 udpMetaConsolemetaconsolelast updated 2018/11/272851 tcpwebemshttpwebemshttplast updated 2018/11/272851 udpwebemshttpwebemshttplast updated 2018/11/272852 tcpbears-01bears-01last updated 2018/11/272852 udpbears-01bears-01last updated 2018/11/272853 tcpISPipesispipeslast updated 2018/11/272853 udpISPipesispipeslast updated 2018/11/272854 tcpInfoMoverinfomoverlast updated 2018/11/272854 udpInfoMoverinfomoverlast updated 2018/11/272855 tcpMSRP over TCPmsrplast updated 2018/11/272855 udpReservedN/Alast updated 2018/11/272856 tcpcesdinvcesdinvlast updated 2018/11/272856 udpcesdinvcesdinvlast updated 2018/11/272857 tcpSimCtIPsimctlplast updated 2018/11/272857 udpSimCtIPsimctlplast updated 2018/11/272858 tcpECNPecnplast updated 2018/11/272858 udpECNPecnplast updated 2018/11/272859 tcpActive Memoryactivememorylast updated 2018/11/272859 udpActive Memoryactivememorylast updated 2018/11/272860 tcpDialpad Voice 1dialpad-voice1last updated 2018/11/272860 udpDialpad Voice 1dialpad-voice1last updated 2018/11/272861 tcpDialpad Voice 2dialpad-voice2last updated 2018/11/272861 udpDialpad Voice 2dialpad-voice2last updated 2018/11/272862 tcpTTG Protocolttg-protocollast updated 2018/11/272862 udpTTG Protocolttg-protocollast updated 2018/11/272863 tcpSonar Datasonardatalast updated 2018/11/272863 udpSonar Datasonardatalast updated 2018/11/272864 tcpmain 5001 cmdastromed-mainlast updated 2018/11/272864 udpmain 5001 cmdastromed-mainlast updated 2018/11/272865 tcppit-vpnpit-vpnlast updated 2018/11/272865 udppit-vpnpit-vpnlast updated 2018/11/272866 tcpiwlisteneriwlistenerlast updated 2018/11/272866 udpiwlisteneriwlistenerlast updated 2018/11/272867 tcpesps-portalesps-portallast updated 2018/11/272867 udpesps-portalesps-portallast updated 2018/11/272868 tcpNorman Proprietaqry Events Protocolnpep-messaginglast updated 2018/11/272868 udpNorman Proprietaqry Events Protocolnpep-messaginglast updated 2018/11/272869 tcpICSLAPicslaplast updated 2018/11/272869 udpICSLAPicslaplast updated 2018/11/272870 tcpdaishidaishilast updated 2018/11/272870 udpdaishidaishilast updated 2018/11/272871 tcpMSI Select Playmsi-selectplaylast updated 2018/11/272871 udpMSI Select Playmsi-selectplaylast updated 2018/11/272872 tcpRADIXradixlast updated 2018/11/272872 udpRADIXradixlast updated 2018/11/272873 UnassignedN/Alast updated 2018/11/272874 tcpDX Message Base Transport Protocoldxmessagebase1last updated 2018/11/272874 udpDX Message Base Transport Protocoldxmessagebase1last updated 2018/11/272875 tcpDX Message Base Transport Protocoldxmessagebase2last updated 2018/11/272875 udpDX Message Base Transport Protocoldxmessagebase2last updated 2018/11/272876 tcpSPS Tunnelsps-tunnellast updated 2018/11/272876 udpSPS Tunnelsps-tunnellast updated 2018/11/272877 tcpBLUELANCEbluelancelast updated 2018/11/272877 udpBLUELANCEbluelancelast updated 2018/11/272878 tcpAAPaaplast updated 2018/11/272878 udpAAPaaplast updated 2018/11/272879 tcpucentric-dsucentric-dslast updated 2018/11/272879 udpucentric-dsucentric-dslast updated 2018/11/272880 tcpSynapse Transportsynapselast updated 2018/11/272880 udpSynapse Transportsynapselast updated 2018/11/272881 tcpNDSPndsplast updated 2018/11/272881 udpNDSPndsplast updated 2018/11/272882 tcpNDTPndtplast updated 2018/11/272882 udpNDTPndtplast updated 2018/11/272883 tcpNDNPndnplast updated 2018/11/272883 udpNDNPndnplast updated 2018/11/272884 tcpFlash Msgflashmsglast updated 2018/11/272884 udpFlash Msgflashmsglast updated 2018/11/272885 tcpTopFlowtopflowlast updated 2018/11/272885 udpTopFlowtopflowlast updated 2018/11/272886 tcpRESPONSELOGICresponselogiclast updated 2018/11/272886 udpRESPONSELOGICresponselogiclast updated 2018/11/272887 tcpaironetaironetddplast updated 2018/11/272887 udpaironetaironetddplast updated 2018/11/272888 tcpSPCSDLOBBYspcsdlobbylast updated 2018/11/272888 udpSPCSDLOBBYspcsdlobbylast updated 2018/11/272889 tcpRSOMrsomlast updated 2018/11/272889 udpRSOMrsomlast updated 2018/11/272890 tcpCSPCLMULTIcspclmultilast updated 2018/11/272890 udpCSPCLMULTIcspclmultilast updated 2018/11/272891 tcpCINEGRFX-ELMD License Managercinegrfx-elmdlast updated 2018/11/272891 udpCINEGRFX-ELMD License Managercinegrfx-elmdlast updated 2018/11/272892 tcpSNIFFERDATAsnifferdatalast updated 2018/11/272892 udpSNIFFERDATAsnifferdatalast updated 2018/11/272893 tcpVSECONNECTORvseconnectorlast updated 2018/11/272893 udpVSECONNECTORvseconnectorlast updated 2018/11/272894 tcpABACUS-REMOTEabacus-remotelast updated 2018/11/272894 udpABACUS-REMOTEabacus-remotelast updated 2018/11/272895 tcpNATUS LINKnatuslinklast updated 2018/11/272895 udpNATUS LINKnatuslinklast updated 2018/11/272896 tcpECOVISIONG6-1ecovisiong6-1last updated 2018/11/272896 udpECOVISIONG6-1ecovisiong6-1last updated 2018/11/272897 tcpCitrix RTMPcitrix-rtmplast updated 2018/11/272897 udpCitrix RTMPcitrix-rtmplast updated 2018/11/272898 tcpAPPLIANCE-CFGappliance-cfglast updated 2018/11/272898 udpAPPLIANCE-CFGappliance-cfglast updated 2018/11/272899 tcpPOWERGEMPLUSpowergempluslast updated 2018/11/272899 udpPOWERGEMPLUSpowergempluslast updated 2018/11/272900 tcpQUICKSUITEquicksuitelast updated 2018/11/272900 udpQUICKSUITEquicksuitelast updated 2018/11/272901 tcpALLSTORCNSallstorcnslast updated 2018/11/272901 udpALLSTORCNSallstorcnslast updated 2018/11/272902 tcpNET ASPInetaspilast updated 2018/11/272902 udpNET ASPInetaspilast updated 2018/11/272903 tcpSUITCASEsuitcaselast updated 2018/11/272903 udpSUITCASEsuitcaselast updated 2018/11/272904 tcpM2UAm2ualast updated 2018/11/272904 udpM2UAm2ualast updated 2018/11/272904 sctpM2UAm2ualast updated 2018/11/272905 tcpM3UAm3ualast updated 2018/11/272905 udpDe-registeredN/Alast updated 2018/11/272905 sctpM3UAm3ualast updated 2018/11/272906 tcpCALLER9caller9last updated 2018/11/272906 udpCALLER9caller9last updated 2018/11/272907 tcpWEBMETHODS B2Bwebmethods-b2blast updated 2018/11/272907 udpWEBMETHODS B2Bwebmethods-b2blast updated 2018/11/272908 tcpmaomaolast updated 2018/11/272908 udpmaomaolast updated 2018/11/272909 tcpFunk Dialoutfunk-dialoutlast updated 2018/11/272909 udpFunk Dialoutfunk-dialoutlast updated 2018/11/272910 tcpTDAccesstdaccesslast updated 2018/11/272910 udpTDAccesstdaccesslast updated 2018/11/272911 tcpBlockadeblockadelast updated 2018/11/272911 udpBlockadeblockadelast updated 2018/11/272912 tcpEpiconepiconlast updated 2018/11/272912 udpEpiconepiconlast updated 2018/11/272913 tcpBooster Wareboosterwarelast updated 2018/11/272913 udpBooster Wareboosterwarelast updated 2018/11/272914 tcpGame Lobbygamelobbylast updated 2018/11/272914 udpGame Lobbygamelobbylast updated 2018/11/272915 tcpTK Sockettksocketlast updated 2018/11/272915 udpTK Sockettksocketlast updated 2018/11/272916 tcpElvin Server IANA assigned this well-formed service name as a replacement for "elvin_server".elvin-serverlast updated 2018/11/272916 tcp (elvin_server)Elvin Serverelvin_serverlast updated 2018/11/272916 udpElvin Server IANA assigned this well-formed service name as a replacement for "elvin_server".elvin-serverlast updated 2018/11/272916 udp (elvin_server)Elvin Serverelvin_serverlast updated 2018/11/272917 tcpElvin Client IANA assigned this well-formed service name as a replacement for "elvin_client".elvin-clientlast updated 2018/11/272917 tcp (elvin_client)Elvin Clientelvin_clientlast updated 2018/11/272917 udpElvin Client IANA assigned this well-formed service name as a replacement for "elvin_client".elvin-clientlast updated 2018/11/272917 udp (elvin_client)Elvin Clientelvin_clientlast updated 2018/11/272918 tcpKasten Chase Padkastenchasepadlast updated 2018/11/272918 udpKasten Chase Padkastenchasepadlast updated 2018/11/272919 tcproboERroboerlast updated 2018/11/272919 udproboERroboerlast updated 2018/11/272920 tcproboEDAroboedalast updated 2018/11/272920 udproboEDAroboedalast updated 2018/11/272921 tcpCESD Contents Delivery Managementcesdcdmanlast updated 2018/11/272921 udpCESD Contents Delivery Managementcesdcdmanlast updated 2018/11/272922 tcpCESD Contents Delivery Data Transfercesdcdtrnlast updated 2018/11/272922 udpCESD Contents Delivery Data Transfercesdcdtrnlast updated 2018/11/272923 tcpWTA-WSP-WTP-Swta-wsp-wtp-slast updated 2018/11/272923 udpWTA-WSP-WTP-Swta-wsp-wtp-slast updated 2018/11/272924 tcpPRECISE-VIPprecise-viplast updated 2018/11/272924 udpPRECISE-VIPprecise-viplast updated 2018/11/272925 Unassigned (FRP-Released 12/7/00)N/Alast updated 2018/11/272926 tcpMOBILE-FILE-DLmobile-file-dllast updated 2018/11/272926 udpMOBILE-FILE-DLmobile-file-dllast updated 2018/11/272927 tcpUNIMOBILECTRLunimobilectrllast updated 2018/11/272927 udpUNIMOBILECTRLunimobilectrllast updated 2018/11/272928 tcpREDSTONE-CPSSredstone-cpsslast updated 2018/11/272928 udpREDSTONE-CPSSredstone-cpsslast updated 2018/11/272929 tcpAMX-WEBADMINamx-webadminlast updated 2018/11/272929 udpAMX-WEBADMINamx-webadminlast updated 2018/11/272930 tcpAMX-WEBLINXamx-weblinxlast updated 2018/11/272930 udpAMX-WEBLINXamx-weblinxlast updated 2018/11/272931 tcpCircle-Xcircle-xlast updated 2018/11/272931 udpCircle-Xcircle-xlast updated 2018/11/272932 tcpINCPincplast updated 2018/11/272932 udpINCPincplast updated 2018/11/272933 tcp4-TIER OPM GW4-tieropmgwlast updated 2018/11/272933 udp4-TIER OPM GW4-tieropmgwlast updated 2018/11/272934 tcp4-TIER OPM CLI4-tieropmclilast updated 2018/11/272934 udp4-TIER OPM CLI4-tieropmclilast updated 2018/11/272935 tcpQTPqtplast updated 2018/11/272935 udpQTPqtplast updated 2018/11/272936 tcpOTPatchotpatchlast updated 2018/11/272936 udpOTPatchotpatchlast updated 2018/11/272937 tcpPNACONSULT-LMpnaconsult-lmlast updated 2018/11/272937 udpPNACONSULT-LMpnaconsult-lmlast updated 2018/11/272938 tcpSM-PAS-1sm-pas-1last updated 2018/11/272938 udpSM-PAS-1sm-pas-1last updated 2018/11/272939 tcpSM-PAS-2sm-pas-2last updated 2018/11/272939 udpSM-PAS-2sm-pas-2last updated 2018/11/272940 tcpSM-PAS-3sm-pas-3last updated 2018/11/272940 udpSM-PAS-3sm-pas-3last updated 2018/11/272941 tcpSM-PAS-4sm-pas-4last updated 2018/11/272941 udpSM-PAS-4sm-pas-4last updated 2018/11/272942 tcpSM-PAS-5sm-pas-5last updated 2018/11/272942 udpSM-PAS-5sm-pas-5last updated 2018/11/272943 tcpTTNRepositoryttnrepositorylast updated 2018/11/272943 udpTTNRepositoryttnrepositorylast updated 2018/11/272944 tcpMegaco H-248megaco-h248last updated 2018/11/272944 udpMegaco H-248megaco-h248last updated 2018/11/272944 sctpMegaco-H.248 textmegaco-h248last updated 2018/11/272945 tcpH248 Binaryh248-binarylast updated 2018/11/272945 udpH248 Binaryh248-binarylast updated 2018/11/272945 sctpMegaco/H.248 binaryh248-binarylast updated 2018/11/272946 tcpFJSVmporfjsvmporlast updated 2018/11/272946 udpFJSVmporfjsvmporlast updated 2018/11/272947 tcpGPS Daemon request/response protocolgpsdlast updated 2018/11/272947 udpGPS Daemon request/response protocolgpsdlast updated 2018/11/272948 tcpWAP PUSHwap-pushlast updated 2018/11/272948 udpWAP PUSHwap-pushlast updated 2018/11/272949 tcpWAP PUSH SECUREwap-pushsecurelast updated 2018/11/272949 udpWAP PUSH SECUREwap-pushsecurelast updated 2018/11/272950 tcpESIPesiplast updated 2018/11/272950 udpESIPesiplast updated 2018/11/272951 tcpOTTPottplast updated 2018/11/272951 udpOTTPottplast updated 2018/11/272952 tcpMPFWSASmpfwsaslast updated 2018/11/272952 udpMPFWSASmpfwsaslast updated 2018/11/272953 tcpOVALARMSRVovalarmsrvlast updated 2018/11/272953 udpOVALARMSRVovalarmsrvlast updated 2018/11/272954 tcpOVALARMSRV-CMDovalarmsrv-cmdlast updated 2018/11/272954 udpOVALARMSRV-CMDovalarmsrv-cmdlast updated 2018/11/272955 tcpCSNOTIFYcsnotifylast updated 2018/11/272955 udpCSNOTIFYcsnotifylast updated 2018/11/272956 tcpOVRIMOSDBMANovrimosdbmanlast updated 2018/11/272956 udpOVRIMOSDBMANovrimosdbmanlast updated 2018/11/272957 tcpJAMCT5jmact5last updated 2018/11/272957 udpJAMCT5jmact5last updated 2018/11/272958 tcpJAMCT6jmact6last updated 2018/11/272958 udpJAMCT6jmact6last updated 2018/11/272959 tcpRMOPAGTrmopagtlast updated 2018/11/272959 udpRMOPAGTrmopagtlast updated 2018/11/272960 tcpDFOXSERVERdfoxserverlast updated 2018/11/272960 udpDFOXSERVERdfoxserverlast updated 2018/11/272961 tcpBOLDSOFT-LMboldsoft-lmlast updated 2018/11/272961 udpBOLDSOFT-LMboldsoft-lmlast updated 2018/11/272962 tcpIPH-POLICY-CLIiph-policy-clilast updated 2018/11/272962 udpIPH-POLICY-CLIiph-policy-clilast updated 2018/11/272963 tcpIPH-POLICY-ADMiph-policy-admlast updated 2018/11/272963 udpIPH-POLICY-ADMiph-policy-admlast updated 2018/11/272964 tcpBULLANT SRAPbullant-sraplast updated 2018/11/272964 udpBULLANT SRAPbullant-sraplast updated 2018/11/272965 tcpBULLANT RAPbullant-raplast updated 2018/11/272965 udpBULLANT RAPbullant-raplast updated 2018/11/272966 tcpIDP-INFOTRIEVEidp-infotrievelast updated 2018/11/272966 udpIDP-INFOTRIEVEidp-infotrievelast updated 2018/11/272967 tcpSSC-AGENTssc-agentlast updated 2018/11/272967 udpSSC-AGENTssc-agentlast updated 2018/11/272968 tcpENPPenpplast updated 2018/11/272968 udpENPPenpplast updated 2018/11/272969 tcpESSPessplast updated 2018/11/272969 udpESSPessplast updated 2018/11/272970 tcpINDEX-NETindex-netlast updated 2018/11/272970 udpINDEX-NETindex-netlast updated 2018/11/272971 tcpNetClip clipboard daemonnetcliplast updated 2018/11/272971 udpNetClip clipboard daemonnetcliplast updated 2018/11/272972 tcpPMSM Webrctlpmsm-webrctllast updated 2018/11/272972 udpPMSM Webrctlpmsm-webrctllast updated 2018/11/272973 tcpSV Networkssvnetworkslast updated 2018/11/272973 udpSV Networkssvnetworkslast updated 2018/11/272974 tcpSignalsignallast updated 2018/11/272974 udpSignalsignallast updated 2018/11/272975 tcpFujitsu Configuration Management Servicefjmpcmlast updated 2018/11/272975 udpFujitsu Configuration Management Servicefjmpcmlast updated 2018/11/272976 tcpCNS Server Portcns-srv-portlast updated 2018/11/272976 udpCNS Server Portcns-srv-portlast updated 2018/11/272977 tcpTTCs Enterprise Test Access Protocol - NSttc-etap-nslast updated 2018/11/272977 udpTTCs Enterprise Test Access Protocol - NSttc-etap-nslast updated 2018/11/272978 tcpTTCs Enterprise Test Access Protocol - DSttc-etap-dslast updated 2018/11/272978 udpTTCs Enterprise Test Access Protocol - DSttc-etap-dslast updated 2018/11/272979 tcpH.263 Video Streamingh263-videolast updated 2018/11/272979 udpH.263 Video Streamingh263-videolast updated 2018/11/272980 tcpInstant Messaging Servicewimdlast updated 2018/11/272980 udpInstant Messaging Servicewimdlast updated 2018/11/272981 tcpMYLXAMPORTmylxamportlast updated 2018/11/272981 udpMYLXAMPORTmylxamportlast updated 2018/11/272982 tcpIWB-WHITEBOARDiwb-whiteboardlast updated 2018/11/272982 udpIWB-WHITEBOARDiwb-whiteboardlast updated 2018/11/272983 tcpNETPLANnetplanlast updated 2018/11/272983 udpNETPLANnetplanlast updated 2018/11/272984 tcpHPIDSADMINhpidsadminlast updated 2018/11/272984 udpHPIDSADMINhpidsadminlast updated 2018/11/272985 tcpHPIDSAGENThpidsagentlast updated 2018/11/272985 udpHPIDSAGENThpidsagentlast updated 2018/11/272986 tcpSTONEFALLSstonefallslast updated 2018/11/272986 udpSTONEFALLSstonefallslast updated 2018/11/272987 tcpidentifyidentifylast updated 2018/11/272987 udpidentifyidentifylast updated 2018/11/272988 tcpHIPPA Reporting Protocolhippadlast updated 2018/11/272988 udpHIPPA Reporting Protocolhippadlast updated 2018/11/272989 tcpZARKOV Intelligent Agent Communicationzarkovlast updated 2018/11/272989 udpZARKOV Intelligent Agent Communicationzarkovlast updated 2018/11/272990 tcpBOSCAPboscaplast updated 2018/11/272990 udpBOSCAPboscaplast updated 2018/11/272991 tcpWKSTN-MONwkstn-monlast updated 2018/11/272991 udpWKSTN-MONwkstn-monlast updated 2018/11/272992 tcpAvenyo Serveravenyolast updated 2018/11/272992 udpAvenyo Serveravenyolast updated 2018/11/272993 tcpVERITAS VIS1veritas-vis1last updated 2018/11/272993 udpVERITAS VIS1veritas-vis1last updated 2018/11/272994 tcpVERITAS VIS2veritas-vis2last updated 2018/11/272994 udpVERITAS VIS2veritas-vis2last updated 2018/11/272995 tcpIDRSidrslast updated 2018/11/272995 udpIDRSidrslast updated 2018/11/272996 tcpvsixmlvsixmllast updated 2018/11/272996 udpvsixmlvsixmllast updated 2018/11/272997 tcpREBOLrebollast updated 2018/11/272997 udpREBOLrebollast updated 2018/11/272998 tcpReal Securerealsecurelast updated 2018/11/272998 udpReal Securerealsecurelast updated 2018/11/272999 tcpRemoteWare Unassignedremoteware-unlast updated 2018/11/272999 udpRemoteWare Unassignedremoteware-unlast updated 2018/11/273000 tcpHBCIhbcilast updated 2018/11/273000 udpHBCIhbcilast updated 2018/11/273000 tcp (remoteware-cl)RemoteWare Clientremoteware-cllast updated 2018/11/273000 udp (remoteware-cl)RemoteWare Clientremoteware-cllast updated 2018/11/273001 tcpOrigoDB Server Native Interfaceorigo-nativelast updated 2018/11/273001 udpReservedN/Alast updated 2018/11/273002 tcpEXLM Agentexlm-agentlast updated 2018/11/273002 udpEXLM Agentexlm-agentlast updated 2018/11/273002 tcp (remoteware-srv)RemoteWare Serverremoteware-srvlast updated 2018/11/273002 udp (remoteware-srv)RemoteWare Serverremoteware-srvlast updated 2018/11/273003 tcpCGMScgmslast updated 2018/11/273003 udpCGMScgmslast updated 2018/11/273004 tcpCsoft Agentcsoftragentlast updated 2018/11/273004 udpCsoft Agentcsoftragentlast updated 2018/11/273005 tcpGenius License Managergeniuslmlast updated 2018/11/273005 udpGenius License Managergeniuslmlast updated 2018/11/273006 tcpInstant Internet Adminii-adminlast updated 2018/11/273006 udpInstant Internet Adminii-adminlast updated 2018/11/273007 tcpLotus Mail Tracking Agent Protocollotusmtaplast updated 2018/11/273007 udpLotus Mail Tracking Agent Protocollotusmtaplast updated 2018/11/273008 tcpMidnight Technologiesmidnight-techlast updated 2018/11/273008 udpMidnight Technologiesmidnight-techlast updated 2018/11/273009 tcpPXC-NTFYpxc-ntfylast updated 2018/11/273009 udpPXC-NTFYpxc-ntfylast updated 2018/11/273010 tcpTelerate Workstationgwlast updated 2018/11/273010 udpTelerate Workstationping-ponglast updated 2018/11/273011 tcpTrusted Webtrusted-weblast updated 2018/11/273011 udpTrusted Webtrusted-weblast updated 2018/11/273012 tcpTrusted Web Clienttwsdsslast updated 2018/11/273012 udpTrusted Web Clienttwsdsslast updated 2018/11/273013 tcpGilat Sky Surfergilatskysurferlast updated 2018/11/273013 udpGilat Sky Surfergilatskysurferlast updated 2018/11/273014 tcpBroker Service IANA assigned this well-formed service name as a replacement for "broker_service".broker-servicelast updated 2018/11/273014 tcp (broker_service)Broker Servicebroker_servicelast updated 2018/11/273014 udpBroker Service IANA assigned this well-formed service name as a replacement for "broker_service".broker-servicelast updated 2018/11/273014 udp (broker_service)Broker Servicebroker_servicelast updated 2018/11/273015 tcpNATI DSTPnati-dstplast updated 2018/11/273015 udpNATI DSTPnati-dstplast updated 2018/11/273016 tcpNotify Server IANA assigned this well-formed service name as a replacement for "notify_srvr".notify-srvrlast updated 2018/11/273016 tcp (notify_srvr)Notify Servernotify_srvrlast updated 2018/11/273016 udpNotify Server IANA assigned this well-formed service name as a replacement for "notify_srvr".notify-srvrlast updated 2018/11/273016 udp (notify_srvr)Notify Servernotify_srvrlast updated 2018/11/273017 tcpEvent Listener IANA assigned this well-formed service name as a replacement for "event_listener".event-listenerlast updated 2018/11/273017 tcp (event_listener)Event Listenerevent_listenerlast updated 2018/11/273017 udpEvent Listener IANA assigned this well-formed service name as a replacement for "event_listener".event-listenerlast updated 2018/11/273017 udp (event_listener)Event Listenerevent_listenerlast updated 2018/11/273018 tcpService Registry IANA assigned this well-formed service name as a replacement for "srvc_registry".srvc-registrylast updated 2018/11/273018 tcp (srvc_registry)Service Registrysrvc_registrylast updated 2018/11/273018 udpService Registry IANA assigned this well-formed service name as a replacement for "srvc_registry".srvc-registrylast updated 2018/11/273018 udp (srvc_registry)Service Registrysrvc_registrylast updated 2018/11/273019 tcpResource Manager IANA assigned this well-formed service name as a replacement for "resource_mgr".resource-mgrlast updated 2018/11/273019 tcp (resource_mgr)Resource Managerresource_mgrlast updated 2018/11/273019 udpResource Manager IANA assigned this well-formed service name as a replacement for "resource_mgr".resource-mgrlast updated 2018/11/273019 udp (resource_mgr)Resource Managerresource_mgrlast updated 2018/11/273020 tcpCIFScifslast updated 2018/11/273020 udpCIFScifslast updated 2018/11/273021 tcpAGRI Serveragriserverlast updated 2018/11/273021 udpAGRI Serveragriserverlast updated 2018/11/273022 tcpCSREGAGENTcsregagentlast updated 2018/11/273022 udpCSREGAGENTcsregagentlast updated 2018/11/273023 tcpmagicnotesmagicnoteslast updated 2018/11/273023 udpmagicnotesmagicnoteslast updated 2018/11/273024 tcpNDS_SSO IANA assigned this well-formed service name as a replacement for "nds_sso".nds-ssolast updated 2018/11/273024 tcp (nds_sso)NDS_SSOnds_ssolast updated 2018/11/273024 udpNDS_SSO IANA assigned this well-formed service name as a replacement for "nds_sso".nds-ssolast updated 2018/11/273024 udp (nds_sso)NDS_SSOnds_ssolast updated 2018/11/273025 tcpArepa Raftarepa-raftlast updated 2018/11/273025 udpArepa Raftarepa-raftlast updated 2018/11/273026 tcpAGRI Gatewayagri-gatewaylast updated 2018/11/273026 udpAGRI Gatewayagri-gatewaylast updated 2018/11/273027 tcpLiebDevMgmt_C IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_C".LiebDevMgmt-Clast updated 2018/11/273027 tcp (LiebDevMgmt_C)LiebDevMgmt_CLiebDevMgmt_Clast updated 2018/11/273027 udpLiebDevMgmt_C IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_C".LiebDevMgmt-Clast updated 2018/11/273027 udp (LiebDevMgmt_C)LiebDevMgmt_CLiebDevMgmt_Clast updated 2018/11/273028 tcpLiebDevMgmt_DM IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_DM".LiebDevMgmt-DMlast updated 2018/11/273028 tcp (LiebDevMgmt_DM)LiebDevMgmt_DMLiebDevMgmt_DMlast updated 2018/11/273028 udpLiebDevMgmt_DM IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_DM".LiebDevMgmt-DMlast updated 2018/11/273028 udp (LiebDevMgmt_DM)LiebDevMgmt_DMLiebDevMgmt_DMlast updated 2018/11/273029 tcpLiebDevMgmt_A IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_A".LiebDevMgmt-Alast updated 2018/11/273029 tcp (LiebDevMgmt_A)LiebDevMgmt_ALiebDevMgmt_Alast updated 2018/11/273029 udpLiebDevMgmt_A IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_A".LiebDevMgmt-Alast updated 2018/11/273029 udp (LiebDevMgmt_A)LiebDevMgmt_ALiebDevMgmt_Alast updated 2018/11/273030 tcpArepa Casarepa-caslast updated 2018/11/273030 udpArepa Casarepa-caslast updated 2018/11/273031 tcpRemote AppleEvents/PPC Toolboxeppclast updated 2018/11/273031 udpRemote AppleEvents/PPC Toolboxeppclast updated 2018/11/273032 tcpRedwood Chatredwood-chatlast updated 2018/11/273032 udpRedwood Chatredwood-chatlast updated 2018/11/273033 tcpPDBpdblast updated 2018/11/273033 udpPDBpdblast updated 2018/11/273034 tcpOsmosis / Helix (R) AEEA Portosmosis-aeealast updated 2018/11/273034 udpOsmosis / Helix (R) AEEA Portosmosis-aeealast updated 2018/11/273035 tcpFJSV gssagtfjsv-gssagtlast updated 2018/11/273035 udpFJSV gssagtfjsv-gssagtlast updated 2018/11/273036 tcpHagel DUMPhagel-dumplast updated 2018/11/273036 udpHagel DUMPhagel-dumplast updated 2018/11/273037 tcpHP SAN Mgmthp-san-mgmtlast updated 2018/11/273037 udpHP SAN Mgmthp-san-mgmtlast updated 2018/11/273038 tcpSantak UPSsantak-upslast updated 2018/11/273038 udpSantak UPSsantak-upslast updated 2018/11/273039 tcpCogitate, Inc.cogitatelast updated 2018/11/273039 udpCogitate, Inc.cogitatelast updated 2018/11/273040 tcpTomato Springstomato-springslast updated 2018/11/273040 udpTomato Springstomato-springslast updated 2018/11/273041 tcpdi-tracewaredi-tracewarelast updated 2018/11/273041 udpdi-tracewaredi-tracewarelast updated 2018/11/273042 tcpjourneejourneelast updated 2018/11/273042 udpjourneejourneelast updated 2018/11/273043 tcpBroadcast Routing Protocolbrplast updated 2018/11/273043 udpBroadcast Routing Protocolbrplast updated 2018/11/273044 tcpEndPoint Protocolepplast updated 2018/11/273044 udpEndPoint Protocolepplast updated 2018/11/273045 tcpResponseNetresponsenetlast updated 2018/11/273045 udpResponseNetresponsenetlast updated 2018/11/273046 tcpdi-asedi-aselast updated 2018/11/273046 udpdi-asedi-aselast updated 2018/11/273047 tcpFast Security HL Serverhlserverlast updated 2018/11/273047 udpFast Security HL Serverhlserverlast updated 2018/11/273048 tcpSierra Net PC Traderpctraderlast updated 2018/11/273048 udpSierra Net PC Traderpctraderlast updated 2018/11/273049 tcpNSWSnswslast updated 2018/11/273049 udpNSWSnswslast updated 2018/11/273050 tcpgds_db IANA assigned this well-formed service name as a replacement for "gds_db".gds-dblast updated 2018/11/273050 tcp (gds_db)gds_dbgds_dblast updated 2018/11/273050 udpgds_db IANA assigned this well-formed service name as a replacement for "gds_db".gds-dblast updated 2018/11/273050 udp (gds_db)gds_dbgds_dblast updated 2018/11/273051 tcpGalaxy Servergalaxy-serverlast updated 2018/11/273051 udpGalaxy Servergalaxy-serverlast updated 2018/11/273052 tcpAPC 3052apc-3052last updated 2018/11/273052 udpAPC 3052apc-3052last updated 2018/11/273053 tcpdsom-serverdsom-serverlast updated 2018/11/273053 udpdsom-serverdsom-serverlast updated 2018/11/273054 tcpAMT CNF PROTamt-cnf-protlast updated 2018/11/273054 udpAMT CNF PROTamt-cnf-protlast updated 2018/11/273055 tcpPolicy Serverpolicyserverlast updated 2018/11/273055 udpPolicy Serverpolicyserverlast updated 2018/11/273056 tcpCDL Servercdl-serverlast updated 2018/11/273056 udpCDL Servercdl-serverlast updated 2018/11/273057 tcpGoAhead FldUpgoahead-flduplast updated 2018/11/273057 udpGoAhead FldUpgoahead-flduplast updated 2018/11/273058 tcpvideobeansvideobeanslast updated 2018/11/273058 udpvideobeansvideobeanslast updated 2018/11/273059 tcpqsoftqsoftlast updated 2018/11/273059 udpqsoftqsoftlast updated 2018/11/273060 tcpinterserverinterserverlast updated 2018/11/273060 udpinterserverinterserverlast updated 2018/11/273061 tcpcautcpdcautcpdlast updated 2018/11/273061 udpcautcpdcautcpdlast updated 2018/11/273062 tcpncacn-ip-tcpncacn-ip-tcplast updated 2018/11/273062 udpncacn-ip-tcpncacn-ip-tcplast updated 2018/11/273063 tcpncadg-ip-udpncadg-ip-udplast updated 2018/11/273063 udpncadg-ip-udpncadg-ip-udplast updated 2018/11/273064 tcpRemote Port Redirectorrprtlast updated 2018/11/273064 udpRemote Port Redirectorrprtlast updated 2018/11/273065 tcpslinterbaseslinterbaselast updated 2018/11/273065 udpslinterbaseslinterbaselast updated 2018/11/273066 tcpNETATTACHSDMPnetattachsdmplast updated 2018/11/273066 udpNETATTACHSDMPnetattachsdmplast updated 2018/11/273067 tcpFJHPJPfjhpjplast updated 2018/11/273067 udpFJHPJPfjhpjplast updated 2018/11/273068 tcpls3 Broadcastls3bcastlast updated 2018/11/273068 udpls3 Broadcastls3bcastlast updated 2018/11/273069 tcpls3ls3last updated 2018/11/273069 udpls3ls3last updated 2018/11/273070 tcpMGXSWITCHmgxswitchlast updated 2018/11/273070 udpMGXSWITCHmgxswitchlast updated 2018/11/273071 tcpCrossplatform replication protocolxplat-replicatelast updated 2018/11/273071 udpReservedN/Alast updated 2018/11/273072 tcpContinuStor Monitor Portcsd-monitorlast updated 2018/11/273072 udpContinuStor Monitor Portcsd-monitorlast updated 2018/11/273073 tcpVery simple chatroom protvcrplast updated 2018/11/273073 udpVery simple chatroom protvcrplast updated 2018/11/273074 tcpXbox game portxboxlast updated 2018/11/273074 udpXbox game portxboxlast updated 2018/11/273075 tcpOrbix 2000 Locatororbix-locatorlast updated 2018/11/273075 udpOrbix 2000 Locatororbix-locatorlast updated 2018/11/273076 tcpOrbix 2000 Configorbix-configlast updated 2018/11/273076 udpOrbix 2000 Configorbix-configlast updated 2018/11/273077 tcpOrbix 2000 Locator SSLorbix-loc-ssllast updated 2018/11/273077 udpOrbix 2000 Locator SSLorbix-loc-ssllast updated 2018/11/273078 tcpOrbix 2000 Locator SSLorbix-cfg-ssllast updated 2018/11/273078 udpOrbix 2000 Locator SSLorbix-cfg-ssllast updated 2018/11/273079 tcpLV Front Panellv-frontpanellast updated 2018/11/273079 udpLV Front Panellv-frontpanellast updated 2018/11/273080 tcpstm_pproc IANA assigned this well-formed service name as a replacement for "stm_pproc".stm-pproclast updated 2018/11/273080 tcp (stm_pproc)stm_pprocstm_pproclast updated 2018/11/273080 udpstm_pproc IANA assigned this well-formed service name as a replacement for "stm_pproc".stm-pproclast updated 2018/11/273080 udp (stm_pproc)stm_pprocstm_pproclast updated 2018/11/273081 tcpTL1-LVtl1-lvlast updated 2018/11/273081 udpTL1-LVtl1-lvlast updated 2018/11/273082 tcpTL1-RAWtl1-rawlast updated 2018/11/273082 udpTL1-RAWtl1-rawlast updated 2018/11/273083 tcpTL1-TELNETtl1-telnetlast updated 2018/11/273083 udpTL1-TELNETtl1-telnetlast updated 2018/11/273084 tcpITM-MCCSitm-mccslast updated 2018/11/273084 udpITM-MCCSitm-mccslast updated 2018/11/273085 tcpPCIHReqpcihreqlast updated 2018/11/273085 udpPCIHReqpcihreqlast updated 2018/11/273086 tcpJDL-DBKitchenjdl-dbkitchenlast updated 2018/11/273086 udpJDL-DBKitchenjdl-dbkitchenlast updated 2018/11/273087 tcpAsoki SMAasoki-smalast updated 2018/11/273087 udpAsoki SMAasoki-smalast updated 2018/11/273088 tcpeXtensible Data Transfer Protocolxdtplast updated 2018/11/273088 udpeXtensible Data Transfer Protocolxdtplast updated 2018/11/273089 tcpParaTek Agent Linkingptk-alinklast updated 2018/11/273089 udpParaTek Agent Linkingptk-alinklast updated 2018/11/273090 tcpSenforce Session Servicesstsslast updated 2018/11/273090 udpSenforce Session Servicesstsslast updated 2018/11/273091 tcp1Ci Server Management1ci-smcslast updated 2018/11/273091 udp1Ci Server Management1ci-smcslast updated 2018/11/273092 UnassignedN/Alast updated 2018/11/273093 tcpJiiva RapidMQ Centerrapidmq-centerlast updated 2018/11/273093 udpJiiva RapidMQ Centerrapidmq-centerlast updated 2018/11/273094 tcpJiiva RapidMQ Registryrapidmq-reglast updated 2018/11/273094 udpJiiva RapidMQ Registryrapidmq-reglast updated 2018/11/273095 tcpPanasas rendezvous portpanasaslast updated 2018/11/273095 udpPanasas rendezvous portpanasaslast updated 2018/11/273096 tcpActive Print Server Portndl-apslast updated 2018/11/273096 udpActive Print Server Portndl-apslast updated 2018/11/273097 tcpReservedN/Alast updated 2018/11/273097 udpReservedN/Alast updated 2018/11/273097 sctpITU-T Q.1902.1/Q.2150.3itu-bicc-stclast updated 2018/11/273098 tcpUniversal Message Managerumm-portlast updated 2018/11/273098 udpUniversal Message Managerumm-portlast updated 2018/11/273099 tcpCHIPSY Machine Daemonchmdlast updated 2018/11/273099 udpCHIPSY Machine Daemonchmdlast updated 2018/11/273100 tcpOpCon/xpsopcon-xpslast updated 2018/11/273100 udpOpCon/xpsopcon-xpslast updated 2018/11/273101 tcpHP PolicyXpert PIB Serverhp-pxpiblast updated 2018/11/273101 udpHP PolicyXpert PIB Serverhp-pxpiblast updated 2018/11/273102 tcpSoftlinK Slave Mon Portslslavemonlast updated 2018/11/273102 udpSoftlinK Slave Mon Portslslavemonlast updated 2018/11/273103 tcpAutocue SMI Protocolautocuesmilast updated 2018/11/273103 udpAutocue SMI Protocolautocuesmilast updated 2018/11/273104 tcpAutocue Logger Protocolautocueloglast updated 2018/11/273104 udpAutocue Time Serviceautocuetimelast updated 2018/11/273105 tcpCardboxcardboxlast updated 2018/11/273105 udpCardboxcardboxlast updated 2018/11/273106 tcpCardbox HTTPcardbox-httplast updated 2018/11/273106 udpCardbox HTTPcardbox-httplast updated 2018/11/273107 tcpBusiness protocolbusinesslast updated 2018/11/273107 udpBusiness protocolbusinesslast updated 2018/11/273108 tcpGeolocate protocolgeolocatelast updated 2018/11/273108 udpGeolocate protocolgeolocatelast updated 2018/11/273109 tcpPersonnel protocolpersonnellast updated 2018/11/273109 udpPersonnel protocolpersonnellast updated 2018/11/273110 tcpsimulator control portsim-controllast updated 2018/11/273110 udpsimulator control portsim-controllast updated 2018/11/273111 tcpWeb Synchronous Serviceswsynchlast updated 2018/11/273111 udpWeb Synchronous Serviceswsynchlast updated 2018/11/273112 tcpKDE System Guardksysguardlast updated 2018/11/273112 udpKDE System Guardksysguardlast updated 2018/11/273113 tcpCS-Authenticate Svr Portcs-auth-svrlast updated 2018/11/273113 udpCS-Authenticate Svr Portcs-auth-svrlast updated 2018/11/273114 tcpCCM AutoDiscoverccmadlast updated 2018/11/273114 udpCCM AutoDiscoverccmadlast updated 2018/11/273115 tcpMCTET Mastermctet-masterlast updated 2018/11/273115 udpMCTET Mastermctet-masterlast updated 2018/11/273116 tcpMCTET Gatewaymctet-gatewaylast updated 2018/11/273116 udpMCTET Gatewaymctet-gatewaylast updated 2018/11/273117 tcpMCTET Jservmctet-jservlast updated 2018/11/273117 udpMCTET Jservmctet-jservlast updated 2018/11/273118 tcpPKAgentpkagentlast updated 2018/11/273118 udpPKAgentpkagentlast updated 2018/11/273119 tcpD2000 Kernel Portd2000kernellast updated 2018/11/273119 udpD2000 Kernel Portd2000kernellast updated 2018/11/273120 tcpD2000 Webserver Portd2000webserverlast updated 2018/11/273120 udpD2000 Webserver Portd2000webserverlast updated 2018/11/273121 tcpThe pacemaker remote (pcmk-remote) service extends high availability functionality outside of the Linux cluster into remote nodes.pcmk-remotelast updated 2018/11/273121 udpReservedN/Alast updated 2018/11/273122 tcpMTI VTR Emulator portvtr-emulatorlast updated 2018/11/273122 udpMTI VTR Emulator portvtr-emulatorlast updated 2018/11/273123 tcpEDI Translation Protocoledixlast updated 2018/11/273123 udpEDI Translation Protocoledixlast updated 2018/11/273124 tcpBeacon Portbeacon-portlast updated 2018/11/273124 udpBeacon Portbeacon-portlast updated 2018/11/273125 tcpA13-AN Interfacea13-anlast updated 2018/11/273125 udpA13-AN Interfacea13-anlast updated 2018/11/273126 UnassignedN/Alast updated 2018/11/273127 tcpCTX Bridge Portctx-bridgelast updated 2018/11/273127 udpCTX Bridge Portctx-bridgelast updated 2018/11/273128 tcpActive API Server Portndl-aaslast updated 2018/11/273128 udpActive API Server Portndl-aaslast updated 2018/11/273129 tcpNetPort Discovery Portnetport-idlast updated 2018/11/273129 udpNetPort Discovery Portnetport-idlast updated 2018/11/273130 tcpICPv2icpv2last updated 2018/11/273130 udpICPv2icpv2last updated 2018/11/273131 tcpNet Book Marknetbookmarklast updated 2018/11/273131 udpNet Book Marknetbookmarklast updated 2018/11/273132 tcpMicrosoft Business Rule Engine Update Servicems-rule-enginelast updated 2018/11/273132 udpMicrosoft Business Rule Engine Update Servicems-rule-enginelast updated 2018/11/273133 tcpPrism Deploy User Portprism-deploylast updated 2018/11/273133 udpPrism Deploy User Portprism-deploylast updated 2018/11/273134 tcpExtensible Code Protocolecplast updated 2018/11/273134 udpExtensible Code Protocolecplast updated 2018/11/273135 tcpPeerBook Portpeerbook-portlast updated 2018/11/273135 udpPeerBook Portpeerbook-portlast updated 2018/11/273136 tcpGrub Server Portgrubdlast updated 2018/11/273136 udpGrub Server Portgrubdlast updated 2018/11/273137 tcprtnt-1 data packetsrtnt-1last updated 2018/11/273137 udprtnt-1 data packetsrtnt-1last updated 2018/11/273138 tcprtnt-2 data packetsrtnt-2last updated 2018/11/273138 udprtnt-2 data packetsrtnt-2last updated 2018/11/273139 tcpIncognito Rendez-Vousincognitorvlast updated 2018/11/273139 udpIncognito Rendez-Vousincognitorvlast updated 2018/11/273140 tcpArilia Multiplexorariliamultilast updated 2018/11/273140 udpArilia Multiplexorariliamultilast updated 2018/11/273141 tcpVMODEMvmodemlast updated 2018/11/273141 udpVMODEMvmodemlast updated 2018/11/273142 tcpRDC WH EOSrdc-wh-eoslast updated 2018/11/273142 udpRDC WH EOSrdc-wh-eoslast updated 2018/11/273143 tcpSea Viewseaviewlast updated 2018/11/273143 udpSea Viewseaviewlast updated 2018/11/273144 tcpTarantellatarantellalast updated 2018/11/273144 udpTarantellatarantellalast updated 2018/11/273145 tcpCSI-LFAPcsi-lfaplast updated 2018/11/273145 udpCSI-LFAPcsi-lfaplast updated 2018/11/273146 tcpbears-02bears-02last updated 2018/11/273146 udpbears-02bears-02last updated 2018/11/273147 tcpRFIOrfiolast updated 2018/11/273147 udpRFIOrfiolast updated 2018/11/273148 tcpNetMike Game Administratornm-game-adminlast updated 2018/11/273148 udpNetMike Game Administratornm-game-adminlast updated 2018/11/273149 tcpNetMike Game Servernm-game-serverlast updated 2018/11/273149 udpNetMike Game Servernm-game-serverlast updated 2018/11/273150 tcpNetMike Assessor Administratornm-asses-adminlast updated 2018/11/273150 udpNetMike Assessor Administratornm-asses-adminlast updated 2018/11/273151 tcpNetMike Assessornm-assessorlast updated 2018/11/273151 udpNetMike Assessornm-assessorlast updated 2018/11/273152 tcpFeiTian Portfeitianrockeylast updated 2018/11/273152 udpFeiTian Portfeitianrockeylast updated 2018/11/273153 tcpS8Cargo Client Ports8-client-portlast updated 2018/11/273153 udpS8Cargo Client Ports8-client-portlast updated 2018/11/273154 tcpON RMI Registryccmrmilast updated 2018/11/273154 udpON RMI Registryccmrmilast updated 2018/11/273155 tcpJpegMpeg Portjpegmpeglast updated 2018/11/273155 udpJpegMpeg Portjpegmpeglast updated 2018/11/273156 tcpIndura Collectorinduralast updated 2018/11/273156 udpIndura Collectorinduralast updated 2018/11/273157 tcpCCC Listener Porte3consultantslast updated 2018/11/273157 udpCCC Listener Porte3consultantslast updated 2018/11/273158 tcpSmashTV Protocolstvplast updated 2018/11/273158 udpSmashTV Protocolstvplast updated 2018/11/273159 tcpNavegaWeb Tarificationnavegaweb-portlast updated 2018/11/273159 udpNavegaWeb Tarificationnavegaweb-portlast updated 2018/11/273160 tcpTIP Application Servertip-app-serverlast updated 2018/11/273160 udpTIP Application Servertip-app-serverlast updated 2018/11/273161 tcpDOC1 License Managerdoc1lmlast updated 2018/11/273161 udpDOC1 License Managerdoc1lmlast updated 2018/11/273162 tcpSFLMsflmlast updated 2018/11/273162 udpSFLMsflmlast updated 2018/11/273163 tcpRES-SAPres-saplast updated 2018/11/273163 udpRES-SAPres-saplast updated 2018/11/273164 tcpIMPRSimprslast updated 2018/11/273164 udpIMPRSimprslast updated 2018/11/273165 tcpNewgenpay Engine Servicenewgenpaylast updated 2018/11/273165 udpNewgenpay Engine Servicenewgenpaylast updated 2018/11/273166 tcpQuest Spotlight Out-Of-Process Collectorsossecollectorlast updated 2018/11/273166 udpQuest Spotlight Out-Of-Process Collectorsossecollectorlast updated 2018/11/273167 tcpNow Contact Public Servernowcontactlast updated 2018/11/273167 udpNow Contact Public Servernowcontactlast updated 2018/11/273168 tcpNow Up-to-Date Public Serverpoweronnudlast updated 2018/11/273168 udpNow Up-to-Date Public Serverpoweronnudlast updated 2018/11/273169 tcpSERVERVIEW-ASserverview-aslast updated 2018/11/273169 udpSERVERVIEW-ASserverview-aslast updated 2018/11/273170 tcpSERVERVIEW-ASNserverview-asnlast updated 2018/11/273170 udpSERVERVIEW-ASNserverview-asnlast updated 2018/11/273171 tcpSERVERVIEW-GFserverview-gflast updated 2018/11/273171 udpSERVERVIEW-GFserverview-gflast updated 2018/11/273172 tcpSERVERVIEW-RMserverview-rmlast updated 2018/11/273172 udpSERVERVIEW-RMserverview-rmlast updated 2018/11/273173 tcpSERVERVIEW-ICCserverview-icclast updated 2018/11/273173 udpSERVERVIEW-ICCserverview-icclast updated 2018/11/273174 tcpARMI Serverarmi-serverlast updated 2018/11/273174 udpARMI Serverarmi-serverlast updated 2018/11/273175 tcpT1_E1_Over_IPt1-e1-over-iplast updated 2018/11/273175 udpT1_E1_Over_IPt1-e1-over-iplast updated 2018/11/273176 tcpARS Masterars-masterlast updated 2018/11/273176 udpARS Masterars-masterlast updated 2018/11/273177 tcpPhonex Protocolphonex-portlast updated 2018/11/273177 udpPhonex Protocolphonex-portlast updated 2018/11/273178 tcpRadiance UltraEdge Portradclientportlast updated 2018/11/273178 udpRadiance UltraEdge Portradclientportlast updated 2018/11/273179 tcpH2GF W.2m Handover prot.h2gf-w-2mlast updated 2018/11/273179 udpH2GF W.2m Handover prot.h2gf-w-2mlast updated 2018/11/273180 tcpMillicent Broker Servermc-brk-srvlast updated 2018/11/273180 udpMillicent Broker Servermc-brk-srvlast updated 2018/11/273181 tcpBMC Patrol Agentbmcpatrolagentlast updated 2018/11/273181 udpBMC Patrol Agentbmcpatrolagentlast updated 2018/11/273182 tcpBMC Patrol Rendezvousbmcpatrolrnvulast updated 2018/11/273182 udpBMC Patrol Rendezvousbmcpatrolrnvulast updated 2018/11/273183 tcpCOPS/TLScops-tlslast updated 2018/11/273183 udpCOPS/TLScops-tlslast updated 2018/11/273184 tcpApogeeX Portapogeex-portlast updated 2018/11/273184 udpApogeeX Portapogeex-portlast updated 2018/11/273185 tcpSuSE Meta PPPDsmpppdlast updated 2018/11/273185 udpSuSE Meta PPPDsmpppdlast updated 2018/11/273186 tcpIIW Monitor User Portiiw-portlast updated 2018/11/273186 udpIIW Monitor User Portiiw-portlast updated 2018/11/273187 tcpOpen Design Listen Portodi-portlast updated 2018/11/273187 udpOpen Design Listen Portodi-portlast updated 2018/11/273188 tcpBroadcom Portbrcm-comm-portlast updated 2018/11/273188 udpBroadcom Portbrcm-comm-portlast updated 2018/11/273189 tcpPinnacle Sys InfEx Portpcle-infexlast updated 2018/11/273189 udpPinnacle Sys InfEx Portpcle-infexlast updated 2018/11/273190 tcpConServR Proxycsvr-proxylast updated 2018/11/273190 udpConServR Proxycsvr-proxylast updated 2018/11/273191 tcpConServR SSL Proxycsvr-sslproxylast updated 2018/11/273191 udpConServR SSL Proxycsvr-sslproxylast updated 2018/11/273192 tcpFireMon Revision Controlfiremonrcclast updated 2018/11/273192 udpFireMon Revision Controlfiremonrcclast updated 2018/11/273193 tcpSpanDataPortspandataportlast updated 2018/11/273193 udpSpanDataPortspandataportlast updated 2018/11/273194 tcpRockstorm MAG protocolmagbindlast updated 2018/11/273194 udpRockstorm MAG protocolmagbindlast updated 2018/11/273195 tcpNetwork Control Unitncu-1last updated 2018/11/273195 udpNetwork Control Unitncu-1last updated 2018/11/273196 tcpNetwork Control Unitncu-2last updated 2018/11/273196 udpNetwork Control Unitncu-2last updated 2018/11/273197 tcpEmbrace Device Protocol Serverembrace-dp-slast updated 2018/11/273197 udpEmbrace Device Protocol Serverembrace-dp-slast updated 2018/11/273198 tcpEmbrace Device Protocol Clientembrace-dp-clast updated 2018/11/273198 udpEmbrace Device Protocol Clientembrace-dp-clast updated 2018/11/273199 tcpDMOD WorkSpacedmod-workspacelast updated 2018/11/273199 udpDMOD WorkSpacedmod-workspacelast updated 2018/11/273200 tcpPress-sense Tick Porttick-portlast updated 2018/11/273200 udpPress-sense Tick Porttick-portlast updated 2018/11/273201 tcpCPQ-TaskSmartcpq-tasksmartlast updated 2018/11/273201 udpCPQ-TaskSmartcpq-tasksmartlast updated 2018/11/273202 tcpIntraIntraintraintralast updated 2018/11/273202 udpIntraIntraintraintralast updated 2018/11/273203 tcpNetwork Watcher Monitornetwatcher-monlast updated 2018/11/273203 udpNetwork Watcher Monitornetwatcher-monlast updated 2018/11/273204 tcpNetwork Watcher DB Accessnetwatcher-dblast updated 2018/11/273204 udpNetwork Watcher DB Accessnetwatcher-dblast updated 2018/11/273205 tcpiSNS Server Portisnslast updated 2018/11/273205 udpiSNS Server Portisnslast updated 2018/11/273206 tcpIronMail POP Proxyironmaillast updated 2018/11/273206 udpIronMail POP Proxyironmaillast updated 2018/11/273207 tcpVeritas Authentication Portvx-auth-portlast updated 2018/11/273207 udpVeritas Authentication Portvx-auth-portlast updated 2018/11/273208 tcpPFU PR Callbackpfu-prcallbacklast updated 2018/11/273208 udpPFU PR Callbackpfu-prcallbacklast updated 2018/11/273209 tcpHP OpenView Network Path Engine Servernetwkpathenginelast updated 2018/11/273209 udpHP OpenView Network Path Engine Servernetwkpathenginelast updated 2018/11/273210 tcpFlamenco Networks Proxyflamenco-proxylast updated 2018/11/273210 udpFlamenco Networks Proxyflamenco-proxylast updated 2018/11/273211 tcpAvocent Secure Managementavsecuremgmtlast updated 2018/11/273211 udpAvocent Secure Managementavsecuremgmtlast updated 2018/11/273212 tcpSurvey Instrumentsurveyinstlast updated 2018/11/273212 udpSurvey Instrumentsurveyinstlast updated 2018/11/273213 tcpNEON 24X7 Mission Controlneon24x7last updated 2018/11/273213 udpNEON 24X7 Mission Controlneon24x7last updated 2018/11/273214 tcpJMQ Daemon Port 1jmq-daemon-1last updated 2018/11/273214 udpJMQ Daemon Port 1jmq-daemon-1last updated 2018/11/273215 tcpJMQ Daemon Port 2jmq-daemon-2last updated 2018/11/273215 udpJMQ Daemon Port 2jmq-daemon-2last updated 2018/11/273216 tcpFerrari electronic FOAMferrari-foamlast updated 2018/11/273216 udpFerrari electronic FOAMferrari-foamlast updated 2018/11/273217 tcpUnified IP & Telecom Environmentunitelast updated 2018/11/273217 udpUnified IP & Telecom Environmentunitelast updated 2018/11/273218 tcpEMC SmartPacketssmartpacketslast updated 2018/11/273218 udpEMC SmartPacketssmartpacketslast updated 2018/11/273219 tcpWMS Messengerwms-messengerlast updated 2018/11/273219 udpWMS Messengerwms-messengerlast updated 2018/11/273220 tcpXML NM over SSLxnm-ssllast updated 2018/11/273220 udpXML NM over SSLxnm-ssllast updated 2018/11/273221 tcpXML NM over TCPxnm-clear-textlast updated 2018/11/273221 udpXML NM over TCPxnm-clear-textlast updated 2018/11/273222 tcpGateway Load Balancing Prglbplast updated 2018/11/273222 udpGateway Load Balancing Prglbplast updated 2018/11/273223 tcpDIGIVOTE (R) Vote-Serverdigivotelast updated 2018/11/273223 udpDIGIVOTE (R) Vote-Serverdigivotelast updated 2018/11/273224 tcpAES Discovery Portaes-discoverylast updated 2018/11/273224 udpAES Discovery Portaes-discoverylast updated 2018/11/273225 tcpFCIPfcip-portlast updated 2018/11/273225 udpFCIPfcip-portlast updated 2018/11/273226 tcpISI Industry Software IRPisi-irplast updated 2018/11/273226 udpISI Industry Software IRPisi-irplast updated 2018/11/273227 tcpDiamondWave NMS Serverdwnmshttplast updated 2018/11/273227 udpDiamondWave NMS Serverdwnmshttplast updated 2018/11/273228 tcpDiamondWave MSG Serverdwmsgserverlast updated 2018/11/273228 udpDiamondWave MSG Serverdwmsgserverlast updated 2018/11/273229 tcpGlobal CD Portglobal-cd-portlast updated 2018/11/273229 udpGlobal CD Portglobal-cd-portlast updated 2018/11/273230 tcpSoftware Distributor Portsftdst-portlast updated 2018/11/273230 udpSoftware Distributor Portsftdst-portlast updated 2018/11/273231 tcpVidiGo communication (previous was: Delta Solutions Direct)vidigolast updated 2018/11/273231 udpVidiGo communication (previous was: Delta Solutions Direct)vidigolast updated 2018/11/273232 tcpMDT portmdtplast updated 2018/11/273232 udpMDT portmdtplast updated 2018/11/273233 tcpWhiskerControl main portwhiskerlast updated 2018/11/273233 udpWhiskerControl main portwhiskerlast updated 2018/11/273234 tcpAlchemy Serveralchemylast updated 2018/11/273234 udpAlchemy Serveralchemylast updated 2018/11/273235 tcpMDAP portmdap-portlast updated 2018/11/273235 udpMDAP Portmdap-portlast updated 2018/11/273236 tcpappareNet Test Serverapparenet-tslast updated 2018/11/273236 udpappareNet Test Serverapparenet-tslast updated 2018/11/273237 tcpappareNet Test Packet Sequencerapparenet-tpslast updated 2018/11/273237 udpappareNet Test Packet Sequencerapparenet-tpslast updated 2018/11/273238 tcpappareNet Analysis Serverapparenet-aslast updated 2018/11/273238 udpappareNet Analysis Serverapparenet-aslast updated 2018/11/273239 tcpappareNet User Interfaceapparenet-uilast updated 2018/11/273239 udpappareNet User Interfaceapparenet-uilast updated 2018/11/273240 tcpTrio Motion Control Porttriomotionlast updated 2018/11/273240 udpTrio Motion Control Porttriomotionlast updated 2018/11/273241 tcpSysOrb Monitoring Serversysorblast updated 2018/11/273241 udpSysOrb Monitoring Serversysorblast updated 2018/11/273242 tcpSession Description IDsdp-id-portlast updated 2018/11/273242 udpSession Description IDsdp-id-portlast updated 2018/11/273243 tcpTimelot Porttimelotlast updated 2018/11/273243 udpTimelot Porttimelotlast updated 2018/11/273244 tcpOneSAFonesaflast updated 2018/11/273244 udpOneSAFonesaflast updated 2018/11/273245 tcpVIEO Fabric Executivevieo-felast updated 2018/11/273245 udpVIEO Fabric Executivevieo-felast updated 2018/11/273246 tcpDVT SYSTEM PORTdvt-systemlast updated 2018/11/273246 udpDVT SYSTEM PORTdvt-systemlast updated 2018/11/273247 tcpDVT DATA LINKdvt-datalast updated 2018/11/273247 udpDVT DATA LINKdvt-datalast updated 2018/11/273248 tcpPROCOS LMprocos-lmlast updated 2018/11/273248 udpPROCOS LMprocos-lmlast updated 2018/11/273249 tcpState Sync Protocolssplast updated 2018/11/273249 udpState Sync Protocolssplast updated 2018/11/273250 tcpHMS hicp porthicplast updated 2018/11/273250 udpHMS hicp porthicplast updated 2018/11/273251 tcpSys Scannersysscannerlast updated 2018/11/273251 udpSys Scannersysscannerlast updated 2018/11/273252 tcpDHE portdhelast updated 2018/11/273252 udpDHE portdhelast updated 2018/11/273253 tcpPDA Datapda-datalast updated 2018/11/273253 udpPDA Datapda-datalast updated 2018/11/273254 tcpPDA Systempda-syslast updated 2018/11/273254 udpPDA Systempda-syslast updated 2018/11/273255 tcpSemaphore Connection Portsemaphorelast updated 2018/11/273255 udpSemaphore Connection Portsemaphorelast updated 2018/11/273256 tcpCompaq RPM Agent Portcpqrpm-agentlast updated 2018/11/273256 udpCompaq RPM Agent Portcpqrpm-agentlast updated 2018/11/273257 tcpCompaq RPM Server Portcpqrpm-serverlast updated 2018/11/273257 udpCompaq RPM Server Portcpqrpm-serverlast updated 2018/11/273258 tcpIvecon Server Portivecon-portlast updated 2018/11/273258 udpIvecon Server Portivecon-portlast updated 2018/11/273259 tcpEpson Network Common Deviepncdp2last updated 2018/11/273259 udpEpson Network Common Deviepncdp2last updated 2018/11/273260 tcpiSCSI portiscsi-targetlast updated 2018/11/273260 udpiSCSI portiscsi-targetlast updated 2018/11/273261 tcpwinShadowwinshadowlast updated 2018/11/273261 udpwinShadowwinshadowlast updated 2018/11/273262 tcpNECPnecplast updated 2018/11/273262 udpNECPnecplast updated 2018/11/273263 tcpE-Color Enterprise Imagerecolor-imagerlast updated 2018/11/273263 udpE-Color Enterprise Imagerecolor-imagerlast updated 2018/11/273264 tcpcc:mail/lotusccmaillast updated 2018/11/273264 udpcc:mail/lotusccmaillast updated 2018/11/273265 tcpAltav Tunnelaltav-tunnellast updated 2018/11/273265 udpAltav Tunnelaltav-tunnellast updated 2018/11/273266 tcpNS CFG Serverns-cfg-serverlast updated 2018/11/273266 udpNS CFG Serverns-cfg-serverlast updated 2018/11/273267 tcpIBM Dial Outibm-dial-outlast updated 2018/11/273267 udpIBM Dial Outibm-dial-outlast updated 2018/11/273268 tcpMicrosoft Global Catalogmsft-gclast updated 2018/11/273268 udpMicrosoft Global Catalogmsft-gclast updated 2018/11/273269 tcpMicrosoft Global Catalog with LDAP/SSLmsft-gc-ssllast updated 2018/11/273269 udpMicrosoft Global Catalog with LDAP/SSLmsft-gc-ssllast updated 2018/11/273270 tcpVerismartverismartlast updated 2018/11/273270 udpVerismartverismartlast updated 2018/11/273271 tcpCSoft Prev Portcsoft-prevlast updated 2018/11/273271 udpCSoft Prev Portcsoft-prevlast updated 2018/11/273272 tcpFujitsu User Manageruser-managerlast updated 2018/11/273272 udpFujitsu User Manageruser-managerlast updated 2018/11/273273 tcpSimple Extensible Multiplexed Protocolsxmplast updated 2018/11/273273 udpSimple Extensible Multiplexed Protocolsxmplast updated 2018/11/273274 tcpOrdinox Serverordinox-serverlast updated 2018/11/273274 udpOrdinox Serverordinox-serverlast updated 2018/11/273275 tcpSAMDsamdlast updated 2018/11/273275 udpSAMDsamdlast updated 2018/11/273276 tcpMaxim ASICsmaxim-asicslast updated 2018/11/273276 udpMaxim ASICsmaxim-asicslast updated 2018/11/273277 tcpAWG Proxyawg-proxylast updated 2018/11/273277 udpAWG Proxyawg-proxylast updated 2018/11/273278 tcpLKCM Serverlkcmserverlast updated 2018/11/273278 udpLKCM Serverlkcmserverlast updated 2018/11/273279 tcpadmindadmindlast updated 2018/11/273279 udpadmindadmindlast updated 2018/11/273280 tcpVS Servervs-serverlast updated 2018/11/273280 udpVS Servervs-serverlast updated 2018/11/273281 tcpSYSOPTsysoptlast updated 2018/11/273281 udpSYSOPTsysoptlast updated 2018/11/273282 tcpDatusorbdatusorblast updated 2018/11/273282 udpDatusorbdatusorblast updated 2018/11/273283 tcpNet AssistantApple Remote Desktop (Net Assistant)last updated 2018/11/273283 udpNet AssistantApple Remote Desktop (Net Assistant)last updated 2018/11/273284 tcp4Talk4talklast updated 2018/11/273284 udp4Talk4talklast updated 2018/11/273285 tcpPlatoplatolast updated 2018/11/273285 udpPlatoplatolast updated 2018/11/273286 tcpE-Nete-netlast updated 2018/11/273286 udpE-Nete-netlast updated 2018/11/273287 tcpDIRECTVDATAdirectvdatalast updated 2018/11/273287 udpDIRECTVDATAdirectvdatalast updated 2018/11/273288 tcpCOPScopslast updated 2018/11/273288 udpCOPScopslast updated 2018/11/273289 tcpENPCenpclast updated 2018/11/273289 udpENPCenpclast updated 2018/11/273290 tcpCAPS LOGISTICS TOOLKIT - LMcaps-lmlast updated 2018/11/273290 udpCAPS LOGISTICS TOOLKIT - LMcaps-lmlast updated 2018/11/273291 tcpS A Holditch & Associates - LMsah-lmlast updated 2018/11/273291 udpS A Holditch & Associates - LMsah-lmlast updated 2018/11/273292 tcpCart O Ramacart-o-ramalast updated 2018/11/273292 udpCart O Ramacart-o-ramalast updated 2018/11/273293 tcpfg-fpsfg-fpslast updated 2018/11/273293 udpfg-fpsfg-fpslast updated 2018/11/273294 tcpfg-gipfg-giplast updated 2018/11/273294 udpfg-gipfg-giplast updated 2018/11/273295 tcpDynamic IP Lookupdyniplookuplast updated 2018/11/273295 udpDynamic IP Lookupdyniplookuplast updated 2018/11/273296 tcpRib License Managerrib-slmlast updated 2018/11/273296 udpRib License Managerrib-slmlast updated 2018/11/273297 tcpCytel License Managercytel-lmlast updated 2018/11/273297 udpCytel License Managercytel-lmlast updated 2018/11/273298 tcpDeskViewdeskviewlast updated 2018/11/273298 udpDeskViewdeskviewlast updated 2018/11/273299 tcppdrncspdrncslast updated 2018/11/273299 udppdrncspdrncslast updated 2018/11/273300 tcpCeph monitorcephlast updated 2018/11/273300 udpReservedN/Alast updated 2018/11/273301 unassignedN/Alast updated 2018/11/273302 tcpMCS Fastmailmcs-fastmaillast updated 2018/11/273302 udpMCS Fastmailmcs-fastmaillast updated 2018/11/273303 tcpOP Session Clientopsession-clntlast updated 2018/11/273303 udpOP Session Clientopsession-clntlast updated 2018/11/273304 tcpOP Session Serveropsession-srvrlast updated 2018/11/273304 udpOP Session Serveropsession-srvrlast updated 2018/11/273305 tcpODETTE-FTPodette-ftplast updated 2018/11/273305 udpODETTE-FTPodette-ftplast updated 2018/11/273306 tcpMySQLmysqllast updated 2018/11/273306 udpMySQLmysqllast updated 2018/11/273307 tcpOP Session Proxyopsession-prxylast updated 2018/11/273307 udpOP Session Proxyopsession-prxylast updated 2018/11/273308 tcpTNS Servertns-serverlast updated 2018/11/273308 udpTNS Servertns-serverlast updated 2018/11/273309 tcpTNS ADVtns-advlast updated 2018/11/273309 udpTNS ADVtns-advlast updated 2018/11/273310 tcpDyna Accessdyna-accesslast updated 2018/11/273310 udpDyna Accessdyna-accesslast updated 2018/11/273311 tcpMCNS Tel Retmcns-tel-retlast updated 2018/11/273311 udpMCNS Tel Retmcns-tel-retlast updated 2018/11/273312 tcpApplication Management Serverappman-serverlast updated 2018/11/273312 udpApplication Management Serverappman-serverlast updated 2018/11/273313 tcpUnify Object Brokeruorblast updated 2018/11/273313 udpUnify Object Brokeruorblast updated 2018/11/273314 tcpUnify Object Hostuohostlast updated 2018/11/273314 udpUnify Object Hostuohostlast updated 2018/11/273315 tcpCDIDcdidlast updated 2018/11/273315 udpCDIDcdidlast updated 2018/11/273316 tcpAICC/CMIaicc-cmilast updated 2018/11/273316 udpAICC/CMIaicc-cmilast updated 2018/11/273317 tcpVSAI PORTvsaiportlast updated 2018/11/273317 udpVSAI PORTvsaiportlast updated 2018/11/273318 tcpSwith to Swith Routing Information Protocolssriplast updated 2018/11/273318 udpSwith to Swith Routing Information Protocolssriplast updated 2018/11/273319 tcpSDT License Managersdt-lmdlast updated 2018/11/273319 udpSDT License Managersdt-lmdlast updated 2018/11/273320 tcpOffice Link 2000officelink2000last updated 2018/11/273320 udpOffice Link 2000officelink2000last updated 2018/11/273321 tcpVNSSTRvnsstrlast updated 2018/11/273321 udpVNSSTRvnsstrlast updated 2018/11/273322-3325 Active Networksactive-netlast updated 2018/11/273326 tcpSFTUsftulast updated 2018/11/273326 udpSFTUsftulast updated 2018/11/273327 tcpBBARSbbarslast updated 2018/11/273327 udpBBARSbbarslast updated 2018/11/273328 tcpEaglepoint License Manageregptlmlast updated 2018/11/273328 udpEaglepoint License Manageregptlmlast updated 2018/11/273329 tcpHP Device Dischp-device-disclast updated 2018/11/273329 udpHP Device Dischp-device-disclast updated 2018/11/273330 tcpMCS Calypso ICFmcs-calypsoicflast updated 2018/11/273330 udpMCS Calypso ICFmcs-calypsoicflast updated 2018/11/273331 tcpMCS Messagingmcs-messaginglast updated 2018/11/273331 udpMCS Messagingmcs-messaginglast updated 2018/11/273332 tcpMCS Mail Servermcs-mailsvrlast updated 2018/11/273332 udpMCS Mail Servermcs-mailsvrlast updated 2018/11/273333 tcpDEC Notesdec-noteslast updated 2018/11/273333 udpDEC Notesdec-noteslast updated 2018/11/273334 tcpDirect TV Webcastingdirectv-weblast updated 2018/11/273334 udpDirect TV Webcastingdirectv-weblast updated 2018/11/273335 tcpDirect TV Software Updatesdirectv-softlast updated 2018/11/273335 udpDirect TV Software Updatesdirectv-softlast updated 2018/11/273336 tcpDirect TV Tickersdirectv-ticklast updated 2018/11/273336 udpDirect TV Tickersdirectv-ticklast updated 2018/11/273337 tcpDirect TV Data Catalogdirectv-catlglast updated 2018/11/273337 udpDirect TV Data Catalogdirectv-catlglast updated 2018/11/273338 tcpOMF data banet-blast updated 2018/11/273338 udpOMF data banet-blast updated 2018/11/273339 tcpOMF data lanet-llast updated 2018/11/273339 udpOMF data lanet-llast updated 2018/11/273340 tcpOMF data manet-mlast updated 2018/11/273340 udpOMF data manet-mlast updated 2018/11/273341 tcpOMF data hanet-hlast updated 2018/11/273341 udpOMF data hanet-hlast updated 2018/11/273342 tcpWebTIEwebtielast updated 2018/11/273342 udpWebTIEwebtielast updated 2018/11/273343 tcpMS Cluster Netms-cluster-netlast updated 2018/11/273343 udpMS Cluster Netms-cluster-netlast updated 2018/11/273344 tcpBNT Managerbnt-managerlast updated 2018/11/273344 udpBNT Managerbnt-managerlast updated 2018/11/273345 tcpInfluenceinfluencelast updated 2018/11/273345 udpInfluenceinfluencelast updated 2018/11/273346 tcpTrnsprnt Proxytrnsprntproxylast updated 2018/11/273346 udpTrnsprnt Proxytrnsprntproxylast updated 2018/11/273347 tcpPhoenix RPCphoenix-rpclast updated 2018/11/273347 udpPhoenix RPCphoenix-rpclast updated 2018/11/273348 tcpPangolin Laserpangolin-laserlast updated 2018/11/273348 udpPangolin Laserpangolin-laserlast updated 2018/11/273349 tcpChevin Serviceschevinserviceslast updated 2018/11/273349 udpChevin Serviceschevinserviceslast updated 2018/11/273350 tcpFINDVIATVfindviatvlast updated 2018/11/273350 udpFINDVIATVfindviatvlast updated 2018/11/273351 tcpBtrieve portbtrievelast updated 2018/11/273351 udpBtrieve portbtrievelast updated 2018/11/273352 tcpScalable SQLssqllast updated 2018/11/273352 udpScalable SQLssqllast updated 2018/11/273353 tcpFATPIPEfatpipelast updated 2018/11/273353 udpFATPIPEfatpipelast updated 2018/11/273354 tcpSUITJDsuitjdlast updated 2018/11/273354 udpSUITJDsuitjdlast updated 2018/11/273355 tcpOrdinox Dbaseordinox-dbaselast updated 2018/11/273355 udpOrdinox Dbaseordinox-dbaselast updated 2018/11/273356 tcpUPNOTIFYPSupnotifypslast updated 2018/11/273356 udpUPNOTIFYPSupnotifypslast updated 2018/11/273357 tcpAdtech Test IPadtech-testlast updated 2018/11/273357 udpAdtech Test IPadtech-testlast updated 2018/11/273358 tcpMp Sys Rmsvrmpsysrmsvrlast updated 2018/11/273358 udpMp Sys Rmsvrmpsysrmsvrlast updated 2018/11/273359 tcpWG NetForcewg-netforcelast updated 2018/11/273359 udpWG NetForcewg-netforcelast updated 2018/11/273360 tcpKV Serverkv-serverlast updated 2018/11/273360 udpKV Serverkv-serverlast updated 2018/11/273361 tcpKV Agentkv-agentlast updated 2018/11/273361 udpKV Agentkv-agentlast updated 2018/11/273362 tcpDJ ILMdj-ilmlast updated 2018/11/273362 udpDJ ILMdj-ilmlast updated 2018/11/273363 tcpNATI Vi Servernati-vi-serverlast updated 2018/11/273363 udpNATI Vi Servernati-vi-serverlast updated 2018/11/273364 tcpCreative Servercreativeserverlast updated 2018/11/273364 udpCreative Servercreativeserverlast updated 2018/11/273365 tcpContent Servercontentserverlast updated 2018/11/273365 udpContent Servercontentserverlast updated 2018/11/273366 tcpCreative Partnercreativepartnrlast updated 2018/11/273366 udpCreative Partnercreativepartnrlast updated 2018/11/273367-3371 Satellite Video Data Linksatvid-datalnklast updated 2018/11/273372 tcpTIP 2tip2last updated 2018/11/273372 udpTIP 2tip2last updated 2018/11/273373 tcpLavenir License Managerlavenir-lmlast updated 2018/11/273373 udpLavenir License Managerlavenir-lmlast updated 2018/11/273374 tcpCluster Disccluster-disclast updated 2018/11/273374 udpCluster Disccluster-disclast updated 2018/11/273375 tcpVSNM Agentvsnm-agentlast updated 2018/11/273375 udpVSNM Agentvsnm-agentlast updated 2018/11/273376 tcpCD Brokercdbrokerlast updated 2018/11/273376 udpCD Brokercdbrokerlast updated 2018/11/273377 tcpCogsys Network License Managercogsys-lmlast updated 2018/11/273377 udpCogsys Network License Managercogsys-lmlast updated 2018/11/273378 tcpWSICOPYwsicopylast updated 2018/11/273378 udpWSICOPYwsicopylast updated 2018/11/273379 tcpSOCORFSsocorfslast updated 2018/11/273379 udpSOCORFSsocorfslast updated 2018/11/273380 tcpSNS Channelssns-channelslast updated 2018/11/273380 udpSNS Channelssns-channelslast updated 2018/11/273381 tcpGeneousgeneouslast updated 2018/11/273381 udpGeneousgeneouslast updated 2018/11/273382 tcpFujitsu Network Enhanced Antitheft functionfujitsu-neatlast updated 2018/11/273382 udpFujitsu Network Enhanced Antitheft functionfujitsu-neatlast updated 2018/11/273383 tcpEnterprise Software Products License Manageresp-lmlast updated 2018/11/273383 udpEnterprise Software Products License Manageresp-lmlast updated 2018/11/273384 tcpCluster Management Serviceshp-cliclast updated 2018/11/273384 udpHardware Managementhp-cliclast updated 2018/11/273385 tcpqnxnetmanqnxnetmanlast updated 2018/11/273385 udpqnxnetmanqnxnetmanlast updated 2018/11/273386 tcpGPRS Datagprs-datalast updated 2018/11/273386 udpGPRS SIGgprs-siglast updated 2018/11/273387 tcpBack Room Netbackroomnetlast updated 2018/11/273387 udpBack Room Netbackroomnetlast updated 2018/11/273388 tcpCB Servercbserverlast updated 2018/11/273388 udpCB Servercbserverlast updated 2018/11/273389 tcpMS WBT Serverms-wbt-serverlast updated 2018/11/273389 udpMS WBT Serverms-wbt-serverlast updated 2018/11/273390 tcpDistributed Service Coordinatordsclast updated 2018/11/273390 udpDistributed Service Coordinatordsclast updated 2018/11/273391 tcpSAVANTsavantlast updated 2018/11/273391 udpSAVANTsavantlast updated 2018/11/273392 tcpEFI License Managementefi-lmlast updated 2018/11/273392 udpEFI License Managementefi-lmlast updated 2018/11/273393 tcpD2K Tapestry Client to Serverd2k-tapestry1last updated 2018/11/273393 udpD2K Tapestry Client to Serverd2k-tapestry1last updated 2018/11/273394 tcpD2K Tapestry Server to Serverd2k-tapestry2last updated 2018/11/273394 udpD2K Tapestry Server to Serverd2k-tapestry2last updated 2018/11/273395 tcpDyna License Manager (Elam)dyna-lmlast updated 2018/11/273395 udpDyna License Manager (Elam)dyna-lmlast updated 2018/11/273396 tcpPrinter Agent IANA assigned this well-formed service name as a replacement for "printer_agent".printer-agentlast updated 2018/11/273396 tcp (printer_agent)Printer Agentprinter_agentlast updated 2018/11/273396 udpPrinter Agent IANA assigned this well-formed service name as a replacement for "printer_agent".printer-agentlast updated 2018/11/273396 udp (printer_agent)Printer Agentprinter_agentlast updated 2018/11/273397 tcpCloanto License Managercloanto-lmlast updated 2018/11/273397 udpCloanto License Managercloanto-lmlast updated 2018/11/273398 tcpMercantilemercantilelast updated 2018/11/273398 udpMercantilemercantilelast updated 2018/11/273399 tcpCSMScsmslast updated 2018/11/273399 udpCSMScsmslast updated 2018/11/273400 tcpCSMS2csms2last updated 2018/11/273400 udpCSMS2csms2last updated 2018/11/273401 tcpfilecastfilecastlast updated 2018/11/273401 udpfilecastfilecastlast updated 2018/11/273402 tcpFXa Engine Network Portfxaengine-netlast updated 2018/11/273402 udpFXa Engine Network Portfxaengine-netlast updated 2018/11/273403 De-registeredN/Alast updated 2018/11/273404 RemovedN/Alast updated 2018/11/273405 tcpNokia Announcement ch 1nokia-ann-ch1last updated 2018/11/273405 udpNokia Announcement ch 1nokia-ann-ch1last updated 2018/11/273406 tcpNokia Announcement ch 2nokia-ann-ch2last updated 2018/11/273406 udpNokia Announcement ch 2nokia-ann-ch2last updated 2018/11/273407 tcpLDAP admin server portldap-adminlast updated 2018/11/273407 udpLDAP admin server portldap-adminlast updated 2018/11/273408 tcpBES Api PortBESApilast updated 2018/11/273408 udpBES Api PortBESApilast updated 2018/11/273409 tcpNetworkLens Event Portnetworklenslast updated 2018/11/273409 udpNetworkLens Event Portnetworklenslast updated 2018/11/273410 tcpNetworkLens SSL Eventnetworklensslast updated 2018/11/273410 udpNetworkLens SSL Eventnetworklensslast updated 2018/11/273411 tcpBioLink Authenteon serverbiolink-authlast updated 2018/11/273411 udpBioLink Authenteon serverbiolink-authlast updated 2018/11/273412 tcpxmlBlasterxmlblasterlast updated 2018/11/273412 udpxmlBlasterxmlblasterlast updated 2018/11/273413 tcpSpecView Networkingsvnetlast updated 2018/11/273413 udpSpecView Networkingsvnetlast updated 2018/11/273414 tcpBroadCloud WIP Portwip-portlast updated 2018/11/273414 udpBroadCloud WIP Portwip-portlast updated 2018/11/273415 tcpBCI Name Servicebcinameservicelast updated 2018/11/273415 udpBCI Name Servicebcinameservicelast updated 2018/11/273416 tcpAirMobile IS Command Portcommandportlast updated 2018/11/273416 udpAirMobile IS Command Portcommandportlast updated 2018/11/273417 tcpConServR file translationcsvrlast updated 2018/11/273417 udpConServR file translationcsvrlast updated 2018/11/273418 tcpRemote nmaprnmaplast updated 2018/11/273418 udpRemote nmaprnmaplast updated 2018/11/273419 tcpIsogon SoftAuditsoftauditlast updated 2018/11/273419 udpISogon SoftAuditsoftauditlast updated 2018/11/273420 tcpiFCP User Portifcp-portlast updated 2018/11/273420 udpiFCP User Portifcp-portlast updated 2018/11/273421 tcpBull Apprise portmapperbmaplast updated 2018/11/273421 udpBull Apprise portmapperbmaplast updated 2018/11/273422 tcpRemote USB System Portrusb-sys-portlast updated 2018/11/273422 udpRemote USB System Portrusb-sys-portlast updated 2018/11/273423 tcpxTrade Reliable Messagingxtrmlast updated 2018/11/273423 udpxTrade Reliable Messagingxtrmlast updated 2018/11/273424 tcpxTrade over TLS/SSLxtrmslast updated 2018/11/273424 udpxTrade over TLS/SSLxtrmslast updated 2018/11/273425 tcpAGPS Access Portagps-portlast updated 2018/11/273425 udpAGPS Access Portagps-portlast updated 2018/11/273426 tcpArkivio Storage Protocolarkiviolast updated 2018/11/273426 udpArkivio Storage Protocolarkiviolast updated 2018/11/273427 tcpWebSphere SNMPwebsphere-snmplast updated 2018/11/273427 udpWebSphere SNMPwebsphere-snmplast updated 2018/11/273428 tcp2Wire CSStwcsslast updated 2018/11/273428 udp2Wire CSStwcsslast updated 2018/11/273429 tcpGCSP user portgcsplast updated 2018/11/273429 udpGCSP user portgcsplast updated 2018/11/273430 tcpScott Studios Dispatchssdispatchlast updated 2018/11/273430 udpScott Studios Dispatchssdispatchlast updated 2018/11/273431 tcpActive License Server Portndl-alslast updated 2018/11/273431 udpActive License Server Portndl-alslast updated 2018/11/273432 tcpSecure Device Protocolosdcplast updated 2018/11/273432 udpSecure Device Protocolosdcplast updated 2018/11/273433 tcpOPNET Service Management Platformopnet-smplast updated 2018/11/273433 udpOPNET Service Management Platformopnet-smplast updated 2018/11/273434 tcpOpenCM Serveropencmlast updated 2018/11/273434 udpOpenCM Serveropencmlast updated 2018/11/273435 tcpPacom Security User Portpacomlast updated 2018/11/273435 udpPacom Security User Portpacomlast updated 2018/11/273436 tcpGuardControl Exchange Protocolgc-configlast updated 2018/11/273436 udpGuardControl Exchange Protocolgc-configlast updated 2018/11/273437 tcpAutocue Directory Serviceautocuedslast updated 2018/11/273437 udpAutocue Directory Serviceautocuedslast updated 2018/11/273438 tcpSpiralcraft Adminspiral-adminlast updated 2018/11/273438 udpSpiralcraft Adminspiral-adminlast updated 2018/11/273439 tcpHRI Interface Porthri-portlast updated 2018/11/273439 udpHRI Interface Porthri-portlast updated 2018/11/273440 tcpNet Steward Mgmt Consoleans-consolelast updated 2018/11/273440 udpNet Steward Mgmt Consoleans-consolelast updated 2018/11/273441 tcpOC Connect Clientconnect-clientlast updated 2018/11/273441 udpOC Connect Clientconnect-clientlast updated 2018/11/273442 tcpOC Connect Serverconnect-serverlast updated 2018/11/273442 udpOC Connect Serverconnect-serverlast updated 2018/11/273443 tcpOpenView Network Node Manager WEB Serverov-nnm-websrvlast updated 2018/11/273443 udpOpenView Network Node Manager WEB Serverov-nnm-websrvlast updated 2018/11/273444 tcpDenali Serverdenali-serverlast updated 2018/11/273444 udpDenali Serverdenali-serverlast updated 2018/11/273445 tcpMedia Object Networkmonplast updated 2018/11/273445 udpMedia Object Networkmonplast updated 2018/11/273446 tcp3Com FAX RPC port3comfaxrpclast updated 2018/11/273446 udp3Com FAX RPC port3comfaxrpclast updated 2018/11/273447 tcpDirectNet IM Systemdirectnetlast updated 2018/11/273447 udpDirectNet IM Systemdirectnetlast updated 2018/11/273448 tcpDiscovery and Net Configdnc-portlast updated 2018/11/273448 udpDiscovery and Net Configdnc-portlast updated 2018/11/273449 tcpHotU Chathotu-chatlast updated 2018/11/273449 udpHotU Chathotu-chatlast updated 2018/11/273450 tcpCAStorProxycastorproxylast updated 2018/11/273450 udpCAStorProxycastorproxylast updated 2018/11/273451 tcpASAM Servicesasamlast updated 2018/11/273451 udpASAM Servicesasamlast updated 2018/11/273452 tcpSABP-Signalling Protocolsabp-signallast updated 2018/11/273452 udpSABP-Signalling Protocolsabp-signallast updated 2018/11/273453 tcpPSC Updatepscupdlast updated 2018/11/273453 udpPSC Updatepscupdlast updated 2018/11/273454 tcpApple Remote Access Protocolmiralast updated 2018/11/273454 udpApple Remote Access Protocolmiralast updated 2018/11/273455 tcpRSVP Portprsvplast updated 2018/11/273455 udpRSVP Portprsvplast updated 2018/11/273456 tcpVAT default datavatlast updated 2018/11/273456 udpVAT default datavatlast updated 2018/11/273457 tcpVAT default controlvat-controllast updated 2018/11/273457 udpVAT default controlvat-controllast updated 2018/11/273458 tcpD3WinOSFId3winosfilast updated 2018/11/273458 udpD3WinOSFId3winosfilast updated 2018/11/273459 tcpTIP Integralintegrallast updated 2018/11/273459 udpTIP Integralintegrallast updated 2018/11/273460 tcpEDM Mangeredm-managerlast updated 2018/11/273460 udpEDM Mangeredm-managerlast updated 2018/11/273461 tcpEDM Stageredm-stagerlast updated 2018/11/273461 udpEDM Stageredm-stagerlast updated 2018/11/273462 tcpEDM STD Notifyedm-std-notifylast updated 2018/11/273462 udpEDM STD Notifyedm-std-notifylast updated 2018/11/273463 tcpEDM ADM Notifyedm-adm-notifylast updated 2018/11/273463 udpEDM ADM Notifyedm-adm-notifylast updated 2018/11/273464 tcpEDM MGR Syncedm-mgr-synclast updated 2018/11/273464 udpEDM MGR Syncedm-mgr-synclast updated 2018/11/273465 tcpEDM MGR Cntrledm-mgr-cntrllast updated 2018/11/273465 udpEDM MGR Cntrledm-mgr-cntrllast updated 2018/11/273466 tcpWORKFLOWworkflowlast updated 2018/11/273466 udpWORKFLOWworkflowlast updated 2018/11/273467 tcpRCSTrcstlast updated 2018/11/273467 udpRCSTrcstlast updated 2018/11/273468 tcpTTCM Remote Controllttcmremotectrllast updated 2018/11/273468 udpTTCM Remote Controllttcmremotectrllast updated 2018/11/273469 tcpPluribuspluribuslast updated 2018/11/273469 udpPluribuspluribuslast updated 2018/11/273470 tcpjt400jt400last updated 2018/11/273470 udpjt400jt400last updated 2018/11/273471 tcpjt400-ssljt400-ssllast updated 2018/11/273471 udpjt400-ssljt400-ssllast updated 2018/11/273472 tcpJAUGS N-G Remotec 1jaugsremotec-1last updated 2018/11/273472 udpJAUGS N-G Remotec 1jaugsremotec-1last updated 2018/11/273473 tcpJAUGS N-G Remotec 2jaugsremotec-2last updated 2018/11/273473 udpJAUGS N-G Remotec 2jaugsremotec-2last updated 2018/11/273474 tcpTSP Automationttntspautolast updated 2018/11/273474 udpTSP Automationttntspautolast updated 2018/11/273475 tcpGenisar Comm Portgenisar-portlast updated 2018/11/273475 udpGenisar Comm Portgenisar-portlast updated 2018/11/273476 tcpNVIDIA Mgmt Protocolnppmplast updated 2018/11/273476 udpNVIDIA Mgmt Protocolnppmplast updated 2018/11/273477 tcpeComm link portecommlast updated 2018/11/273477 udpeComm link portecommlast updated 2018/11/273478 tcpSession Traversal Utilities for NAT (STUN) portstunlast updated 2018/11/273478 udpSession Traversal Utilities for NAT (STUN) portstunlast updated 2018/11/273478 tcp (turn)TURN over TCPturnlast updated 2018/11/273478 udp (turn)TURN over UDPturnlast updated 2018/11/273478 tcp (stun-behavior)STUN Behavior Discovery over TCPstun-behaviorlast updated 2018/11/273478 udp (stun-behavior)STUN Behavior Discovery over UDPstun-behaviorlast updated 2018/11/273479 tcp2Wire RPCtwrpclast updated 2018/11/273479 udp2Wire RPCtwrpclast updated 2018/11/273480 tcpSecure Virtual Workspaceplethoralast updated 2018/11/273480 udpSecure Virtual Workspaceplethoralast updated 2018/11/273481 tcpCleanerLive remote ctrlcleanerliverclast updated 2018/11/273481 udpCleanerLive remote ctrlcleanerliverclast updated 2018/11/273482 tcpVulture Monitoring Systemvulturelast updated 2018/11/273482 udpVulture Monitoring Systemvulturelast updated 2018/11/273483 tcpSlim Devices Protocolslim-deviceslast updated 2018/11/273483 udpSlim Devices Protocolslim-deviceslast updated 2018/11/273484 tcpGBS SnapTalk Protocolgbs-stplast updated 2018/11/273484 udpGBS SnapTalk Protocolgbs-stplast updated 2018/11/273485 tcpCelaTalkcelatalklast updated 2018/11/273485 udpCelaTalkcelatalklast updated 2018/11/273486 tcpIFSF Heartbeat Portifsf-hb-portlast updated 2018/11/273486 udpIFSF Heartbeat Portifsf-hb-portlast updated 2018/11/273487 tcpLISA TCP Transfer Channelltctcplast updated 2018/11/273487 udpLISA UDP Transfer Channelltcudplast updated 2018/11/273488 tcpFS Remote Host Serverfs-rh-srvlast updated 2018/11/273488 udpFS Remote Host Serverfs-rh-srvlast updated 2018/11/273489 tcpDTP/DIAdtp-dialast updated 2018/11/273489 udpDTP/DIAdtp-dialast updated 2018/11/273490 tcpColubris Management Portcolubrislast updated 2018/11/273490 udpColubris Management Portcolubrislast updated 2018/11/273491 tcpSWR Portswr-portlast updated 2018/11/273491 udpSWR Portswr-portlast updated 2018/11/273492 tcpTVDUM Tray Porttvdumtray-portlast updated 2018/11/273492 udpTVDUM Tray Porttvdumtray-portlast updated 2018/11/273493 tcpNetwork UPS Toolsnutlast updated 2018/11/273493 udpNetwork UPS Toolsnutlast updated 2018/11/273494 tcpIBM 3494ibm3494last updated 2018/11/273494 udpIBM 3494ibm3494last updated 2018/11/273495 tcpsecuritylayer over tcpseclayer-tcplast updated 2018/11/273495 udpsecuritylayer over tcpseclayer-tcplast updated 2018/11/273496 tcpsecuritylayer over tlsseclayer-tlslast updated 2018/11/273496 udpsecuritylayer over tlsseclayer-tlslast updated 2018/11/273497 tcpipEther232Portipether232portlast updated 2018/11/273497 udpipEther232Portipether232portlast updated 2018/11/273498 tcpDASHPAS user portdashpas-portlast updated 2018/11/273498 udpDASHPAS user portdashpas-portlast updated 2018/11/273499 tcpSccIP Mediasccip-medialast updated 2018/11/273499 udpSccIP Mediasccip-medialast updated 2018/11/273500 tcpRTMP Portrtmp-portlast updated 2018/11/273500 udpRTMP Portrtmp-portlast updated 2018/11/273501 tcpiSoft-P2Pisoft-p2plast updated 2018/11/273501 udpiSoft-P2Pisoft-p2plast updated 2018/11/273502 tcpAvocent Install Discoveryavinstalldisclast updated 2018/11/273502 udpAvocent Install Discoveryavinstalldisclast updated 2018/11/273503 tcpMPLS LSP-echo Portlsp-pinglast updated 2018/11/273503 udpMPLS LSP-echo Portlsp-pinglast updated 2018/11/273504 tcpIronStorm game serverironstormlast updated 2018/11/273504 udpIronStorm game serverironstormlast updated 2018/11/273505 tcpCCM communications portccmcommlast updated 2018/11/273505 udpCCM communications portccmcommlast updated 2018/11/273506 tcpAPC 3506apc-3506last updated 2018/11/273506 udpAPC 3506apc-3506last updated 2018/11/273507 tcpNesh Broker Portnesh-brokerlast updated 2018/11/273507 udpNesh Broker Portnesh-brokerlast updated 2018/11/273508 tcpInteraction Webinteractionweblast updated 2018/11/273508 udpInteraction Webinteractionweblast updated 2018/11/273509 tcpVirtual Token SSL Portvt-ssllast updated 2018/11/273509 udpVirtual Token SSL Portvt-ssllast updated 2018/11/273510 tcpXSS Portxss-portlast updated 2018/11/273510 udpXSS Portxss-portlast updated 2018/11/273511 tcpWebMail/2webmail-2last updated 2018/11/273511 udpWebMail/2webmail-2last updated 2018/11/273512 tcpAztec Distribution Portazteclast updated 2018/11/273512 udpAztec Distribution Portazteclast updated 2018/11/273513 tcpAdaptec Remote Protocolarcpdlast updated 2018/11/273513 udpAdaptec Remote Protocolarcpdlast updated 2018/11/273514 tcpMUST Peer to Peermust-p2plast updated 2018/11/273514 udpMUST Peer to Peermust-p2plast updated 2018/11/273515 tcpMUST Backplanemust-backplanelast updated 2018/11/273515 udpMUST Backplanemust-backplanelast updated 2018/11/273516 tcpSmartcard Portsmartcard-portlast updated 2018/11/273516 udpSmartcard Portsmartcard-portlast updated 2018/11/273517 tcpIEEE 802.11 WLANs WG IAPP802-11-iapplast updated 2018/11/273517 udpIEEE 802.11 WLANs WG IAPP802-11-iapplast updated 2018/11/273518 tcpArtifact Message Serverartifact-msglast updated 2018/11/273518 udpArtifact Message Serverartifact-msglast updated 2018/11/273519 tcpNetvion Messenger Portnvmsgdlast updated 2018/11/273519 udpNetvion Galileo Portgalileolast updated 2018/11/273520 tcpNetvion Galileo Log Portgalileologlast updated 2018/11/273520 udpNetvion Galileo Log Portgalileologlast updated 2018/11/273521 tcpTelequip Labs MC3SSmc3sslast updated 2018/11/273521 udpTelequip Labs MC3SSmc3sslast updated 2018/11/273522 tcpDO over NSSocketPortnssocketportlast updated 2018/11/273522 udpDO over NSSocketPortnssocketportlast updated 2018/11/273523 tcpOdeum Serverlinkodeumservlinklast updated 2018/11/273523 udpOdeum Serverlinkodeumservlinklast updated 2018/11/273524 tcpECM Server portecmportlast updated 2018/11/273524 udpECM Server portecmportlast updated 2018/11/273525 tcpEIS Server porteisportlast updated 2018/11/273525 udpEIS Server porteisportlast updated 2018/11/273526 tcpstarQuiz Portstarquiz-portlast updated 2018/11/273526 udpstarQuiz Portstarquiz-portlast updated 2018/11/273527 tcpVERITAS Backup Exec Serverbeserver-msg-qlast updated 2018/11/273527 udpVERITAS Backup Exec Serverbeserver-msg-qlast updated 2018/11/273528 tcpJBoss IIOPjboss-iioplast updated 2018/11/273528 udpJBoss IIOPjboss-iioplast updated 2018/11/273529 tcpJBoss IIOP/SSLjboss-iiop-ssllast updated 2018/11/273529 udpJBoss IIOP/SSLjboss-iiop-ssllast updated 2018/11/273530 tcpGrid Friendlygflast updated 2018/11/273530 udpGrid Friendlygflast updated 2018/11/273531 tcpJoltidjoltidlast updated 2018/11/273531 udpJoltidjoltidlast updated 2018/11/273532 tcpRaven Remote Management Controlraven-rmplast updated 2018/11/273532 udpRaven Remote Management Controlraven-rmplast updated 2018/11/273533 tcpRaven Remote Management Dataraven-rdplast updated 2018/11/273533 udpRaven Remote Management Dataraven-rdplast updated 2018/11/273534 tcpURL Daemon Porturld-portlast updated 2018/11/273534 udpURL Daemon Porturld-portlast updated 2018/11/273535 tcpMS-LAms-lalast updated 2018/11/273535 udpMS-LAms-lalast updated 2018/11/273536 tcpSNACsnaclast updated 2018/11/273536 udpSNACsnaclast updated 2018/11/273537 tcpRemote NI-VISA portni-visa-remotelast updated 2018/11/273537 udpRemote NI-VISA portni-visa-remotelast updated 2018/11/273538 tcpIBM Directory Serveribm-diradmlast updated 2018/11/273538 udpIBM Directory Serveribm-diradmlast updated 2018/11/273539 tcpIBM Directory Server SSLibm-diradm-ssllast updated 2018/11/273539 udpIBM Directory Server SSLibm-diradm-ssllast updated 2018/11/273540 tcpPNRP User Portpnrp-portlast updated 2018/11/273540 udpPNRP User Portpnrp-portlast updated 2018/11/273541 tcpVoiSpeed Portvoispeed-portlast updated 2018/11/273541 udpVoiSpeed Portvoispeed-portlast updated 2018/11/273542 tcpHA cluster monitorhacl-monitorlast updated 2018/11/273542 udpHA cluster monitorhacl-monitorlast updated 2018/11/273543 tcpqftest Lookup Portqftest-lookuplast updated 2018/11/273543 udpqftest Lookup Portqftest-lookuplast updated 2018/11/273544 tcpTeredo Portteredolast updated 2018/11/273544 udpTeredo Portteredolast updated 2018/11/273545 tcpCAMAC equipmentcamaclast updated 2018/11/273545 udpCAMAC equipmentcamaclast updated 2018/11/273546 UnassignedN/Alast updated 2018/11/273547 tcpSymantec SIMsymantec-simlast updated 2018/11/273547 udpSymantec SIMsymantec-simlast updated 2018/11/273548 tcpInterworldinterworldlast updated 2018/11/273548 udpInterworldinterworldlast updated 2018/11/273549 tcpTellumat MDR NMStellumat-nmslast updated 2018/11/273549 udpTellumat MDR NMStellumat-nmslast updated 2018/11/273550 tcpSecure SMPPssmpplast updated 2018/11/273550 udpSecure SMPPssmpplast updated 2018/11/273551 tcpApcupsd Information Portapcupsdlast updated 2018/11/273551 udpApcupsd Information Portapcupsdlast updated 2018/11/273552 tcpTeamAgenda Server Porttaserverlast updated 2018/11/273552 udpTeamAgenda Server Porttaserverlast updated 2018/11/273553 tcpRed Box Recorder ADPrbr-discoverylast updated 2018/11/273553 udpRed Box Recorder ADPrbr-discoverylast updated 2018/11/273554 tcpQuest Notification Serverquestnotifylast updated 2018/11/273554 udpQuest Notification Serverquestnotifylast updated 2018/11/273555 tcpVipul's Razorrazorlast updated 2018/11/273555 udpVipul's Razorrazorlast updated 2018/11/273556 tcpSky Transport Protocolsky-transportlast updated 2018/11/273556 udpSky Transport Protocolsky-transportlast updated 2018/11/273557 tcpPersonalOS Comm Portpersonalos-001last updated 2018/11/273557 udpPersonalOS Comm Portpersonalos-001last updated 2018/11/273558 tcpMCP user portmcp-portlast updated 2018/11/273558 udpMCP user portmcp-portlast updated 2018/11/273559 tcpCCTV control portcctv-portlast updated 2018/11/273559 udpCCTV control portcctv-portlast updated 2018/11/273560 tcpINIServe portiniserve-portlast updated 2018/11/273560 udpINIServe portiniserve-portlast updated 2018/11/273561 tcpBMC-OneKeybmc-onekeylast updated 2018/11/273561 udpBMC-OneKeybmc-onekeylast updated 2018/11/273562 tcpSDBProxysdbproxylast updated 2018/11/273562 udpSDBProxysdbproxylast updated 2018/11/273563 tcpWatcom Debugwatcomdebuglast updated 2018/11/273563 udpWatcom Debugwatcomdebuglast updated 2018/11/273564 tcpElectromed SIM portesimportlast updated 2018/11/273564 udpElectromed SIM portesimportlast updated 2018/11/273565 tcpM2PAm2palast updated 2018/11/273565 udpReservedN/Alast updated 2018/11/273565 sctpM2PAm2palast updated 2018/11/273566 tcpQuest Data Hubquest-data-hublast updated 2018/11/273566 udpReservedN/Alast updated 2018/11/273567 tcpDOF Protocol Stackdof-epslast updated 2018/11/273567 udpDOF Protocol Stackdof-epslast updated 2018/11/273568 tcpDOF Secure Tunneldof-tunnel-seclast updated 2018/11/273568 udpDOF Secure Tunneldof-tunnel-seclast updated 2018/11/273569 tcpMeinberg Control Servicembg-ctrllast updated 2018/11/273569 udpMeinberg Control Servicembg-ctrllast updated 2018/11/273570 tcpMCC Web Server Portmccwebsvr-portlast updated 2018/11/273570 udpMCC Web Server Portmccwebsvr-portlast updated 2018/11/273571 tcpMegaRAID Server Portmegardsvr-portlast updated 2018/11/273571 udpMegaRAID Server Portmegardsvr-portlast updated 2018/11/273572 tcpRegistration Server Portmegaregsvrportlast updated 2018/11/273572 udpRegistration Server Portmegaregsvrportlast updated 2018/11/273573 tcpAdvantage Group UPS Suitetag-ups-1last updated 2018/11/273573 udpAdvantage Group UPS Suitetag-ups-1last updated 2018/11/273574 tcpDMAF Serverdmaf-serverlast updated 2018/11/273574 udpDMAF Casterdmaf-casterlast updated 2018/11/273575 tcpCoalsere CCM Portccm-portlast updated 2018/11/273575 udpCoalsere CCM Portccm-portlast updated 2018/11/273576 tcpCoalsere CMC Portcmc-portlast updated 2018/11/273576 udpCoalsere CMC Portcmc-portlast updated 2018/11/273577 tcpConfiguration Portconfig-portlast updated 2018/11/273577 udpConfiguration Portconfig-portlast updated 2018/11/273578 tcpData Portdata-portlast updated 2018/11/273578 udpData Portdata-portlast updated 2018/11/273579 tcpTarantella Load Balancingttat3lblast updated 2018/11/273579 udpTarantella Load Balancingttat3lblast updated 2018/11/273580 tcpNATI-ServiceLocatornati-svrloclast updated 2018/11/273580 udpNATI-ServiceLocatornati-svrloclast updated 2018/11/273581 tcpAscent Capture Licensingkfxaclicensinglast updated 2018/11/273581 udpAscent Capture Licensingkfxaclicensinglast updated 2018/11/273582 tcpPEG PRESS Serverpresslast updated 2018/11/273582 udpPEG PRESS Serverpresslast updated 2018/11/273583 tcpCANEX Watch Systemcanex-watchlast updated 2018/11/273583 udpCANEX Watch Systemcanex-watchlast updated 2018/11/273584 tcpU-DBase Access Protocolu-dbaplast updated 2018/11/273584 udpU-DBase Access Protocolu-dbaplast updated 2018/11/273585 tcpEmprise License Serveremprise-llslast updated 2018/11/273585 udpEmprise License Serveremprise-llslast updated 2018/11/273586 tcpLicense Server Consoleemprise-lsclast updated 2018/11/273586 udpLicense Server Consoleemprise-lsclast updated 2018/11/273587 tcpPeer to Peer Groupingp2pgrouplast updated 2018/11/273587 udpPeer to Peer Groupingp2pgrouplast updated 2018/11/273588 tcpSentinel Serversentinellast updated 2018/11/273588 udpSentinel Serversentinellast updated 2018/11/273589 tcpisomairisomairlast updated 2018/11/273589 udpisomairisomairlast updated 2018/11/273590 tcpWV CSP SMS Bindingwv-csp-smslast updated 2018/11/273590 udpWV CSP SMS Bindingwv-csp-smslast updated 2018/11/273591 tcpLOCANIS G-TRACK Servergtrack-serverlast updated 2018/11/273591 udpLOCANIS G-TRACK Servergtrack-serverlast updated 2018/11/273592 tcpLOCANIS G-TRACK NE Portgtrack-nelast updated 2018/11/273592 udpLOCANIS G-TRACK NE Portgtrack-nelast updated 2018/11/273593 tcpBP Model Debuggerbpmdlast updated 2018/11/273593 udpBP Model Debuggerbpmdlast updated 2018/11/273594 tcpMediaSpacemediaspacelast updated 2018/11/273594 udpMediaSpacemediaspacelast updated 2018/11/273595 tcpShareAppshareapplast updated 2018/11/273595 udpShareAppshareapplast updated 2018/11/273596 tcpIllusion Wireless MMOGiw-mmogamelast updated 2018/11/273596 udpIllusion Wireless MMOGiw-mmogamelast updated 2018/11/273597 tcpA14 (AN-to-SC/MM)a14last updated 2018/11/273597 udpA14 (AN-to-SC/MM)a14last updated 2018/11/273598 tcpA15 (AN-to-AN)a15last updated 2018/11/273598 udpA15 (AN-to-AN)a15last updated 2018/11/273599 tcpQuasar Accounting Serverquasar-serverlast updated 2018/11/273599 udpQuasar Accounting Serverquasar-serverlast updated 2018/11/273600 tcptext relay-answertrap-daemonlast updated 2018/11/273600 udptext relay-answertrap-daemonlast updated 2018/11/273601 tcpVisinet Guivisinet-guilast updated 2018/11/273601 udpVisinet Guivisinet-guilast updated 2018/11/273602 tcpInfiniSwitch Mgr Clientinfiniswitchcllast updated 2018/11/273602 udpInfiniSwitch Mgr Clientinfiniswitchcllast updated 2018/11/273603 tcpIntegrated Rcvr Controlint-rcv-cntrllast updated 2018/11/273603 udpIntegrated Rcvr Controlint-rcv-cntrllast updated 2018/11/273604 tcpBMC JMX Portbmc-jmx-portlast updated 2018/11/273604 udpBMC JMX Portbmc-jmx-portlast updated 2018/11/273605 tcpComCam IO Portcomcam-iolast updated 2018/11/273605 udpComCam IO Portcomcam-iolast updated 2018/11/273606 tcpSplitlock Serversplitlocklast updated 2018/11/273606 udpSplitlock Serversplitlocklast updated 2018/11/273607 tcpPrecise I3precise-i3last updated 2018/11/273607 udpPrecise I3precise-i3last updated 2018/11/273608 tcpTrendchip control protocoltrendchip-dcplast updated 2018/11/273608 udpTrendchip control protocoltrendchip-dcplast updated 2018/11/273609 tcpCPDI PIDAS Connection Moncpdi-pidas-cmlast updated 2018/11/273609 udpCPDI PIDAS Connection Moncpdi-pidas-cmlast updated 2018/11/273610 tcpECHONETechonetlast updated 2018/11/273610 udpECHONETechonetlast updated 2018/11/273611 tcpSix Degrees Portsix-degreeslast updated 2018/11/273611 udpSix Degrees Portsix-degreeslast updated 2018/11/273612 tcpHP Data Protectorhp-dataprotectlast updated 2018/11/273612 udpHP Data Protectorhp-dataprotectlast updated 2018/11/273613 tcpAlaris Device Discoveryalaris-disclast updated 2018/11/273613 udpAlaris Device Discoveryalaris-disclast updated 2018/11/273614 tcpSatchwell Sigmasigma-portlast updated 2018/11/273614 udpSatchwell Sigmasigma-portlast updated 2018/11/273615 tcpStart Messaging Networkstart-networklast updated 2018/11/273615 udpStart Messaging Networkstart-networklast updated 2018/11/273616 tcpcd3o Control Protocolcd3o-protocollast updated 2018/11/273616 udpcd3o Control Protocolcd3o-protocollast updated 2018/11/273617 tcpATI SHARP Logic Enginesharp-serverlast updated 2018/11/273617 udpATI SHARP Logic Enginesharp-serverlast updated 2018/11/273618 tcpAAIR-Network 1aairnet-1last updated 2018/11/273618 udpAAIR-Network 1aairnet-1last updated 2018/11/273619 tcpAAIR-Network 2aairnet-2last updated 2018/11/273619 udpAAIR-Network 2aairnet-2last updated 2018/11/273620 tcpEPSON Projector Control Portep-pcplast updated 2018/11/273620 udpEPSON Projector Control Portep-pcplast updated 2018/11/273621 tcpEPSON Network Screen Portep-nsplast updated 2018/11/273621 udpEPSON Network Screen Portep-nsplast updated 2018/11/273622 tcpFF LAN Redundancy Portff-lr-portlast updated 2018/11/273622 udpFF LAN Redundancy Portff-lr-portlast updated 2018/11/273623 tcpHAIPIS Dynamic Discoveryhaipe-discoverlast updated 2018/11/273623 udpHAIPIS Dynamic Discoveryhaipe-discoverlast updated 2018/11/273624 tcpDistributed Upgrade Portdist-upgradelast updated 2018/11/273624 udpDistributed Upgrade Portdist-upgradelast updated 2018/11/273625 tcpVolleyvolleylast updated 2018/11/273625 udpVolleyvolleylast updated 2018/11/273626 tcpbvControl Daemonbvcdaemon-portlast updated 2018/11/273626 udpbvControl Daemonbvcdaemon-portlast updated 2018/11/273627 tcpJam Server Portjamserverportlast updated 2018/11/273627 udpJam Server Portjamserverportlast updated 2018/11/273628 tcpEPT Machine Interfaceept-machinelast updated 2018/11/273628 udpEPT Machine Interfaceept-machinelast updated 2018/11/273629 tcpESC/VP.netescvpnetlast updated 2018/11/273629 udpESC/VP.netescvpnetlast updated 2018/11/273630 tcpC&S Remote Database Portcs-remote-dblast updated 2018/11/273630 udpC&S Remote Database Portcs-remote-dblast updated 2018/11/273631 tcpC&S Web Services Portcs-serviceslast updated 2018/11/273631 udpC&S Web Services Portcs-serviceslast updated 2018/11/273632 tcpdistributed compilerdistcclast updated 2018/11/273632 udpdistributed compilerdistcclast updated 2018/11/273633 tcpWyrnix AIS portwacplast updated 2018/11/273633 udpWyrnix AIS portwacplast updated 2018/11/273634 tcphNTSP Library Managerhlibmgrlast updated 2018/11/273634 udphNTSP Library Managerhlibmgrlast updated 2018/11/273635 tcpSimple Distributed Objectssdolast updated 2018/11/273635 udpSimple Distributed Objectssdolast updated 2018/11/273636 tcpSerVistaITSMservistaitsmlast updated 2018/11/273636 udpSerVistaITSMservistaitsmlast updated 2018/11/273637 tcpCustomer Service Portscservplast updated 2018/11/273637 udpCustomer Service Portscservplast updated 2018/11/273638 tcpEHP Backup Protocolehp-backuplast updated 2018/11/273638 udpEHP Backup Protocolehp-backuplast updated 2018/11/273639 tcpExtensible Automationxap-halast updated 2018/11/273639 udpExtensible Automationxap-halast updated 2018/11/273640 tcpNetplay Port 1netplay-port1last updated 2018/11/273640 udpNetplay Port 1netplay-port1last updated 2018/11/273641 tcpNetplay Port 2netplay-port2last updated 2018/11/273641 udpNetplay Port 2netplay-port2last updated 2018/11/273642 tcpJuxml Replication portjuxml-portlast updated 2018/11/273642 udpJuxml Replication portjuxml-portlast updated 2018/11/273643 tcpAudioJuggleraudiojugglerlast updated 2018/11/273643 udpAudioJuggleraudiojugglerlast updated 2018/11/273644 tcpssowatchssowatchlast updated 2018/11/273644 udpssowatchssowatchlast updated 2018/11/273645 tcpCyccyclast updated 2018/11/273645 udpCyccyclast updated 2018/11/273646 tcpXSS Server Portxss-srv-portlast updated 2018/11/273646 udpXSS Server Portxss-srv-portlast updated 2018/11/273647 tcpSplitlock Gatewaysplitlock-gwlast updated 2018/11/273647 udpSplitlock Gatewaysplitlock-gwlast updated 2018/11/273648 tcpFujitsu Cooperation Portfjcplast updated 2018/11/273648 udpFujitsu Cooperation Portfjcplast updated 2018/11/273649 tcpNishioka Miyuki Msg Protocolnmmplast updated 2018/11/273649 udpNishioka Miyuki Msg Protocolnmmplast updated 2018/11/273650 tcpPRISMIQ VOD plug-inprismiq-pluginlast updated 2018/11/273650 udpPRISMIQ VOD plug-inprismiq-pluginlast updated 2018/11/273651 tcpXRPC Registryxrpc-registrylast updated 2018/11/273651 udpXRPC Registryxrpc-registrylast updated 2018/11/273652 tcpVxCR NBU Default Portvxcrnbuportlast updated 2018/11/273652 udpVxCR NBU Default Portvxcrnbuportlast updated 2018/11/273653 tcpTunnel Setup Protocoltsplast updated 2018/11/273653 udpTunnel Setup Protocoltsplast updated 2018/11/273654 tcpVAP RealTime Messengervaprtmlast updated 2018/11/273654 udpVAP RealTime Messengervaprtmlast updated 2018/11/273655 tcpActiveBatch Exec Agentabatemgrlast updated 2018/11/273655 udpActiveBatch Exec Agentabatemgrlast updated 2018/11/273656 tcpActiveBatch Job Schedulerabatjsslast updated 2018/11/273656 udpActiveBatch Job Schedulerabatjsslast updated 2018/11/273657 tcpImmediaNet Beaconimmedianet-bcnlast updated 2018/11/273657 udpImmediaNet Beaconimmedianet-bcnlast updated 2018/11/273658 tcpPlayStation AMS (Secure)ps-amslast updated 2018/11/273658 udpPlayStation AMS (Secure)ps-amslast updated 2018/11/273659 tcpApple SASLapple-sasllast updated 2018/11/273659 udpApple SASLapple-sasllast updated 2018/11/273660 tcpIBM Tivoli Directory Service using SSLcan-nds-ssllast updated 2018/11/273660 udpIBM Tivoli Directory Service using SSLcan-nds-ssllast updated 2018/11/273661 tcpIBM Tivoli Directory Service using SSLcan-ferret-ssllast updated 2018/11/273661 udpIBM Tivoli Directory Service using SSLcan-ferret-ssllast updated 2018/11/273662 tcppserverpserverlast updated 2018/11/273662 udppserverpserverlast updated 2018/11/273663 tcpDIRECWAY Tunnel Protocoldtplast updated 2018/11/273663 udpDIRECWAY Tunnel Protocoldtplast updated 2018/11/273664 tcpUPS Engine Portups-enginelast updated 2018/11/273664 udpUPS Engine Portups-enginelast updated 2018/11/273665 tcpEnterprise Engine Portent-enginelast updated 2018/11/273665 udpEnterprise Engine Portent-enginelast updated 2018/11/273666 tcpIBM eServer PAPeserver-paplast updated 2018/11/273666 udpIBM EServer PAPeserver-paplast updated 2018/11/273667 tcpIBM Information Exchangeinfoexchlast updated 2018/11/273667 udpIBM Information Exchangeinfoexchlast updated 2018/11/273668 tcpDell Remote Managementdell-rm-portlast updated 2018/11/273668 udpDell Remote Managementdell-rm-portlast updated 2018/11/273669 tcpCA SAN Switch Managementcasanswmgmtlast updated 2018/11/273669 udpCA SAN Switch Managementcasanswmgmtlast updated 2018/11/273670 tcpSMILE TCP/UDP Interfacesmilelast updated 2018/11/273670 udpSMILE TCP/UDP Interfacesmilelast updated 2018/11/273671 tcpe Field Control (EIBnet)efcplast updated 2018/11/273671 udpe Field Control (EIBnet)efcplast updated 2018/11/273672 tcpLispWorks ORBlispworks-orblast updated 2018/11/273672 udpLispWorks ORBlispworks-orblast updated 2018/11/273673 tcpOpenview Media Vault GUImediavault-guilast updated 2018/11/273673 udpOpenview Media Vault GUImediavault-guilast updated 2018/11/273674 tcpWinINSTALL IPC Portwininstall-ipclast updated 2018/11/273674 udpWinINSTALL IPC Portwininstall-ipclast updated 2018/11/273675 tcpCallTrax Data Portcalltraxlast updated 2018/11/273675 udpCallTrax Data Portcalltraxlast updated 2018/11/273676 tcpVisualAge Pacbase serverva-pacbaselast updated 2018/11/273676 udpVisualAge Pacbase serverva-pacbaselast updated 2018/11/273677 tcpRoverLog IPCroverloglast updated 2018/11/273677 udpRoverLog IPCroverloglast updated 2018/11/273678 tcpDataGuardianLTipr-dgltlast updated 2018/11/273678 udpDataGuardianLTipr-dgltlast updated 2018/11/273679 tcpNewton DockEscale (Newton Dock)last updated 2018/11/273679 udpNewton DockEscale (Newton Dock)last updated 2018/11/273680 tcpNPDS Trackernpds-trackerlast updated 2018/11/273680 udpNPDS Trackernpds-trackerlast updated 2018/11/273681 tcpBTS X73 Portbts-x73last updated 2018/11/273681 udpBTS X73 Portbts-x73last updated 2018/11/273682 tcpEMC SmartPackets-MAPIcas-mapilast updated 2018/11/273682 udpEMC SmartPackets-MAPIcas-mapilast updated 2018/11/273683 tcpBMC EDV/EAbmc-ealast updated 2018/11/273683 udpBMC EDV/EAbmc-ealast updated 2018/11/273684 tcpFAXstfXfaxstfx-portlast updated 2018/11/273684 udpFAXstfXfaxstfx-portlast updated 2018/11/273685 tcpDS Expert Agentdsx-agentlast updated 2018/11/273685 udpDS Expert Agentdsx-agentlast updated 2018/11/273686 tcpTrivial Network Managementtnmpv2last updated 2018/11/273686 udpTrivial Network Managementtnmpv2last updated 2018/11/273687 tcpsimple-pushsimple-pushlast updated 2018/11/273687 udpsimple-pushsimple-pushlast updated 2018/11/273688 tcpsimple-push Securesimple-push-slast updated 2018/11/273688 udpsimple-push Securesimple-push-slast updated 2018/11/273689 tcpDigital Audio Access Protocol (iTunes)daaplast updated 2018/11/273689 udpDigital Audio Access Protocol (iTunes)daaplast updated 2018/11/273690 tcpSubversionsvnlast updated 2018/11/273690 udpSubversionsvnlast updated 2018/11/273691 tcpMagaya Network Portmagaya-networklast updated 2018/11/273691 udpMagaya Network Portmagaya-networklast updated 2018/11/273692 tcpBrimstone IntelSyncintelsynclast updated 2018/11/273692 udpBrimstone IntelSyncintelsynclast updated 2018/11/273693 tcpEmergency Automatic Structure Lockdown Systemeasllast updated 2018/11/273693 udpReservedN/Alast updated 2018/11/273694 UnassignedN/Alast updated 2018/11/273695 tcpBMC Data Collectionbmc-data-colllast updated 2018/11/273695 udpBMC Data Collectionbmc-data-colllast updated 2018/11/273696 tcpTelnet Com Port Controltelnetcpcdlast updated 2018/11/273696 udpTelnet Com Port Controltelnetcpcdlast updated 2018/11/273697 tcpNavisWorks License Systemnw-licenselast updated 2018/11/273697 udpNavisWorks Licnese Systemnw-licenselast updated 2018/11/273698 tcpSAGECTLPANELsagectlpanellast updated 2018/11/273698 udpSAGECTLPANELsagectlpanellast updated 2018/11/273699 tcpInternet Call Waitingkpn-icwlast updated 2018/11/273699 udpInternet Call Waitingkpn-icwlast updated 2018/11/273700 tcpLRS NetPagelrs-paginglast updated 2018/11/273700 udpLRS NetPagelrs-paginglast updated 2018/11/273701 tcpNetCeleranetceleralast updated 2018/11/273701 udpNetCeleranetceleralast updated 2018/11/273702 tcpWeb Service Discoveryws-discoverylast updated 2018/11/273702 udpWeb Service Discoveryws-discoverylast updated 2018/11/273703 tcpAdobe Server 3adobeserver-3last updated 2018/11/273703 udpAdobe Server 3adobeserver-3last updated 2018/11/273704 tcpAdobe Server 4adobeserver-4last updated 2018/11/273704 udpAdobe Server 4adobeserver-4last updated 2018/11/273705 tcpAdobe Server 5adobeserver-5last updated 2018/11/273705 udpAdobe Server 5adobeserver-5last updated 2018/11/273706 tcpReal-Time Event Portrt-eventlast updated 2018/11/273706 udpReal-Time Event Portrt-eventlast updated 2018/11/273707 tcpReal-Time Event Secure Portrt-event-slast updated 2018/11/273707 udpReal-Time Event Secure Portrt-event-slast updated 2018/11/273708 tcpSun App Svr - Namingsun-as-iiopslast updated 2018/11/273708 udpSun App Svr - Namingsun-as-iiopslast updated 2018/11/273709 tcpCA-IDMS Serverca-idmslast updated 2018/11/273709 udpCA-IDMS Serverca-idmslast updated 2018/11/273710 tcpPortGate Authenticationportgate-authlast updated 2018/11/273710 udpPortGate Authenticationportgate-authlast updated 2018/11/273711 tcpEBD Server 2edb-server2last updated 2018/11/273711 udpEBD Server 2edb-server2last updated 2018/11/273712 tcpSentinel Enterprisesentinel-entlast updated 2018/11/273712 udpSentinel Enterprisesentinel-entlast updated 2018/11/273713 tcpTFTP over TLStftpslast updated 2018/11/273713 udpTFTP over TLStftpslast updated 2018/11/273714 tcpDELOS Direct Messagingdelos-dmslast updated 2018/11/273714 udpDELOS Direct Messagingdelos-dmslast updated 2018/11/273715 tcpAnoto Rendezvous Portanoto-rendezvlast updated 2018/11/273715 udpAnoto Rendezvous Portanoto-rendezvlast updated 2018/11/273716 tcpWV CSP SMS CIR Channelwv-csp-sms-cirlast updated 2018/11/273716 udpWV CSP SMS CIR Channelwv-csp-sms-cirlast updated 2018/11/273717 tcpWV CSP UDP/IP CIR Channelwv-csp-udp-cirlast updated 2018/11/273717 udpWV CSP UDP/IP CIR Channelwv-csp-udp-cirlast updated 2018/11/273718 tcpOPUS Server Portopus-serviceslast updated 2018/11/273718 udpOPUS Server Portopus-serviceslast updated 2018/11/273719 tcpiTel Server Portitelserverportlast updated 2018/11/273719 udpiTel Server Portitelserverportlast updated 2018/11/273720 tcpUF Astro. Instr. Servicesufastro-instrlast updated 2018/11/273720 udpUF Astro. Instr. Servicesufastro-instrlast updated 2018/11/273721 tcpXsyncxsynclast updated 2018/11/273721 udpXsyncxsynclast updated 2018/11/273722 tcpXserve RAIDxserveraidlast updated 2018/11/273722 udpXserve RAIDxserveraidlast updated 2018/11/273723 tcpSychron Service Daemonsychrondlast updated 2018/11/273723 udpSychron Service Daemonsychrondlast updated 2018/11/273724 tcpWorld of Warcraftblizwowlast updated 2018/11/273724 udpWorld of Warcraftblizwowlast updated 2018/11/273725 tcpNetia NA-ER Portna-er-tiplast updated 2018/11/273725 udpNetia NA-ER Portna-er-tiplast updated 2018/11/273726 tcpXyratex Array Managerarray-managerlast updated 2018/11/273726 udpXyartex Array Managerarray-managerlast updated 2018/11/273727 tcpEricsson Mobile Data Unite-mdulast updated 2018/11/273727 udpEricsson Mobile Data Unite-mdulast updated 2018/11/273728 tcpEricsson Web on Aire-woalast updated 2018/11/273728 udpEricsson Web on Aire-woalast updated 2018/11/273729 tcpFireking Audit Portfksp-auditlast updated 2018/11/273729 udpFireking Audit Portfksp-auditlast updated 2018/11/273730 tcpClient Controlclient-ctrllast updated 2018/11/273730 udpClient Controlclient-ctrllast updated 2018/11/273731 tcpService Managersmaplast updated 2018/11/273731 udpService Managersmaplast updated 2018/11/273732 tcpMobile Wnnm-wnnlast updated 2018/11/273732 udpMobile Wnnm-wnnlast updated 2018/11/273733 tcpMultipuesto Msg Portmultip-msglast updated 2018/11/273733 udpMultipuesto Msg Portmultip-msglast updated 2018/11/273734 tcpSynel Data Collection Portsynel-datalast updated 2018/11/273734 udpSynel Data Collection Portsynel-datalast updated 2018/11/273735 tcpPassword Distributionpwdislast updated 2018/11/273735 udpPassword Distributionpwdislast updated 2018/11/273736 tcpRealSpace RMIrs-rmilast updated 2018/11/273736 udpRealSpace RMIrs-rmilast updated 2018/11/273737 tcpXPanel Daemonxpanellast updated 2018/11/273737 udpReservedN/Alast updated 2018/11/273738 tcpversaTalk Server Portversatalklast updated 2018/11/273738 udpversaTalk Server Portversatalklast updated 2018/11/273739 tcpLaunchbird LicenseManagerlaunchbird-lmlast updated 2018/11/273739 udpLaunchbird LicenseManagerlaunchbird-lmlast updated 2018/11/273740 tcpHeartbeat Protocolheartbeatlast updated 2018/11/273740 udpHeartbeat Protocolheartbeatlast updated 2018/11/273741 tcpWysDM Agentwysdmalast updated 2018/11/273741 udpWysDM Agentwysdmalast updated 2018/11/273742 tcpCST - Configuration & Service Trackercst-portlast updated 2018/11/273742 udpCST - Configuration & Service Trackercst-portlast updated 2018/11/273743 tcpIP Control Systems Ltd.ipcs-commandlast updated 2018/11/273743 udpIP Control Systems Ltd.ipcs-commandlast updated 2018/11/273744 tcpSASGsasglast updated 2018/11/273744 udpSASGsasglast updated 2018/11/273745 tcpGWRTC Call Portgw-call-portlast updated 2018/11/273745 udpGWRTC Call Portgw-call-portlast updated 2018/11/273746 tcpLXPRO.COM LinkTestlinktestlast updated 2018/11/273746 udpLXPRO.COM LinkTestlinktestlast updated 2018/11/273747 tcpLXPRO.COM LinkTest SSLlinktest-slast updated 2018/11/273747 udpLXPRO.COM LinkTest SSLlinktest-slast updated 2018/11/273748 tcpwebDatawebdatalast updated 2018/11/273748 udpwebDatawebdatalast updated 2018/11/273749 tcpCimTrakcimtraklast updated 2018/11/273749 udpCimTrakcimtraklast updated 2018/11/273750 tcpCBOS/IP ncapsalation portcbos-ip-portlast updated 2018/11/273750 udpCBOS/IP ncapsalatoin portcbos-ip-portlast updated 2018/11/273751 tcpCommLinx GPRS Cubegprs-cubelast updated 2018/11/273751 udpCommLinx GPRS Cubegprs-cubelast updated 2018/11/273752 tcpVigil-IP RemoteAgentvipremoteagentlast updated 2018/11/273752 udpVigil-IP RemoteAgentvipremoteagentlast updated 2018/11/273753 tcpNattyServer Portnattyserverlast updated 2018/11/273753 udpNattyServer Portnattyserverlast updated 2018/11/273754 tcpTimesTen Broker Porttimestenbrokerlast updated 2018/11/273754 udpTimesTen Broker Porttimestenbrokerlast updated 2018/11/273755 tcpSAS Remote Help Serversas-remote-hlplast updated 2018/11/273755 udpSAS Remote Help Serversas-remote-hlplast updated 2018/11/273756 tcpCanon CAPT Portcanon-captlast updated 2018/11/273756 udpCanon CAPT Portcanon-captlast updated 2018/11/273757 tcpGRF Server Portgrf-portlast updated 2018/11/273757 udpGRF Server Portgrf-portlast updated 2018/11/273758 tcpapw RMI registryapw-registrylast updated 2018/11/273758 udpapw RMI registryapw-registrylast updated 2018/11/273759 tcpExapt License Managerexapt-lmgrlast updated 2018/11/273759 udpExapt License Managerexapt-lmgrlast updated 2018/11/273760 tcpadTempus Clientadtempusclientlast updated 2018/11/273760 udpadTEmpus Clientadtempusclientlast updated 2018/11/273761 tcpgsakmp portgsakmplast updated 2018/11/273761 udpgsakmp portgsakmplast updated 2018/11/273762 tcpGBS SnapMail Protocolgbs-smplast updated 2018/11/273762 udpGBS SnapMail Protocolgbs-smplast updated 2018/11/273763 tcpXO Wave Control Portxo-wavelast updated 2018/11/273763 udpXO Wave Control Portxo-wavelast updated 2018/11/273764 tcpMNI Protected Routingmni-prot-routlast updated 2018/11/273764 udpMNI Protected Routingmni-prot-routlast updated 2018/11/273765 tcpRemote Traceroutertraceroutelast updated 2018/11/273765 udpRemote Traceroutertraceroutelast updated 2018/11/273766 tcpSSL e-watch sitewatch serversitewatch-slast updated 2018/11/273766 udpReservedN/Alast updated 2018/11/273767 tcpListMGR Portlistmgr-portlast updated 2018/11/273767 udpListMGR Portlistmgr-portlast updated 2018/11/273768 tcprblcheckd server daemonrblcheckdlast updated 2018/11/273768 udprblcheckd server daemonrblcheckdlast updated 2018/11/273769 tcpHAIPE Network Keyinghaipe-otnklast updated 2018/11/273769 udpHAIPE Network Keyinghaipe-otnklast updated 2018/11/273770 tcpCinderella Collaborationcindycollablast updated 2018/11/273770 udpCinderella Collaborationcindycollablast updated 2018/11/273771 tcpRTP Paging Portpaging-portlast updated 2018/11/273771 udpRTP Paging Portpaging-portlast updated 2018/11/273772 tcpChantry Tunnel Protocolctplast updated 2018/11/273772 udpChantry Tunnel Protocolctplast updated 2018/11/273773 tcpctdherculesctdherculeslast updated 2018/11/273773 udpctdherculesctdherculeslast updated 2018/11/273774 tcpZICOMzicomlast updated 2018/11/273774 udpZICOMzicomlast updated 2018/11/273775 tcpISPM Manager Portispmmgrlast updated 2018/11/273775 udpISPM Manager Portispmmgrlast updated 2018/11/273776 tcpDevice Provisioning Portdvcprov-portlast updated 2018/11/273776 udpDevice Provisioning Portdvcprov-portlast updated 2018/11/273777 tcpJibe EdgeBurstjibe-eblast updated 2018/11/273777 udpJibe EdgeBurstjibe-eblast updated 2018/11/273778 tcpCutler-Hammer IT Portc-h-it-portlast updated 2018/11/273778 udpCutler-Hammer IT Portc-h-it-portlast updated 2018/11/273779 tcpCognima Replicationcognimalast updated 2018/11/273779 udpCognima Replicationcognimalast updated 2018/11/273780 tcpNuzzler Network Protocolnnplast updated 2018/11/273780 udpNuzzler Network Protocolnnplast updated 2018/11/273781 tcpABCvoice server portabcvoice-portlast updated 2018/11/273781 udpABCvoice server portabcvoice-portlast updated 2018/11/273782 tcpSecure ISO TP0 portiso-tp0slast updated 2018/11/273782 udpSecure ISO TP0 portiso-tp0slast updated 2018/11/273783 tcpImpact Mgr./PEM Gatewaybim-pemlast updated 2018/11/273783 udpImpact Mgr./PEM Gatewaybim-pemlast updated 2018/11/273784 tcpBFD Control Protocolbfd-controllast updated 2018/11/273784 udpBFD Control Protocolbfd-controllast updated 2018/11/273785 tcpBFD Echo Protocolbfd-echolast updated 2018/11/273785 udpBFD Echo Protocolbfd-echolast updated 2018/11/273786 tcpVSW Upstrigger portupstriggervswlast updated 2018/11/273786 udpVSW Upstrigger portupstriggervswlast updated 2018/11/273787 tcpFintrxfintrxlast updated 2018/11/273787 udpFintrxfintrxlast updated 2018/11/273788 tcpSPACEWAY Routing portisrp-portlast updated 2018/11/273788 udpSPACEWAY Routing portisrp-portlast updated 2018/11/273789 tcpRemoteDeploy Administration Port [July 2003]remotedeploylast updated 2018/11/273789 udpRemoteDeploy Administration Port [July 2003]remotedeploylast updated 2018/11/273790 tcpQuickBooks RDSquickbooksrdslast updated 2018/11/273790 udpQuickBooks RDSquickbooksrdslast updated 2018/11/273791 tcpTV NetworkVideo Data porttvnetworkvideolast updated 2018/11/273791 udpTV NetworkVideo Data porttvnetworkvideolast updated 2018/11/273792 tcpe-Watch Corporation SiteWatchsitewatchlast updated 2018/11/273792 udpe-Watch Corporation SiteWatchsitewatchlast updated 2018/11/273793 tcpDataCore Softwaredcsoftwarelast updated 2018/11/273793 udpDataCore Softwaredcsoftwarelast updated 2018/11/273794 tcpJAUS Robotsjauslast updated 2018/11/273794 udpJAUS Robotsjauslast updated 2018/11/273795 tcpmyBLAST Mekentosj portmyblastlast updated 2018/11/273795 udpmyBLAST Mekentosj portmyblastlast updated 2018/11/273796 tcpSpaceway Dialerspw-dialerlast updated 2018/11/273796 udpSpaceway Dialerspw-dialerlast updated 2018/11/273797 tcpidpsidpslast updated 2018/11/273797 udpidpsidpslast updated 2018/11/273798 tcpMinilockminilocklast updated 2018/11/273798 udpMinilockminilocklast updated 2018/11/273799 tcpRADIUS Dynamic Authorizationradius-dynauthlast updated 2018/11/273799 udpRADIUS Dynamic Authorizationradius-dynauthlast updated 2018/11/273800 tcpPrint Services Interfacepwgpsilast updated 2018/11/273800 udpPrint Services Interfacepwgpsilast updated 2018/11/273801 tcpibm manager serviceibm-mgrlast updated 2018/11/273801 udpibm manager serviceibm-mgrlast updated 2018/11/273802 tcpVHDvhdlast updated 2018/11/273802 udpVHDvhdlast updated 2018/11/273803 tcpSoniqSyncsoniqsynclast updated 2018/11/273803 udpSoniqSyncsoniqsynclast updated 2018/11/273804 tcpHarman IQNet Portiqnet-portlast updated 2018/11/273804 udpHarman IQNet Portiqnet-portlast updated 2018/11/273805 tcpThorGuard Server Porttcpdataserverlast updated 2018/11/273805 udpThorGuard Server Porttcpdataserverlast updated 2018/11/273806 tcpRemote System Managerwsmlblast updated 2018/11/273806 udpRemote System Managerwsmlblast updated 2018/11/273807 tcpSpuGNA Communication Portspugnalast updated 2018/11/273807 udpSpuGNA Communication Portspugnalast updated 2018/11/273808 tcpSun App Svr-IIOPClntAuthsun-as-iiops-calast updated 2018/11/273808 udpSun App Svr-IIOPClntAuthsun-as-iiops-calast updated 2018/11/273809 tcpJava Desktop System Configuration Agentapocdlast updated 2018/11/273809 udpJava Desktop System Configuration Agentapocdlast updated 2018/11/273810 tcpWLAN AS serverwlanauthlast updated 2018/11/273810 udpWLAN AS serverwlanauthlast updated 2018/11/273811 tcpAMPamplast updated 2018/11/273811 udpAMPamplast updated 2018/11/273812 tcpnetO WOL Serverneto-wol-serverlast updated 2018/11/273812 udpnetO WOL Serverneto-wol-serverlast updated 2018/11/273813 tcpRhapsody Interface Protocolrap-iplast updated 2018/11/273813 udpRhapsody Interface Protocolrap-iplast updated 2018/11/273814 tcpnetO DCSneto-dcslast updated 2018/11/273814 udpnetO DCSneto-dcslast updated 2018/11/273815 tcpLANsurveyor XMLlansurveyorxmllast updated 2018/11/273815 udpLANsurveyor XMLlansurveyorxmllast updated 2018/11/273816 tcpSun Local Patch Serversunlps-httplast updated 2018/11/273816 udpSun Local Patch Serversunlps-httplast updated 2018/11/273817 tcpYosemite Tech Tapewaretapewarelast updated 2018/11/273817 udpYosemite Tech Tapewaretapewarelast updated 2018/11/273818 tcpCrinis Heartbeatcrinis-hblast updated 2018/11/273818 udpCrinis Heartbeatcrinis-hblast updated 2018/11/273819 tcpEPL Sequ Layer Protocolepl-slplast updated 2018/11/273819 udpEPL Sequ Layer Protocolepl-slplast updated 2018/11/273820 tcpSiemens AuD SCPscplast updated 2018/11/273820 udpSiemens AuD SCPscplast updated 2018/11/273821 tcpATSC PMCP Standardpmcplast updated 2018/11/273821 udpATSC PMCP Standardpmcplast updated 2018/11/273822 tcpCompute Pool Discoveryacp-discoverylast updated 2018/11/273822 udpCompute Pool Discoveryacp-discoverylast updated 2018/11/273823 tcpCompute Pool Conduitacp-conduitlast updated 2018/11/273823 udpCompute Pool Conduitacp-conduitlast updated 2018/11/273824 tcpCompute Pool Policyacp-policylast updated 2018/11/273824 udpCompute Pool Policyacp-policylast updated 2018/11/273825 tcpAntera FlowFusion Process Simulationffserverlast updated 2018/11/273825 udpAntera FlowFusion Process Simulationffserverlast updated 2018/11/273826 tcpWarMUX game serverwarmuxlast updated 2018/11/273826 udpWarMUX game serverwarmuxlast updated 2018/11/273827 tcpNetadmin Systems MPI servicenetmpilast updated 2018/11/273827 udpNetadmin Systems MPI servicenetmpilast updated 2018/11/273828 tcpNetadmin Systems Event Handlernetehlast updated 2018/11/273828 udpNetadmin Systems Event Handlernetehlast updated 2018/11/273829 tcpNetadmin Systems Event Handler Externalneteh-extlast updated 2018/11/273829 udpNetadmin Systems Event Handler Externalneteh-extlast updated 2018/11/273830 tcpCerner System Management Agentcernsysmgmtagtlast updated 2018/11/273830 udpCerner System Management Agentcernsysmgmtagtlast updated 2018/11/273831 tcpDocsvault Application Servicedvappslast updated 2018/11/273831 udpDocsvault Application Servicedvappslast updated 2018/11/273832 tcpxxNETserverxxnetserverlast updated 2018/11/273832 udpxxNETserverxxnetserverlast updated 2018/11/273833 tcpAIPN LS Authenticationaipn-authlast updated 2018/11/273833 udpAIPN LS Authenticationaipn-authlast updated 2018/11/273834 tcpSpectar Data Stream Servicespectardatalast updated 2018/11/273834 udpSpectar Data Stream Servicespectardatalast updated 2018/11/273835 tcpSpectar Database Rights Servicespectardblast updated 2018/11/273835 udpSpectar Database Rights Servicespectardblast updated 2018/11/273836 tcpMARKEM NEXTGEN DCPmarkem-dcplast updated 2018/11/273836 udpMARKEM NEXTGEN DCPmarkem-dcplast updated 2018/11/273837 tcpMARKEM Auto-Discoverymkm-discoverylast updated 2018/11/273837 udpMARKEM Auto-Discoverymkm-discoverylast updated 2018/11/273838 tcpScito Object Serversoslast updated 2018/11/273838 udpScito Object Serversoslast updated 2018/11/273839 tcpAMX Resource Management Suiteamx-rmslast updated 2018/11/273839 udpAMX Resource Management Suiteamx-rmslast updated 2018/11/273840 tcpwww.FlirtMitMir.deflirtmitmirlast updated 2018/11/273840 udpwww.FlirtMitMir.deflirtmitmirlast updated 2018/11/273841 tcpShipRush Database Servershiprush-db-svrlast updated 2018/11/273841 udpReservedN/Alast updated 2018/11/273842 tcpNHCI status portnhcilast updated 2018/11/273842 udpNHCI status portnhcilast updated 2018/11/273843 tcpQuest Common Agentquest-agentlast updated 2018/11/273843 udpQuest Common Agentquest-agentlast updated 2018/11/273844 tcpRNMrnmlast updated 2018/11/273844 udpRNMrnmlast updated 2018/11/273845 tcpV-ONE Single Port Proxyv-one-spplast updated 2018/11/273845 udpV-ONE Single Port Proxyv-one-spplast updated 2018/11/273846 tcpAstare Network PCPan-pcplast updated 2018/11/273846 udpAstare Network PCPan-pcplast updated 2018/11/273847 tcpMS Firewall Controlmsfw-controllast updated 2018/11/273847 udpMS Firewall Controlmsfw-controllast updated 2018/11/273848 tcpIT Environmental Monitoritemlast updated 2018/11/273848 udpIT Environmental Monitoritemlast updated 2018/11/273849 tcpSPACEWAY DNS Preloadspw-dnspreloadlast updated 2018/11/273849 udpSPACEWAY DNS Prelaodspw-dnspreloadlast updated 2018/11/273850 tcpQTMS Bootstrap Protocolqtms-bootstraplast updated 2018/11/273850 udpQTMS Bootstrap Protocolqtms-bootstraplast updated 2018/11/273851 tcpSpectraTalk Portspectraportlast updated 2018/11/273851 udpSpectraTalk Portspectraportlast updated 2018/11/273852 tcpSSE App Configurationsse-app-configlast updated 2018/11/273852 udpSSE App Configurationsse-app-configlast updated 2018/11/273853 tcpSONY scanning protocolsscanlast updated 2018/11/273853 udpSONY scanning protocolsscanlast updated 2018/11/273854 tcpStryker Comm Portstryker-comlast updated 2018/11/273854 udpStryker Comm Portstryker-comlast updated 2018/11/273855 tcpOpenTRACopentraclast updated 2018/11/273855 udpOpenTRACopentraclast updated 2018/11/273856 tcpINFORMERinformerlast updated 2018/11/273856 udpINFORMERinformerlast updated 2018/11/273857 tcpTrap Porttrap-portlast updated 2018/11/273857 udpTrap Porttrap-portlast updated 2018/11/273858 tcpTrap Port MOMtrap-port-momlast updated 2018/11/273858 udpTrap Port MOMtrap-port-momlast updated 2018/11/273859 tcpNavini Portnav-portlast updated 2018/11/273859 udpNavini Portnav-portlast updated 2018/11/273860 tcpServer/Application State Protocol (SASP)sasplast updated 2018/11/273860 udpServer/Application State Protocol (SASP)sasplast updated 2018/11/273861 tcpwinShadow Host Discoverywinshadow-hdlast updated 2018/11/273861 udpwinShadow Host Discoverywinshadow-hdlast updated 2018/11/273862 tcpGIGA-POCKETgiga-pocketlast updated 2018/11/273862 udpGIGA-POCKETgiga-pocketlast updated 2018/11/273863 tcpasap tcp portasap-tcplast updated 2018/11/273863 udpasap udp portasap-udplast updated 2018/11/273863 sctpasap sctpasap-sctplast updated 2018/11/273864 tcpasap/tls tcp portasap-tcp-tlslast updated 2018/11/273864 udpReservedN/Alast updated 2018/11/273864 sctpasap-sctp/tlsasap-sctp-tlslast updated 2018/11/273865 tcpxpl automation protocolxpllast updated 2018/11/273865 udpxpl automation protocolxpllast updated 2018/11/273866 tcpSun SDViz DZDAEMON Portdzdaemonlast updated 2018/11/273866 udpSun SDViz DZDAEMON Portdzdaemonlast updated 2018/11/273867 tcpSun SDViz DZOGLSERVER Portdzoglserverlast updated 2018/11/273867 udpSun SDViz DZOGLSERVER Portdzoglserverlast updated 2018/11/273868 tcpDIAMETERdiameterlast updated 2018/11/273868 udpReservedN/Alast updated 2018/11/273868 sctpDIAMETERdiameterlast updated 2018/11/273869 tcphp OVSAM MgmtServer Discoovsam-mgmtlast updated 2018/11/273869 udphp OVSAM MgmtServer Discoovsam-mgmtlast updated 2018/11/273870 tcphp OVSAM HostAgent Discoovsam-d-agentlast updated 2018/11/273870 udphp OVSAM HostAgent Discoovsam-d-agentlast updated 2018/11/273871 tcpAvocent DS Authorizationavocent-adsaplast updated 2018/11/273871 udpAvocent DS Authorizationavocent-adsaplast updated 2018/11/273872 tcpOEM Agentoem-agentlast updated 2018/11/273872 udpOEM Agentoem-agentlast updated 2018/11/273873 tcpfagordncfagordnclast updated 2018/11/273873 udpfagordncfagordnclast updated 2018/11/273874 tcpSixXS Configurationsixxsconfiglast updated 2018/11/273874 udpSixXS Configurationsixxsconfiglast updated 2018/11/273875 tcpPNBSCADApnbscadalast updated 2018/11/273875 udpPNBSCADApnbscadalast updated 2018/11/273876 tcpDirectoryLockdown Agent IANA assigned this well-formed service name as a replacement for "dl_agent".dl-agentlast updated 2018/11/273876 tcp (dl_agent)DirectoryLockdown Agentdl_agentlast updated 2018/11/273876 udpDirectoryLockdown Agent IANA assigned this well-formed service name as a replacement for "dl_agent".dl-agentlast updated 2018/11/273876 udp (dl_agent)DirectoryLockdown Agentdl_agentlast updated 2018/11/273877 tcpXMPCR Interface Portxmpcr-interfacelast updated 2018/11/273877 udpXMPCR Interface Portxmpcr-interfacelast updated 2018/11/273878 tcpFotoG CAD interfacefotogcadlast updated 2018/11/273878 udpFotoG CAD interfacefotogcadlast updated 2018/11/273879 tcpappss license managerappss-lmlast updated 2018/11/273879 udpappss license managerappss-lmlast updated 2018/11/273880 tcpIGRSigrslast updated 2018/11/273880 udpIGRSigrslast updated 2018/11/273881 tcpData Acquisition and Controlidaclast updated 2018/11/273881 udpData Acquisition and Controlidaclast updated 2018/11/273882 tcpDTS Service Portmsdts1last updated 2018/11/273882 udpDTS Service Portmsdts1last updated 2018/11/273883 tcpVR Peripheral Networkvrpnlast updated 2018/11/273883 udpVR Peripheral Networkvrpnlast updated 2018/11/273884 tcpSofTrack Meteringsoftrack-meterlast updated 2018/11/273884 udpSofTrack Meteringsoftrack-meterlast updated 2018/11/273885 tcpTopFlow SSLtopflow-ssllast updated 2018/11/273885 udpTopFlow SSLtopflow-ssllast updated 2018/11/273886 tcpNEI management portnei-managementlast updated 2018/11/273886 udpNEI management portnei-managementlast updated 2018/11/273887 tcpCiphire Data Transportciphire-datalast updated 2018/11/273887 udpCiphire Data Transportciphire-datalast updated 2018/11/273888 tcpCiphire Servicesciphire-servlast updated 2018/11/273888 udpCiphire Servicesciphire-servlast updated 2018/11/273889 tcpD and V Tester Control Portdandv-testerlast updated 2018/11/273889 udpD and V Tester Control Portdandv-testerlast updated 2018/11/273890 tcpNiche Data Server Connectndsconnectlast updated 2018/11/273890 udpNiche Data Server Connectndsconnectlast updated 2018/11/273891 tcpOracle RTC-PM portrtc-pm-portlast updated 2018/11/273891 udpOracle RTC-PM portrtc-pm-portlast updated 2018/11/273892 tcpPCC-image-portpcc-image-portlast updated 2018/11/273892 udpPCC-image-portpcc-image-portlast updated 2018/11/273893 tcpCGI StarAPI Servercgi-starapilast updated 2018/11/273893 udpCGI StarAPI Servercgi-starapilast updated 2018/11/273894 tcpSyAM Agent Portsyam-agentlast updated 2018/11/273894 udpSyAM Agent Portsyam-agentlast updated 2018/11/273895 tcpSyAm SMC Service Portsyam-smclast updated 2018/11/273895 udpSyAm SMC Service Portsyam-smclast updated 2018/11/273896 tcpSimple Distributed Objects over TLSsdo-tlslast updated 2018/11/273896 udpSimple Distributed Objects over TLSsdo-tlslast updated 2018/11/273897 tcpSimple Distributed Objects over SSHsdo-sshlast updated 2018/11/273897 udpSimple Distributed Objects over SSHsdo-sshlast updated 2018/11/273898 tcpIAS, Inc. SmartEye NET Internet Protocolseniplast updated 2018/11/273898 udpIAS, Inc. SmartEye NET Internet Protocolseniplast updated 2018/11/273899 tcpITV Portitv-controllast updated 2018/11/273899 udpITV Portitv-controllast updated 2018/11/273900 tcpUnidata UDT OS IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 2018/11/273900 tcp (udt_os)Unidata UDT OSudt_oslast updated 2018/11/273900 udpUnidata UDT OS IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 2018/11/273900 udp (udt_os)Unidata UDT OSudt_oslast updated 2018/11/273901 tcpNIM Service Handlernimshlast updated 2018/11/273901 udpNIM Service Handlernimshlast updated 2018/11/273902 tcpNIMsh Auxiliary Portnimauxlast updated 2018/11/273902 udpNIMsh Auxiliary Portnimauxlast updated 2018/11/273903 tcpCharsetMGRcharsetmgrlast updated 2018/11/273903 udpCharsetMGRcharsetmgrlast updated 2018/11/273904 tcpArnet Omnilink Portomnilink-portlast updated 2018/11/273904 udpArnet Omnilink Portomnilink-portlast updated 2018/11/273905 tcpMailbox Update (MUPDATE) protocolmupdatelast updated 2018/11/273905 udpMailbox Update (MUPDATE) protocolmupdatelast updated 2018/11/273906 tcpTopoVista elevation datatopovista-datalast updated 2018/11/273906 udpTopoVista elevation datatopovista-datalast updated 2018/11/273907 tcpImoguia Portimoguia-portlast updated 2018/11/273907 udpImoguia Portimoguia-portlast updated 2018/11/273908 tcpHP Procurve NetManagementhppronetmanlast updated 2018/11/273908 udpHP Procurve NetManagementhppronetmanlast updated 2018/11/273909 tcpSurfControl CPAsurfcontrolcpalast updated 2018/11/273909 udpSurfControl CPAsurfcontrolcpalast updated 2018/11/273910 tcpPrinter Request Portprnrequestlast updated 2018/11/273910 udpPrinter Request Portprnrequestlast updated 2018/11/273911 tcpPrinter Status Portprnstatuslast updated 2018/11/273911 udpPrinter Status Portprnstatuslast updated 2018/11/273912 tcpGlobal Maintech Starsgbmt-starslast updated 2018/11/273912 udpGlobal Maintech Starsgbmt-starslast updated 2018/11/273913 tcpListCREATOR Portlistcrt-portlast updated 2018/11/273913 udpListCREATOR Portlistcrt-portlast updated 2018/11/273914 tcpListCREATOR Port 2listcrt-port-2last updated 2018/11/273914 udpListCREATOR Port 2listcrt-port-2last updated 2018/11/273915 tcpAuto-Graphics Catalogingagcatlast updated 2018/11/273915 udpAuto-Graphics Catalogingagcatlast updated 2018/11/273916 tcpWysDM Controllerwysdmclast updated 2018/11/273916 udpWysDM Controllerwysdmclast updated 2018/11/273917 tcpAFT multiplex portaftmuxlast updated 2018/11/273917 udpAFT multiples portaftmuxlast updated 2018/11/273918 tcpPacketCableMultimediaCOPSpktcablemmcopslast updated 2018/11/273918 udpPacketCableMultimediaCOPSpktcablemmcopslast updated 2018/11/273919 tcpHyperIPhyperiplast updated 2018/11/273919 udpHyperIPhyperiplast updated 2018/11/273920 tcpExasoft IP Portexasoftport1last updated 2018/11/273920 udpExasoft IP Portexasoftport1last updated 2018/11/273921 tcpHerodotus Netherodotus-netlast updated 2018/11/273921 udpHerodotus Netherodotus-netlast updated 2018/11/273922 tcpSoronti Update Portsor-updatelast updated 2018/11/273922 udpSoronti Update Portsor-updatelast updated 2018/11/273923 tcpSymbian Service Brokersymb-sb-portlast updated 2018/11/273923 udpSymbian Service Brokersymb-sb-portlast updated 2018/11/273924 tcpMPL_GPRS_PORTmpl-gprs-portlast updated 2018/11/273924 udpMPL_GPRS_Portmpl-gprs-portlast updated 2018/11/273925 tcpZoran Media Portzmplast updated 2018/11/273925 udpZoran Media Portzmplast updated 2018/11/273926 tcpWINPortwinportlast updated 2018/11/273926 udpWINPortwinportlast updated 2018/11/273927 tcpScsTsrnatdataservicelast updated 2018/11/273927 udpScsTsrnatdataservicelast updated 2018/11/273928 tcpPXE NetBoot Managernetboot-pxelast updated 2018/11/273928 udpPXE NetBoot Managernetboot-pxelast updated 2018/11/273929 tcpAMS Portsmauth-portlast updated 2018/11/273929 udpAMS Portsmauth-portlast updated 2018/11/273930 tcpSyam Web Server Portsyam-webserverlast updated 2018/11/273930 udpSyam Web Server Portsyam-webserverlast updated 2018/11/273931 tcpMSR Plugin Portmsr-plugin-portlast updated 2018/11/273931 udpMSR Plugin Portmsr-plugin-portlast updated 2018/11/273932 tcpDynamic Site Systemdyn-sitelast updated 2018/11/273932 udpDynamic Site Systemdyn-sitelast updated 2018/11/273933 tcpPL/B App Server User Portplbserve-portlast updated 2018/11/273933 udpPL/B App Server User Portplbserve-portlast updated 2018/11/273934 tcpPL/B File Manager Portsunfm-portlast updated 2018/11/273934 udpPL/B File Manager Portsunfm-portlast updated 2018/11/273935 tcpSDP Port Mapper Protocolsdp-portmapperlast updated 2018/11/273935 udpSDP Port Mapper Protocolsdp-portmapperlast updated 2018/11/273936 tcpMailproxmailproxlast updated 2018/11/273936 udpMailproxmailproxlast updated 2018/11/273937 tcpDVB Service Discoverydvbservdsclast updated 2018/11/273937 udpDVB Service Discoverydvbservdsclast updated 2018/11/273938 tcpOracle dbControl Agent po IANA assigned this well-formed service name as a replacement for "dbcontrol_agent".dbcontrol-agentlast updated 2018/11/273938 tcp (dbcontrol_agent)Oracle dbControl Agent podbcontrol_agentlast updated 2018/11/273938 udpOracel dbControl Agent po IANA assigned this well-formed service name as a replacement for "dbcontrol_agent".dbcontrol-agentlast updated 2018/11/273938 udp (dbcontrol_agent)Oracel dbControl Agent podbcontrol_agentlast updated 2018/11/273939 tcpAnti-virus Application Management Portaamplast updated 2018/11/273939 udpAnti-virus Application Management Portaamplast updated 2018/11/273940 tcpXeCP Node Servicexecp-nodelast updated 2018/11/273940 udpXeCP Node Servicexecp-nodelast updated 2018/11/273941 tcpHome Portal Web Serverhomeportal-weblast updated 2018/11/273941 udpHome Portal Web Serverhomeportal-weblast updated 2018/11/273942 tcpsatellite distributionsrdplast updated 2018/11/273942 udpsatellite distributionsrdplast updated 2018/11/273943 tcpTetraNode Ip Gatewaytiglast updated 2018/11/273943 udpTetraNode Ip Gatewaytiglast updated 2018/11/273944 tcpS-Ops Managementsopslast updated 2018/11/273944 udpS-Ops Managementsopslast updated 2018/11/273945 tcpEMCADS Server Portemcadslast updated 2018/11/273945 udpEMCADS Server Portemcadslast updated 2018/11/273946 tcpBackupEDGE Serverbackupedgelast updated 2018/11/273946 udpBackupEDGE Serverbackupedgelast updated 2018/11/273947 tcpConnect and Control Protocol for Consumer, Commercial, and Industrial Electronic Devicesccplast updated 2018/11/273947 udpConnect and Control Protocol for Consumer, Commercial, and Industrial Electronic Devicesccplast updated 2018/11/273948 tcpAnton Paar Device Administration Protocolapdaplast updated 2018/11/273948 udpAnton Paar Device Administration Protocolapdaplast updated 2018/11/273949 tcpDynamic Routing Information Protocoldriplast updated 2018/11/273949 udpDynamic Routing Information Protocoldriplast updated 2018/11/273950 tcpName Mungingnamemungelast updated 2018/11/273950 udpName Mungingnamemungelast updated 2018/11/273951 tcpPWG IPP Facsimilepwgippfaxlast updated 2018/11/273951 udpPWG IPP Facsimilepwgippfaxlast updated 2018/11/273952 tcpI3 Session Manageri3-sessionmgrlast updated 2018/11/273952 udpI3 Session Manageri3-sessionmgrlast updated 2018/11/273953 tcpEydeas XMLink Connectxmlink-connectlast updated 2018/11/273953 udpEydeas XMLink Connectxmlink-connectlast updated 2018/11/273954 tcpAD Replication RPCadreplast updated 2018/11/273954 udpAD Replication RPCadreplast updated 2018/11/273955 tcpp2pCommunityp2pcommunitylast updated 2018/11/273955 udpp2pCommunityp2pcommunitylast updated 2018/11/273956 tcpGigE Vision Controlgvcplast updated 2018/11/273956 udpGigE Vision Controlgvcplast updated 2018/11/273957 tcpMQEnterprise Brokermqe-brokerlast updated 2018/11/273957 udpMQEnterprise Brokermqe-brokerlast updated 2018/11/273958 tcpMQEnterprise Agentmqe-agentlast updated 2018/11/273958 udpMQEnterprise Agentmqe-agentlast updated 2018/11/273959 tcpTree Hopper Networkingtreehopperlast updated 2018/11/273959 udpTree Hopper Networkingtreehopperlast updated 2018/11/273960 tcpBess Peer Assessmentbesslast updated 2018/11/273960 udpBess Peer Assessmentbesslast updated 2018/11/273961 tcpProAxess Serverproaxesslast updated 2018/11/273961 udpProAxess Serverproaxesslast updated 2018/11/273962 tcpSBI Agent Protocolsbi-agentlast updated 2018/11/273962 udpSBI Agent Protocolsbi-agentlast updated 2018/11/273963 tcpTeran Hybrid Routing Protocolthrplast updated 2018/11/273963 udpTeran Hybrid Routing Protocolthrplast updated 2018/11/273964 tcpSASG GPRSsasggprslast updated 2018/11/273964 udpSASG GPRSsasggprslast updated 2018/11/273965 tcpAvanti IP to NCPE APIati-ip-to-ncpelast updated 2018/11/273965 udpAvanti IP to NCPE APIati-ip-to-ncpelast updated 2018/11/273966 tcpBuildForge Lock Managerbflckmgrlast updated 2018/11/273966 udpBuildForge Lock Managerbflckmgrlast updated 2018/11/273967 tcpPPS Message Serviceppsmslast updated 2018/11/273967 udpPPS Message Serviceppsmslast updated 2018/11/273968 tcpiAnywhere DBNSianywhere-dbnslast updated 2018/11/273968 udpiAnywhere DBNSianywhere-dbnslast updated 2018/11/273969 tcpLandmark Messageslandmarkslast updated 2018/11/273969 udpLandmark Messageslandmarkslast updated 2018/11/273970 tcpLANrev Agentlanrevagentlast updated 2018/11/273970 udpLANrev Agentlanrevagentlast updated 2018/11/273971 tcpLANrev Serverlanrevserverlast updated 2018/11/273971 udpLANrev Serverlanrevserverlast updated 2018/11/273972 tcpict-control Protocoliconplast updated 2018/11/273972 udpict-control Protocoliconplast updated 2018/11/273973 tcpConnectShip Progisticsprogisticslast updated 2018/11/273973 udpConnectShip Progisticsprogisticslast updated 2018/11/273974 tcpRemote Applicant Tracking Servicecitysearchlast updated 2018/11/273974 udpRemote Applicant Tracking Servicecitysearchlast updated 2018/11/273975 tcpAir Shotairshotlast updated 2018/11/273975 udpAir Shotairshotlast updated 2018/11/273976 tcpServer Automation Agentopswagentlast updated 2018/11/273976 udpServer Automation Agentopswagentlast updated 2018/11/273977 tcpOpsware Manageropswmanagerlast updated 2018/11/273977 udpOpsware Manageropswmanagerlast updated 2018/11/273978 tcpSecured Configuration Serversecure-cfg-svrlast updated 2018/11/273978 udpSecured Configuration Serversecure-cfg-svrlast updated 2018/11/273979 tcpSmith Micro Wide Area Network Servicesmwanlast updated 2018/11/273979 udpSmith Micro Wide Area Network Servicesmwanlast updated 2018/11/273980 tcpAircraft Cabin Management Systemacmslast updated 2018/11/273980 udpAircraft Cabin Management Systemacmslast updated 2018/11/273981 tcpStarfish System Adminstarfishlast updated 2018/11/273981 udpStarfish System Adminstarfishlast updated 2018/11/273982 tcpESRI Image Servereislast updated 2018/11/273982 udpESRI Image Servereislast updated 2018/11/273983 tcpESRI Image Serviceeisplast updated 2018/11/273983 udpESRI Image Serviceeisplast updated 2018/11/273984 tcpMAPPER network node managermapper-nodemgrlast updated 2018/11/273984 udpMAPPER network node managermapper-nodemgrlast updated 2018/11/273985 tcpMAPPER TCP/IP servermapper-mapethdlast updated 2018/11/273985 udpMAPPER TCP/IP servermapper-mapethdlast updated 2018/11/273986 tcpMAPPER workstation server IANA assigned this well-formed service name as a replacement for "mapper-ws_ethd".mapper-ws-ethdlast updated 2018/11/273986 tcp (mapper-ws_ethd)MAPPER workstation servermapper-ws_ethdlast updated 2018/11/273986 udpMAPPER workstation server IANA assigned this well-formed service name as a replacement for "mapper-ws_ethd".mapper-ws-ethdlast updated 2018/11/273986 udp (mapper-ws_ethd)MAPPER workstation servermapper-ws_ethdlast updated 2018/11/273987 tcpCenterlinecenterlinelast updated 2018/11/273987 udpCenterlinecenterlinelast updated 2018/11/273988 tcpDCS Configuration Portdcs-configlast updated 2018/11/273988 udpDCS Configuration Portdcs-configlast updated 2018/11/273989 tcpBindView-Query Enginebv-queryenginelast updated 2018/11/273989 udpBindView-Query Enginebv-queryenginelast updated 2018/11/273990 tcpBindView-ISbv-islast updated 2018/11/273990 udpBindView-ISbv-islast updated 2018/11/273991 tcpBindView-SMCServerbv-smcsrvlast updated 2018/11/273991 udpBindView-SMCServerbv-smcsrvlast updated 2018/11/273992 tcpBindView-DirectoryServerbv-dslast updated 2018/11/273992 udpBindView-DirectoryServerbv-dslast updated 2018/11/273993 tcpBindView-Agentbv-agentlast updated 2018/11/273993 udpBindView-Agentbv-agentlast updated 2018/11/273994 UnassignedN/Alast updated 2018/11/273995 tcpISS Management Svcs SSLiss-mgmt-ssllast updated 2018/11/273995 udpISS Management Svcs SSLiss-mgmt-ssllast updated 2018/11/273996 tcpabcsoftware-01abcsoftwarelast updated 2018/11/273996 udpabcsoftware-01abcsoftwarelast updated 2018/11/273997 tcpaes_dbagentsease-dblast updated 2018/11/273997 udpaes_dbagentsease-dblast updated 2018/11/273998 tcpDistributed Nagios Executor Servicednxlast updated 2018/11/273998 udpDistributed Nagios Executor Servicednxlast updated 2018/11/273999 tcpNorman distributes scanning servicenvcnetlast updated 2018/11/273999 udpNorman distributes scanning servicenvcnetlast updated 2018/11/274000 tcpTerabaseterabaselast updated 2018/11/274000 udpTerabaseterabaselast updated 2018/11/274001 tcpNewOaknewoaklast updated 2018/11/274001 udpNewOaknewoaklast updated 2018/11/274002 tcppxc-spvr-ftpxc-spvr-ftlast updated 2018/11/274002 udppxc-spvr-ftpxc-spvr-ftlast updated 2018/11/274003 tcppxc-splr-ftpxc-splr-ftlast updated 2018/11/274003 udppxc-splr-ftpxc-splr-ftlast updated 2018/11/274004 tcppxc-roidpxc-roidlast updated 2018/11/274004 udppxc-roidpxc-roidlast updated 2018/11/274005 tcppxc-pinpxc-pinlast updated 2018/11/274005 udppxc-pinpxc-pinlast updated 2018/11/274006 tcppxc-spvrpxc-spvrlast updated 2018/11/274006 udppxc-spvrpxc-spvrlast updated 2018/11/274007 tcppxc-splrpxc-splrlast updated 2018/11/274007 udppxc-splrpxc-splrlast updated 2018/11/274008 tcpNetCheque accountingnetchequelast updated 2018/11/274008 udpNetCheque accountingnetchequelast updated 2018/11/274009 tcpChimera HWMchimera-hwmlast updated 2018/11/274009 udpChimera HWMchimera-hwmlast updated 2018/11/274010 tcpSamsung Unidexsamsung-unidexlast updated 2018/11/274010 udpSamsung Unidexsamsung-unidexlast updated 2018/11/274011 tcpAlternate Service Bootaltservicebootlast updated 2018/11/274011 udpAlternate Service Bootaltservicebootlast updated 2018/11/274012 tcpPDA Gatepda-gatelast updated 2018/11/274012 udpPDA Gatepda-gatelast updated 2018/11/274013 tcpACL Manageracl-managerlast updated 2018/11/274013 udpACL Manageracl-managerlast updated 2018/11/274014 tcpTAICLOCKtaiclocklast updated 2018/11/274014 udpTAICLOCKtaiclocklast updated 2018/11/274015 tcpTalarian Mcasttalarian-mcast1last updated 2018/11/274015 udpTalarian Mcasttalarian-mcast1last updated 2018/11/274016 tcpTalarian Mcasttalarian-mcast2last updated 2018/11/274016 udpTalarian Mcasttalarian-mcast2last updated 2018/11/274017 tcpTalarian Mcasttalarian-mcast3last updated 2018/11/274017 udpTalarian Mcasttalarian-mcast3last updated 2018/11/274018 tcpTalarian Mcasttalarian-mcast4last updated 2018/11/274018 udpTalarian Mcasttalarian-mcast4last updated 2018/11/274019 tcpTalarian Mcasttalarian-mcast5last updated 2018/11/274019 udpTalarian Mcasttalarian-mcast5last updated 2018/11/274020 tcpTRAP Porttraplast updated 2018/11/274020 udpTRAP Porttraplast updated 2018/11/274021 tcpNexus Portalnexus-portallast updated 2018/11/274021 udpNexus Portalnexus-portallast updated 2018/11/274022 tcpDNOXdnoxlast updated 2018/11/274022 udpDNOXdnoxlast updated 2018/11/274023 tcpESNM Zoning Portesnm-zoninglast updated 2018/11/274023 udpESNM Zoning Portesnm-zoninglast updated 2018/11/274024 tcpTNP1 User Porttnp1-portlast updated 2018/11/274024 udpTNP1 User Porttnp1-portlast updated 2018/11/274025 tcpPartition Image Portpartimagelast updated 2018/11/274025 udpPartition Image Portpartimagelast updated 2018/11/274026 tcpGraphical Debug Serveras-debuglast updated 2018/11/274026 udpGraphical Debug Serveras-debuglast updated 2018/11/274027 tcpbitxpressbxplast updated 2018/11/274027 udpbitxpressbxplast updated 2018/11/274028 tcpDTServer Portdtserver-portlast updated 2018/11/274028 udpDTServer Portdtserver-portlast updated 2018/11/274029 tcpIP Q signaling protocolip-qsiglast updated 2018/11/274029 udpIP Q signaling protocolip-qsiglast updated 2018/11/274030 tcpAccell/JSP Daemon Portjdmn-portlast updated 2018/11/274030 udpAccell/JSP Daemon Portjdmn-portlast updated 2018/11/274031 tcpUUCP over SSLsuucplast updated 2018/11/274031 udpUUCP over SSLsuucplast updated 2018/11/274032 tcpVERITAS Authorization Servicevrts-auth-portlast updated 2018/11/274032 udpVERITAS Authorization Servicevrts-auth-portlast updated 2018/11/274033 tcpSANavigator Peer Portsanavigatorlast updated 2018/11/274033 udpSANavigator Peer Portsanavigatorlast updated 2018/11/274034 tcpUbiquinox Daemonubxdlast updated 2018/11/274034 udpUbiquinox Daemonubxdlast updated 2018/11/274035 tcpWAP Push OTA-HTTP portwap-push-httplast updated 2018/11/274035 udpWAP Push OTA-HTTP portwap-push-httplast updated 2018/11/274036 tcpWAP Push OTA-HTTP securewap-push-httpslast updated 2018/11/274036 udpWAP Push OTA-HTTP securewap-push-httpslast updated 2018/11/274037 tcpRaveHD network controlravehdlast updated 2018/11/274037 udpRaveHD network controlravehdlast updated 2018/11/274038 tcpFazzt Point-To-Pointfazzt-ptplast updated 2018/11/274038 udpFazzt Point-To-Pointfazzt-ptplast updated 2018/11/274039 tcpFazzt Administrationfazzt-adminlast updated 2018/11/274039 udpFazzt Administrationfazzt-adminlast updated 2018/11/274040 main serviceyo-mainlast updated 2018/11/274040 main serviceyo-mainlast updated 2018/11/274041 tcpRocketeer-Houstonhoustonlast updated 2018/11/274041 udpRocketeer-Houstonhoustonlast updated 2018/11/274042 tcpLDXPldxplast updated 2018/11/274042 udpLDXPldxplast updated 2018/11/274043 tcpNeighbour Identity Resolutionnirplast updated 2018/11/274043 udpNeighbour Identity Resolutionnirplast updated 2018/11/274044 tcpLocation Tracking Protocolltplast updated 2018/11/274044 udpLocation Tracking Protocolltplast updated 2018/11/274045 tcpNetwork Paging Protocolnpplast updated 2018/11/274045 udpNetwork Paging Protocolnpplast updated 2018/11/274046 tcpAccounting Protocolacp-protolast updated 2018/11/274046 udpAccounting Protocolacp-protolast updated 2018/11/274047 tcpContext Transfer Protocolctp-statelast updated 2018/11/274047 udpContext Transfer Protocolctp-statelast updated 2018/11/274048 UnassignedN/Alast updated 2018/11/274049 tcpWide Area File Serviceswafslast updated 2018/11/274049 udpWide Area File Serviceswafslast updated 2018/11/274050 tcpWide Area File Servicescisco-wafslast updated 2018/11/274050 udpWide Area File Servicescisco-wafslast updated 2018/11/274051 tcpCisco Peer to Peer Distribution Protocolcppdplast updated 2018/11/274051 udpCisco Peer to Peer Distribution Protocolcppdplast updated 2018/11/274052 tcpVoiceConnect Interactinteractlast updated 2018/11/274052 udpVoiceConnect Interactinteractlast updated 2018/11/274053 tcpCosmoCall Universe Communications Port 1ccu-comm-1last updated 2018/11/274053 udpCosmoCall Universe Communications Port 1ccu-comm-1last updated 2018/11/274054 tcpCosmoCall Universe Communications Port 2ccu-comm-2last updated 2018/11/274054 udpCosmoCall Universe Communications Port 2ccu-comm-2last updated 2018/11/274055 tcpCosmoCall Universe Communications Port 3ccu-comm-3last updated 2018/11/274055 udpCosmoCall Universe Communications Port 3ccu-comm-3last updated 2018/11/274056 tcpLocation Message Servicelmslast updated 2018/11/274056 udpLocation Message Servicelmslast updated 2018/11/274057 tcpServigistics WFM serverwfmlast updated 2018/11/274057 udpServigistics WFM serverwfmlast updated 2018/11/274058 tcpKingfisher protocolkingfisherlast updated 2018/11/274058 udpKingfisher protocolkingfisherlast updated 2018/11/274059 tcpDLMS/COSEMdlms-cosemlast updated 2018/11/274059 udpDLMS/COSEMdlms-cosemlast updated 2018/11/274060 tcpDSMETER Inter-Agent Transfer Channel IANA assigned this well-formed service name as a replacement for "dsmeter_iatc".dsmeter-iatclast updated 2018/11/274060 tcp (dsmeter_iatc)DSMETER Inter-Agent Transfer Channeldsmeter_iatclast updated 2018/11/274060 udpDSMETER Inter-Agent Transfer Channel IANA assigned this well-formed service name as a replacement for "dsmeter_iatc".dsmeter-iatclast updated 2018/11/274060 udp (dsmeter_iatc)DSMETER Inter-Agent Transfer Channeldsmeter_iatclast updated 2018/11/274061 tcpIce Location Service (TCP)ice-locationlast updated 2018/11/274061 udpIce Location Service (TCP)ice-locationlast updated 2018/11/274062 tcpIce Location Service (SSL)ice-slocationlast updated 2018/11/274062 udpIce Location Service (SSL)ice-slocationlast updated 2018/11/274063 tcpIce Firewall Traversal Service (TCP)ice-routerlast updated 2018/11/274063 udpIce Firewall Traversal Service (TCP)ice-routerlast updated 2018/11/274064 tcpIce Firewall Traversal Service (SSL)ice-srouterlast updated 2018/11/274064 udpIce Firewall Traversal Service (SSL)ice-srouterlast updated 2018/11/274065 tcpAvanti Common Data IANA assigned this well-formed service name as a replacement for "avanti_cdp".avanti-cdplast updated 2018/11/274065 tcp (avanti_cdp)Avanti Common Dataavanti_cdplast updated 2018/11/274065 udpAvanti Common Data IANA assigned this well-formed service name as a replacement for "avanti_cdp".avanti-cdplast updated 2018/11/274065 udp (avanti_cdp)Avanti Common Dataavanti_cdplast updated 2018/11/274066 tcpPerformance Measurement and Analysispmaslast updated 2018/11/274066 udpPerformance Measurement and Analysispmaslast updated 2018/11/274067 tcpInformation Distribution Protocolidplast updated 2018/11/274067 udpInformation Distribution Protocolidplast updated 2018/11/274068 tcpIP Fleet Broadcastipfltbcstlast updated 2018/11/274068 udpIP Fleet Broadcastipfltbcstlast updated 2018/11/274069 tcpMinger Email Address Validation Servicemingerlast updated 2018/11/274069 udpMinger Email Address Validation Servicemingerlast updated 2018/11/274070 tcpTrivial IP Encryption (TrIPE)tripelast updated 2018/11/274070 udpTrivial IP Encryption (TrIPE)tripelast updated 2018/11/274071 tcpAutomatically Incremental Backupaibkuplast updated 2018/11/274071 udpAutomatically Incremental Backupaibkuplast updated 2018/11/274072 tcpZieto Socket Communicationszieto-socklast updated 2018/11/274072 udpZieto Socket Communicationszieto-socklast updated 2018/11/274073 tcpInteractive Remote Application Pairing ProtocoliRAPPlast updated 2018/11/274073 udpInteractive Remote Application Pairing ProtocoliRAPPlast updated 2018/11/274074 tcpCequint City ID UI triggercequint-cityidlast updated 2018/11/274074 udpCequint City ID UI triggercequint-cityidlast updated 2018/11/274075 tcpISC Alarm Message Serviceperimlanlast updated 2018/11/274075 udpISC Alarm Message Serviceperimlanlast updated 2018/11/274076 tcpSeraph DCSseraphlast updated 2018/11/274076 udpSeraph DCSseraphlast updated 2018/11/274077 tcpReservedN/Alast updated 2018/11/274077 udpAscom IP Alarmingascomalarmlast updated 2018/11/274078 tcpCoordinated Security Service Protocolcssplast updated 2018/11/274078 udpReservedN/Alast updated 2018/11/274079 tcpSANtools Diagnostic Serversantoolslast updated 2018/11/274079 udpSANtools Diagnostic Serversantoolslast updated 2018/11/274080 tcpLorica inside facinglorica-inlast updated 2018/11/274080 udpLorica inside facinglorica-inlast updated 2018/11/274081 tcpLorica inside facing (SSL)lorica-in-seclast updated 2018/11/274081 udpLorica inside facing (SSL)lorica-in-seclast updated 2018/11/274082 tcpLorica outside facinglorica-outlast updated 2018/11/274082 udpLorica outside facinglorica-outlast updated 2018/11/274083 tcpLorica outside facing (SSL)lorica-out-seclast updated 2018/11/274083 udpLorica outside facing (SSL)lorica-out-seclast updated 2018/11/274084 tcpReservedN/Alast updated 2018/11/274084 udpFortisphere VM Servicefortisphere-vmlast updated 2018/11/274085 tcpEZNews Newsroom Message Serviceezmessagesrvlast updated 2018/11/274085 udpReservedN/Alast updated 2018/11/274086 tcpReservedN/Alast updated 2018/11/274086 udpFirewall/NAT state table synchronizationftsynclast updated 2018/11/274087 tcpAPplus Serviceapplusservicelast updated 2018/11/274087 udpReservedN/Alast updated 2018/11/274088 tcpNoah Printing Service Protocolnpsplast updated 2018/11/274088 udpReservedN/Alast updated 2018/11/274089 tcpOpenCORE Remote Control Serviceopencorelast updated 2018/11/274089 udpOpenCORE Remote Control Serviceopencorelast updated 2018/11/274090 tcpOMA BCAST Service Guideomasgportlast updated 2018/11/274090 udpOMA BCAST Service Guideomasgportlast updated 2018/11/274091 tcpEminentWare Installerewinstallerlast updated 2018/11/274091 udpEminentWare Installerewinstallerlast updated 2018/11/274092 tcpEminentWare DGSewdgslast updated 2018/11/274092 udpEminentWare DGSewdgslast updated 2018/11/274093 tcpPvx Plus CS Hostpvxpluscslast updated 2018/11/274093 udpPvx Plus CS Hostpvxpluscslast updated 2018/11/274094 tcpsysrq daemonsysrqdlast updated 2018/11/274094 udpsysrq daemonsysrqdlast updated 2018/11/274095 tcpxtgui information servicextguilast updated 2018/11/274095 udpxtgui information servicextguilast updated 2018/11/274096 tcpBRE (Bridge Relay Element)brelast updated 2018/11/274096 udpBRE (Bridge Relay Element)brelast updated 2018/11/274097 tcpPatrol Viewpatrolviewlast updated 2018/11/274097 udpPatrol Viewpatrolviewlast updated 2018/11/274098 tcpdrmsfsddrmsfsdlast updated 2018/11/274098 udpdrmsfsddrmsfsdlast updated 2018/11/274099 tcpDPCPdpcplast updated 2018/11/274099 udpDPCPdpcplast updated 2018/11/274100 tcpIGo Incognito Data Portigo-incognitolast updated 2018/11/274100 udpIGo Incognito Data Portigo-incognitolast updated 2018/11/274101 tcpBraille protocolbrlp-0last updated 2018/11/274101 udpBraille protocolbrlp-0last updated 2018/11/274102 tcpBraille protocolbrlp-1last updated 2018/11/274102 udpBraille protocolbrlp-1last updated 2018/11/274103 tcpBraille protocolbrlp-2last updated 2018/11/274103 udpBraille protocolbrlp-2last updated 2018/11/274104 tcpBraille protocolbrlp-3last updated 2018/11/274104 udpBraille protocolbrlp-3last updated 2018/11/274105 tcpShofarshofarlast updated 2018/11/274105 udpShofarshofarlast updated 2018/11/274106 tcpSynchronitesynchronitelast updated 2018/11/274106 udpSynchronitesynchronitelast updated 2018/11/274107 tcpJDL Accounting LAN Servicej-aclast updated 2018/11/274107 udpJDL Accounting LAN Servicej-aclast updated 2018/11/274108 tcpACCELaccellast updated 2018/11/274108 udpACCELaccellast updated 2018/11/274109 tcpInstantiated Zero-control Messagingizmlast updated 2018/11/274109 udpInstantiated Zero-control Messagingizmlast updated 2018/11/274110 tcpG2 RFID Tag Telemetry Datag2taglast updated 2018/11/274110 udpG2 RFID Tag Telemetry Datag2taglast updated 2018/11/274111 tcpXgridxgridlast updated 2018/11/274111 udpXgridxgridlast updated 2018/11/274112 tcpApple VPN Server Reporting Protocolapple-vpns-rplast updated 2018/11/274112 udpApple VPN Server Reporting Protocolapple-vpns-rplast updated 2018/11/274113 tcpAIPN LS Registrationaipn-reglast updated 2018/11/274113 udpAIPN LS Registrationaipn-reglast updated 2018/11/274114 tcpJomaMQMonitorjomamqmonitorlast updated 2018/11/274114 udpJomaMQMonitorjomamqmonitorlast updated 2018/11/274115 tcpCDS Transfer Agentcdslast updated 2018/11/274115 udpCDS Transfer Agentcdslast updated 2018/11/274116 tcpsmartcard-TLSsmartcard-tlslast updated 2018/11/274116 udpsmartcard-TLSsmartcard-tlslast updated 2018/11/274117 tcpHillr Connection Managerhillrservlast updated 2018/11/274117 udpHillr Connection Managerhillrservlast updated 2018/11/274118 tcpNetadmin Systems NETscript servicenetscriptlast updated 2018/11/274118 udpNetadmin Systems NETscript servicenetscriptlast updated 2018/11/274119 tcpAssuria Log Managerassuria-slmlast updated 2018/11/274119 udpAssuria Log Managerassuria-slmlast updated 2018/11/274120 tcpMiniRem Remote Telemetry and Controlminiremlast updated 2018/11/274120 udpReservedN/Alast updated 2018/11/274121 tcpe-Builder Application Communicatione-builderlast updated 2018/11/274121 udpe-Builder Application Communicatione-builderlast updated 2018/11/274122 tcpFiber Patrol Alarm Servicefpramslast updated 2018/11/274122 udpFiber Patrol Alarm Servicefpramslast updated 2018/11/274123 tcpZ-Wave Protocolz-wavelast updated 2018/11/274123 udpZ-Wave Protocolz-wavelast updated 2018/11/274124 tcpRohill TetraNode Ip Gateway v2tigv2last updated 2018/11/274124 udpRohill TetraNode Ip Gateway v2tigv2last updated 2018/11/274125 tcpOpsview Envoyopsview-envoylast updated 2018/11/274125 udpOpsview Envoyopsview-envoylast updated 2018/11/274126 tcpData Domain Replication Serviceddrepllast updated 2018/11/274126 udpData Domain Replication Serviceddrepllast updated 2018/11/274127 tcpNetUniKeyServerunikeyprolast updated 2018/11/274127 udpNetUniKeyServerunikeyprolast updated 2018/11/274128 tcpNuFW decision delegation protocolnufwlast updated 2018/11/274128 udpNuFW decision delegation protocolnufwlast updated 2018/11/274129 tcpNuFW authentication protocolnuauthlast updated 2018/11/274129 udpNuFW authentication protocolnuauthlast updated 2018/11/274130 tcpFRONET message protocolfronetlast updated 2018/11/274130 udpFRONET message protocolfronetlast updated 2018/11/274131 tcpGlobal Maintech Starsstarslast updated 2018/11/274131 udpGlobal Maintech Starsstarslast updated 2018/11/274132 tcpNUTS Daemon IANA assigned this well-formed service name as a replacement for "nuts_dem".nuts-demlast updated 2018/11/274132 tcp (nuts_dem)NUTS Daemonnuts_demlast updated 2018/11/274132 udpNUTS Daemon IANA assigned this well-formed service name as a replacement for "nuts_dem".nuts-demlast updated 2018/11/274132 udp (nuts_dem)NUTS Daemonnuts_demlast updated 2018/11/274133 tcpNUTS Bootp Server IANA assigned this well-formed service name as a replacement for "nuts_bootp".nuts-bootplast updated 2018/11/274133 tcp (nuts_bootp)NUTS Bootp Servernuts_bootplast updated 2018/11/274133 udpNUTS Bootp Server IANA assigned this well-formed service name as a replacement for "nuts_bootp".nuts-bootplast updated 2018/11/274133 udp (nuts_bootp)NUTS Bootp Servernuts_bootplast updated 2018/11/274134 tcpNIFTY-Serve HMI protocolnifty-hmilast updated 2018/11/274134 udpNIFTY-Serve HMI protocolnifty-hmilast updated 2018/11/274135 tcpClassic Line Database Server Attachcl-db-attachlast updated 2018/11/274135 udpClassic Line Database Server Attachcl-db-attachlast updated 2018/11/274136 tcpClassic Line Database Server Requestcl-db-requestlast updated 2018/11/274136 udpClassic Line Database Server Requestcl-db-requestlast updated 2018/11/274137 tcpClassic Line Database Server Remotecl-db-remotelast updated 2018/11/274137 udpClassic Line Database Server Remotecl-db-remotelast updated 2018/11/274138 tcpnettestnettestlast updated 2018/11/274138 udpnettestnettestlast updated 2018/11/274139 tcpImperfect Networks Serverthrtxlast updated 2018/11/274139 udpImperfect Networks Serverthrtxlast updated 2018/11/274140 tcpCedros Fraud Detection System IANA assigned this well-formed service name as a replacement for "cedros_fds".cedros-fdslast updated 2018/11/274140 tcp (cedros_fds)Cedros Fraud Detection Systemcedros_fdslast updated 2018/11/274140 udpCedros Fraud Detection System IANA assigned this well-formed service name as a replacement for "cedros_fds".cedros-fdslast updated 2018/11/274140 udp (cedros_fds)Cedros Fraud Detection Systemcedros_fdslast updated 2018/11/274141 tcpWorkflow Serveroirtgsvclast updated 2018/11/274141 udpWorkflow Serveroirtgsvclast updated 2018/11/274142 tcpDocument Serveroidocsvclast updated 2018/11/274142 udpDocument Serveroidocsvclast updated 2018/11/274143 tcpDocument Replicationoidsrlast updated 2018/11/274143 udpDocument Replicationoidsrlast updated 2018/11/274144 UnassignedN/Alast updated 2018/11/274145 tcpVVR Controlvvr-controllast updated 2018/11/274145 udpVVR Controlvvr-controllast updated 2018/11/274146 tcpTGCConnect Beacontgcconnectlast updated 2018/11/274146 udpTGCConnect Beacontgcconnectlast updated 2018/11/274147 tcpMultum Service Managervrxpservmanlast updated 2018/11/274147 udpMultum Service Managervrxpservmanlast updated 2018/11/274148 tcpHHB Handheld Clienthhb-handheldlast updated 2018/11/274148 udpHHB Handheld Clienthhb-handheldlast updated 2018/11/274149 tcpA10 GSLB Serviceagslblast updated 2018/11/274149 udpA10 GSLB Serviceagslblast updated 2018/11/274150 tcpPowerAlert Network Shutdown AgentPowerAlert-nsalast updated 2018/11/274150 udpPowerAlert Network Shutdown AgentPowerAlert-nsalast updated 2018/11/274151 tcpMen & Mice Remote Control IANA assigned this well-formed service name as a replacement for "menandmice_noh".menandmice-nohlast updated 2018/11/274151 tcp (menandmice_noh)Men & Mice Remote Controlmenandmice_nohlast updated 2018/11/274151 udpMen & Mice Remote Control IANA assigned this well-formed service name as a replacement for "menandmice_noh".menandmice-nohlast updated 2018/11/274151 udp (menandmice_noh)Men & Mice Remote Controlmenandmice_nohlast updated 2018/11/274152 tcpiDigTech Multiplex IANA assigned this well-formed service name as a replacement for "idig_mux".idig-muxlast updated 2018/11/274152 tcp (idig_mux)iDigTech Multiplexidig_muxlast updated 2018/11/274152 udpiDigTech Multiplex IANA assigned this well-formed service name as a replacement for "idig_mux".idig-muxlast updated 2018/11/274152 udp (idig_mux)iDigTech Multiplexidig_muxlast updated 2018/11/274153 tcpMBL Remote Battery Monitoringmbl-battdlast updated 2018/11/274153 udpMBL Remote Battery Monitoringmbl-battdlast updated 2018/11/274154 tcpatlinks device discoveryatlinkslast updated 2018/11/274154 udpatlinks device discoveryatlinkslast updated 2018/11/274155 tcpBazaar version control systembzrlast updated 2018/11/274155 udpBazaar version control systembzrlast updated 2018/11/274156 tcpSTAT Resultsstat-resultslast updated 2018/11/274156 udpSTAT Resultsstat-resultslast updated 2018/11/274157 tcpSTAT Scanner Controlstat-scannerlast updated 2018/11/274157 udpSTAT Scanner Controlstat-scannerlast updated 2018/11/274158 tcpSTAT Command Centerstat-cclast updated 2018/11/274158 udpSTAT Command Centerstat-cclast updated 2018/11/274159 tcpNetwork Security Servicensslast updated 2018/11/274159 udpNetwork Security Servicensslast updated 2018/11/274160 tcpJini Discoveryjini-discoverylast updated 2018/11/274160 udpJini Discoveryjini-discoverylast updated 2018/11/274161 tcpOMS Contactomscontactlast updated 2018/11/274161 udpOMS Contactomscontactlast updated 2018/11/274162 tcpOMS Topologyomstopologylast updated 2018/11/274162 udpOMS Topologyomstopologylast updated 2018/11/274163 tcpSilver Peak Peer Protocolsilverpeakpeerlast updated 2018/11/274163 udpSilver Peak Peer Protocolsilverpeakpeerlast updated 2018/11/274164 tcpSilver Peak Communication Protocolsilverpeakcommlast updated 2018/11/274164 udpSilver Peak Communication Protocolsilverpeakcommlast updated 2018/11/274165 tcpArcLink over Ethernetaltcplast updated 2018/11/274165 udpArcLink over Ethernetaltcplast updated 2018/11/274166 tcpJoost Peer to Peer Protocoljoostlast updated 2018/11/274166 udpJoost Peer to Peer Protocoljoostlast updated 2018/11/274167 tcpDeskDirect Global Networkddgnlast updated 2018/11/274167 udpDeskDirect Global Networkddgnlast updated 2018/11/274168 tcpPrintSoft License Serverpslicserlast updated 2018/11/274168 udpPrintSoft License Serverpslicserlast updated 2018/11/274169 tcpAutomation Drive Interface Transportiadtlast updated 2018/11/274169 udpInternet ADT Discovery Protocoliadt-disclast updated 2018/11/274170 tcpSMPTE Content Synchonization Protocold-cinema-csplast updated 2018/11/274170 udpReservedN/Alast updated 2018/11/274171 tcpMaxlogic Supervisor Communicationml-svnetlast updated 2018/11/274171 udpReservedN/Alast updated 2018/11/274172 tcpPC over IPpcoiplast updated 2018/11/274172 udpPC over IPpcoiplast updated 2018/11/274173 tcpReservedN/Alast updated 2018/11/274173 udpMMA Device Discoverymma-discoverylast updated 2018/11/274174 tcpStorMagic Cluster Servicessmclusterlast updated 2018/11/274174 udpStorMagic Discoverysm-disclast updated 2018/11/274175 tcpBrocade Cluster Communication Protocolbccplast updated 2018/11/274175 udpReservedN/Alast updated 2018/11/274176 tcpTranslattice Cluster IPC Proxytl-ipcproxylast updated 2018/11/274176 udpReservedN/Alast updated 2018/11/274177 tcpWello P2P pubsub servicewellolast updated 2018/11/274177 udpWello P2P pubsub servicewellolast updated 2018/11/274178 tcpStorManstormanlast updated 2018/11/274178 udpStorManstormanlast updated 2018/11/274179 tcpMaxum ServicesMaxumSPlast updated 2018/11/274179 udpMaxum ServicesMaxumSPlast updated 2018/11/274180 tcpHTTPXhttpxlast updated 2018/11/274180 udpHTTPXhttpxlast updated 2018/11/274181 tcpMacBakmacbaklast updated 2018/11/274181 udpMacBakmacbaklast updated 2018/11/274182 tcpProduction Company Pro TCP Servicepcptcpservicelast updated 2018/11/274182 udpProduction Company Pro TCP Servicepcptcpservicelast updated 2018/11/274183 tcpCyborgNet communications protocolcyborgnetlast updated 2018/11/274183 udpCyborgNet communications protocolcyborgnetlast updated 2018/11/274184 tcpUNIVERSE SUITE MESSAGE SERVICE IANA assigned this well-formed service name as a replacement for "universe_suite".universe-suitelast updated 2018/11/274184 tcp (universe_suite)UNIVERSE SUITE MESSAGE SERVICEuniverse_suitelast updated 2018/11/274184 udpUNIVERSE SUITE MESSAGE SERVICE IANA assigned this well-formed service name as a replacement for "universe_suite".universe-suitelast updated 2018/11/274184 udp (universe_suite)UNIVERSE SUITE MESSAGE SERVICEuniverse_suitelast updated 2018/11/274185 tcpWoven Control Plane Protocolwcpplast updated 2018/11/274185 udpWoven Control Plane Protocolwcpplast updated 2018/11/274186 tcpBox Backup Store Serviceboxbackupstorelast updated 2018/11/274186 udpReservedN/Alast updated 2018/11/274187 tcpCascade Proxy IANA assigned this well-formed service name as a replacement for "csc_proxy".csc-proxylast updated 2018/11/274187 tcp (csc_proxy)Cascade Proxycsc_proxylast updated 2018/11/274187 udpReservedN/Alast updated 2018/11/274188 tcpVatata Peer to Peer Protocolvatatalast updated 2018/11/274188 udpVatata Peer to Peer Protocolvatatalast updated 2018/11/274189 tcpPath Computation Element Communication Protocolpceplast updated 2018/11/274189 udpReservedN/Alast updated 2018/11/274190 tcpManageSieve Protocolsievelast updated 2018/11/274190 udpReservedN/Alast updated 2018/11/274191 tcpReservedN/Alast updated 2018/11/274191 udpDual Stack MIPv6 NAT Traversaldsmipv6last updated 2018/11/274192 tcpAzeti Agent Serviceazetilast updated 2018/11/274192 udpazeti blinddateazeti-bdlast updated 2018/11/274193 tcpPxPlus remote file srvrpvxplusiolast updated 2018/11/274193 udpReservedN/Alast updated 2018/11/274194-4196 UnassignedN/Alast updated 2018/11/274197 tcpHarman HControl Protocolhctllast updated 2018/11/274197 udpHarman HControl Protocolhctllast updated 2018/11/274198 UnassignedN/Alast updated 2018/11/274199 tcpEIMS ADMINeims-adminlast updated 2018/11/274199 udpEIMS ADMINeims-adminlast updated 2018/11/274200-4299 VRML Multi User Systemsvrml-multi-uselast updated 2018/11/274300 tcpCorel CCamcorelccamlast updated 2018/11/274300 udpCorel CCamcorelccamlast updated 2018/11/274301 tcpDiagnostic Datad-datalast updated 2018/11/274301 udpDiagnostic Datad-datalast updated 2018/11/274302 tcpDiagnostic Data Controld-data-controllast updated 2018/11/274302 udpDiagnostic Data Controld-data-controllast updated 2018/11/274303 tcpSimple Railroad Command Protocolsrcplast updated 2018/11/274303 udpSimple Railroad Command Protocolsrcplast updated 2018/11/274304 tcpOne-Wire Filesystem Serverowserverlast updated 2018/11/274304 udpOne-Wire Filesystem Serverowserverlast updated 2018/11/274305 tcpbetter approach to mobile ad-hoc networkingbatmanlast updated 2018/11/274305 udpbetter approach to mobile ad-hoc networkingbatmanlast updated 2018/11/274306 tcpHellgate Londonpinghgllast updated 2018/11/274306 udpHellgate Londonpinghgllast updated 2018/11/274307 tcpTrueConf Videoconference Servicetrueconflast updated 2018/11/274307 udpTrueConf Videoconference Servicetrueconflast updated 2018/11/274308 tcpCompX-LockViewcompx-lockviewlast updated 2018/11/274308 udpCompX-LockViewcompx-lockviewlast updated 2018/11/274309 tcpExsequi Appliance Discoverydserverlast updated 2018/11/274309 udpExsequi Appliance Discoverydserverlast updated 2018/11/274310 tcpMir-RT exchange servicemirrtexlast updated 2018/11/274310 udpMir-RT exchange servicemirrtexlast updated 2018/11/274311 tcpP6R Secure Server Management Consolep6ssmclast updated 2018/11/274311 udpReservedN/Alast updated 2018/11/274312 tcpParascale Membership Managerpscl-mgtlast updated 2018/11/274312 udpReservedN/Alast updated 2018/11/274313 tcpPERRLA User Servicesperrlalast updated 2018/11/274313 udpReservedN/Alast updated 2018/11/274314 tcpChoiceView Agentchoiceview-agtlast updated 2018/11/274314 udpReservedN/Alast updated 2018/11/274315 UnassignedN/Alast updated 2018/11/274316 tcpChoiceView Clientchoiceview-cltlast updated 2018/11/274316 udpReservedN/Alast updated 2018/11/274317-4319 UnassignedN/Alast updated 2018/11/274320 tcpFDT Remote Categorization Protocolfdt-rcatplast updated 2018/11/274320 udpFDT Remote Categorization Protocolfdt-rcatplast updated 2018/11/274321 tcpRemote Who Isrwhoislast updated 2018/11/274321 udpRemote Who Isrwhoislast updated 2018/11/274322 tcpTRIM Event Servicetrim-eventlast updated 2018/11/274322 udpTRIM Event Servicetrim-eventlast updated 2018/11/274323 tcpTRIM ICE Servicetrim-icelast updated 2018/11/274323 udpTRIM ICE Servicetrim-icelast updated 2018/11/274324 ReservedN/Alast updated 2018/11/274325 tcpCadcorp GeognoSIS Manager Servicegeognosismanlast updated 2018/11/274325 udpCadcorp GeognoSIS Manager Servicegeognosismanlast updated 2018/11/274326 tcpCadcorp GeognoSIS Servicegeognosislast updated 2018/11/274326 udpCadcorp GeognoSIS Servicegeognosislast updated 2018/11/274327 tcpJaxer Web Protocoljaxer-weblast updated 2018/11/274327 udpJaxer Web Protocoljaxer-weblast updated 2018/11/274328 tcpJaxer Manager Command Protocoljaxer-managerlast updated 2018/11/274328 udpJaxer Manager Command Protocoljaxer-managerlast updated 2018/11/274329 tcpPubliQare Distributed Environment Synchronisation Enginepubliqare-synclast updated 2018/11/274329 udpReservedN/Alast updated 2018/11/274330 tcpDEY Storage Administration REST APIdey-sapilast updated 2018/11/274330 udpReservedN/Alast updated 2018/11/274331 tcpktickets REST API for event management and ticketing systems (embedded POS devices)ktickets-restlast updated 2018/11/274331 udpReservedN/Alast updated 2018/11/274332 UnassignedN/Alast updated 2018/11/274333 tcpArrowHead Service Protocol (AHSP)ahsplast updated 2018/11/274333 udpArrowHead Service Protocol (AHSP)ahsplast updated 2018/11/274333 sctpArrowHead Service Protocol (AHSP)ahsplast updated 2018/11/274334 tcpNETCONF Call Home (SSH)netconf-ch-sshlast updated 2018/11/274334 udpReservedN/Alast updated 2018/11/274335 tcpNETCONF Call Home (TLS)netconf-ch-tlslast updated 2018/11/274335 udpReservedN/Alast updated 2018/11/274336 tcpRESTCONF Call Home (TLS)restconf-ch-tlslast updated 2018/11/274336 udpReservedN/Alast updated 2018/11/274337-4339 UnassignedN/Alast updated 2018/11/274340 tcpGaia Connector Protocolgaialast updated 2018/11/274340 udpGaia Connector Protocolgaialast updated 2018/11/274341 tcpLISP Data Packetslisp-datalast updated 2018/11/274341 udpLISP Data Packetslisp-datalast updated 2018/11/274342 tcpLISP-CONS Controllisp-conslast updated 2018/11/274342 udpLISP Control Packetslisp-controllast updated 2018/11/274343 tcpUNICALLunicalllast updated 2018/11/274343 udpUNICALLunicalllast updated 2018/11/274344 tcpVinaInstallvinainstalllast updated 2018/11/274344 udpVinaInstallvinainstalllast updated 2018/11/274345 tcpMacro 4 Network ASm4-network-aslast updated 2018/11/274345 udpMacro 4 Network ASm4-network-aslast updated 2018/11/274346 tcpELAN LMelanlmlast updated 2018/11/274346 udpELAN LMelanlmlast updated 2018/11/274347 tcpLAN Surveyorlansurveyorlast updated 2018/11/274347 udpLAN Surveyorlansurveyorlast updated 2018/11/274348 tcpITOSEitoselast updated 2018/11/274348 udpITOSEitoselast updated 2018/11/274349 tcpFile System Port Mapfsportmaplast updated 2018/11/274349 udpFile System Port Mapfsportmaplast updated 2018/11/274350 tcpNet Devicenet-devicelast updated 2018/11/274350 udpNet Devicenet-devicelast updated 2018/11/274351 tcpPLCY Net Servicesplcy-net-svcslast updated 2018/11/274351 udpPLCY Net Servicesplcy-net-svcslast updated 2018/11/274352 tcpProjector Linkpjlinklast updated 2018/11/274352 udpProjector Linkpjlinklast updated 2018/11/274353 tcpF5 iQueryf5-iquerylast updated 2018/11/274353 udpF5 iQueryf5-iquerylast updated 2018/11/274354 tcpQSNet Transmitterqsnet-translast updated 2018/11/274354 udpQSNet Transmitterqsnet-translast updated 2018/11/274355 tcpQSNet Workstationqsnet-workstlast updated 2018/11/274355 udpQSNet Workstationqsnet-workstlast updated 2018/11/274356 tcpQSNet Assistantqsnet-assistlast updated 2018/11/274356 udpQSNet Assistantqsnet-assistlast updated 2018/11/274357 tcpQSNet Conductorqsnet-condlast updated 2018/11/274357 udpQSNet Conductorqsnet-condlast updated 2018/11/274358 tcpQSNet Nucleusqsnet-nucllast updated 2018/11/274358 udpQSNet Nucleusqsnet-nucllast updated 2018/11/274359 tcpOMA BCAST Long-Term Key Messagesomabcastltkmlast updated 2018/11/274359 udpOMA BCAST Long-Term Key Messagesomabcastltkmlast updated 2018/11/274360 tcpMatrix VNet Communication Protocol IANA assigned this well-formed service name as a replacement for "matrix_vnet".matrix-vnetlast updated 2018/11/274360 tcp (matrix_vnet)Matrix VNet Communication Protocolmatrix_vnetlast updated 2018/11/274360 udpReservedN/Alast updated 2018/11/274361 tcpReservedN/Alast updated 2018/11/274361 udpNavCom Discovery and Control Portnacnllast updated 2018/11/274362 tcpReservedN/Alast updated 2018/11/274362 udpAFORE vNode Discovery protocolafore-vdp-disclast updated 2018/11/274363-4365 UnassignedN/Alast updated 2018/11/274366 udpShadowStream Systemshadowstreamlast updated 2018/11/274366 tcpReservedN/Alast updated 2018/11/274367 UnassignedN/Alast updated 2018/11/274368 tcpWeatherBrief Directwxbrieflast updated 2018/11/274368 udpWeatherBrief Directwxbrieflast updated 2018/11/274369 tcpErlang Port Mapper Daemonepmdlast updated 2018/11/274369 udpErlang Port Mapper Daemonepmdlast updated 2018/11/274370 tcpELPRO V2 Protocol Tunnel IANA assigned this well-formed service name as a replacement for "elpro_tunnel".elpro-tunnellast updated 2018/11/274370 tcp (elpro_tunnel)ELPRO V2 Protocol Tunnelelpro_tunnellast updated 2018/11/274370 udpELPRO V2 Protocol Tunnel IANA assigned this well-formed service name as a replacement for "elpro_tunnel".elpro-tunnellast updated 2018/11/274370 udp (elpro_tunnel)ELPRO V2 Protocol Tunnelelpro_tunnellast updated 2018/11/274371 tcpLAN2CAN Controll2c-controllast updated 2018/11/274371 udpLAN2CAN Discoveryl2c-disclast updated 2018/11/274372 tcpLAN2CAN Datal2c-datalast updated 2018/11/274372 udpLAN2CAN Datal2c-datalast updated 2018/11/274373 tcpRemote Authenticated Command Serviceremctllast updated 2018/11/274373 udpRemote Authenticated Command Serviceremctllast updated 2018/11/274374 tcpPSI Push-to-Talk Protocolpsi-pttlast updated 2018/11/274374 udpReservedN/Alast updated 2018/11/274375 tcpToltec EasySharetolteceslast updated 2018/11/274375 udpToltec EasySharetolteceslast updated 2018/11/274376 tcpBioAPI Interworkingbiplast updated 2018/11/274376 udpBioAPI Interworkingbiplast updated 2018/11/274377 tcpCambridge Pixel SPx Servercp-spxsvrlast updated 2018/11/274377 udpCambridge Pixel SPx Servercp-spxsvrlast updated 2018/11/274378 tcpCambridge Pixel SPx Displaycp-spxdpylast updated 2018/11/274378 udpCambridge Pixel SPx Displaycp-spxdpylast updated 2018/11/274379 tcpCTDBctdblast updated 2018/11/274379 udpCTDBctdblast updated 2018/11/274380-4388 UnassignedN/Alast updated 2018/11/274389 tcpXandros Community Management Servicexandros-cmslast updated 2018/11/274389 udpXandros Community Management Servicexandros-cmslast updated 2018/11/274390 tcpPhysical Access Controlwiegandlast updated 2018/11/274390 udpPhysical Access Controlwiegandlast updated 2018/11/274391 tcpAmerican Printware IMServer Protocolapwi-imserverlast updated 2018/11/274391 udpReservedN/Alast updated 2018/11/274392 tcpAmerican Printware RXServer Protocolapwi-rxserverlast updated 2018/11/274392 udpReservedN/Alast updated 2018/11/274393 tcpAmerican Printware RXSpooler Protocolapwi-rxspoolerlast updated 2018/11/274393 udpReservedN/Alast updated 2018/11/274394 tcpReservedN/Alast updated 2018/11/274394 udpAmerican Printware Discoveryapwi-disclast updated 2018/11/274395 tcpOmniVision communication for Virtual environmentsomnivisionesxlast updated 2018/11/274395 udpOmniVision communication for Virtual environmentsomnivisionesxlast updated 2018/11/274396 tcpFly Object Spaceflylast updated 2018/11/274396 udpReservedN/Alast updated 2018/11/274397-4399 UnassignedN/Alast updated 2018/11/274400 tcpASIGRA Servicesds-srvlast updated 2018/11/274400 udpASIGRA Servicesds-srvlast updated 2018/11/274401 tcpASIGRA Televaulting DS-System Serviceds-srvrlast updated 2018/11/274401 udpASIGRA Televaulting DS-System Serviceds-srvrlast updated 2018/11/274402 tcpASIGRA Televaulting DS-Client Serviceds-clntlast updated 2018/11/274402 udpASIGRA Televaulting DS-Client Serviceds-clntlast updated 2018/11/274403 tcpASIGRA Televaulting DS-Client Monitoring/Managementds-userlast updated 2018/11/274403 udpASIGRA Televaulting DS-Client Monitoring/Managementds-userlast updated 2018/11/274404 tcpASIGRA Televaulting DS-System Monitoring/Managementds-adminlast updated 2018/11/274404 udpASIGRA Televaulting DS-System Monitoring/Managementds-adminlast updated 2018/11/274405 tcpASIGRA Televaulting Message Level Restore serviceds-maillast updated 2018/11/274405 udpASIGRA Televaulting Message Level Restore serviceds-maillast updated 2018/11/274406 tcpASIGRA Televaulting DS-Sleeper Serviceds-slplast updated 2018/11/274406 udpASIGRA Televaulting DS-Sleeper Serviceds-slplast updated 2018/11/274407 tcpNetwork Access Control Agentnacagentlast updated 2018/11/274407 udpReservedN/Alast updated 2018/11/274408 tcpSLS Technology Control Centreslscclast updated 2018/11/274408 udpReservedN/Alast updated 2018/11/274409 tcpNet-Cabinet comunicationnetcabinet-comlast updated 2018/11/274409 udpReservedN/Alast updated 2018/11/274410 tcpRIB iTWO Application Serveritwo-serverlast updated 2018/11/274410 udpReservedN/Alast updated 2018/11/274411 tcpFound Messaging Protocolfoundlast updated 2018/11/274411 udpReservedN/Alast updated 2018/11/274412 tcpReservedN/Alast updated 2018/11/274412 udpSmallChatsmallchatlast updated 2018/11/274413 tcpAVI Systems NMSavi-nmslast updated 2018/11/274413 udpAVI Systems NMSavi-nms-disclast updated 2018/11/274414 tcpUpdog Monitoring and Status Frameworkupdoglast updated 2018/11/274414 udpReservedN/Alast updated 2018/11/274415 tcpBrocade Virtual Router Requestbrcd-vr-reqlast updated 2018/11/274415 udpReservedN/Alast updated 2018/11/274416 tcpPJJ Media Playerpjj-playerlast updated 2018/11/274416 udpPJJ Media Player discoverypjj-player-disclast updated 2018/11/274417 tcpWorkflow Director Communicationworkflowdirlast updated 2018/11/274417 udpReservedN/Alast updated 2018/11/274418 tcpReservedN/Alast updated 2018/11/274418 udpAXYS communication protocolaxysbridgelast updated 2018/11/274419 tcpColnod Binary Protocolcbplast updated 2018/11/274419 udpReservedN/Alast updated 2018/11/274420 tcpNVM Express over Fabrics storage accessnvmelast updated 2018/11/274420 udpNVM Express over Fabrics storage accessnvmelast updated 2018/11/274421 tcpMulti-Platform Remote Management for Cloud Infrastructurescaleftlast updated 2018/11/274421 udpReservedN/Alast updated 2018/11/274422 tcpTSEP Installation Service Protocoltsepisplast updated 2018/11/274422 udpReservedN/Alast updated 2018/11/274423 tcpthingkit secure meshthingkitlast updated 2018/11/274423 udpReservedN/Alast updated 2018/11/274424 UnassignedN/Alast updated 2018/11/274425 tcpNetROCKEY6 SMART Plus Servicenetrockey6last updated 2018/11/274425 udpNetROCKEY6 SMART Plus Servicenetrockey6last updated 2018/11/274426 tcpSMARTS Beacon Portbeacon-port-2last updated 2018/11/274426 udpSMARTS Beacon Portbeacon-port-2last updated 2018/11/274427 tcpDrizzle database serverdrizzlelast updated 2018/11/274427 udpReservedN/Alast updated 2018/11/274428 tcpOMV-Investigation Server-Clientomviserverlast updated 2018/11/274428 udpReservedN/Alast updated 2018/11/274429 tcpOMV Investigation Agent-Serveromviagentlast updated 2018/11/274429 udpReservedN/Alast updated 2018/11/274430 tcpREAL SQL Serverrsqlserverlast updated 2018/11/274430 udpREAL SQL Serverrsqlserverlast updated 2018/11/274431 tcpadWISE Pipewspipelast updated 2018/11/274431 udpReservedN/Alast updated 2018/11/274432 tcpL-ACOUSTICS managementl-acousticslast updated 2018/11/274432 udpL-ACOUSTICS managementl-acousticslast updated 2018/11/274433 tcpVersile Object Protocolvoplast updated 2018/11/274433 udpReservedN/Alast updated 2018/11/274434-4440 UnassignedN/Alast updated 2018/11/274441 tcpReservedN/Alast updated 2018/11/274441 udpNetblox Protocolnetbloxlast updated 2018/11/274442 tcpSarissarislast updated 2018/11/274442 udpSarissarislast updated 2018/11/274443 tcpPharospharoslast updated 2018/11/274443 udpPharospharoslast updated 2018/11/274444 tcpKRB524krb524last updated 2018/11/274444 udpKRB524krb524last updated 2018/11/274444 tcp (nv-video)NV Video defaultnv-videolast updated 2018/11/274444 udp (nv-video)NV Video defaultnv-videolast updated 2018/11/274445 tcpUPNOTIFYPupnotifyplast updated 2018/11/274445 udpUPNOTIFYPupnotifyplast updated 2018/11/274446 tcpN1-FWPn1-fwplast updated 2018/11/274446 udpN1-FWPn1-fwplast updated 2018/11/274447 tcpN1-RMGMTn1-rmgmtlast updated 2018/11/274447 udpN1-RMGMTn1-rmgmtlast updated 2018/11/274448 tcpASC Licence Managerasc-slmdlast updated 2018/11/274448 udpASC Licence Managerasc-slmdlast updated 2018/11/274449 tcpPrivateWireprivatewirelast updated 2018/11/274449 udpPrivateWireprivatewirelast updated 2018/11/274450 tcpCommon ASCII Messaging Protocolcamplast updated 2018/11/274450 udpCommon ASCII Messaging Protocolcamplast updated 2018/11/274451 tcpCTI System Msgctisystemmsglast updated 2018/11/274451 udpCTI System Msgctisystemmsglast updated 2018/11/274452 tcpCTI Program Loadctiprogramloadlast updated 2018/11/274452 udpCTI Program Loadctiprogramloadlast updated 2018/11/274453 tcpNSS Alert Managernssalertmgrlast updated 2018/11/274453 udpNSS Alert Managernssalertmgrlast updated 2018/11/274454 tcpNSS Agent Managernssagentmgrlast updated 2018/11/274454 udpNSS Agent Managernssagentmgrlast updated 2018/11/274455 tcpPR Chat Userprchat-userlast updated 2018/11/274455 udpPR Chat Userprchat-userlast updated 2018/11/274456 tcpPR Chat Serverprchat-serverlast updated 2018/11/274456 udpPR Chat Serverprchat-serverlast updated 2018/11/274457 tcpPR RegisterprRegisterlast updated 2018/11/274457 udpPR RegisterprRegisterlast updated 2018/11/274458 tcpMatrix Configuration Protocolmcplast updated 2018/11/274458 udpMatrix Configuration Protocolmcplast updated 2018/11/274459-4483 UnassignedN/Alast updated 2018/11/274484 tcphpssmgmt servicehpssmgmtlast updated 2018/11/274484 udphpssmgmt servicehpssmgmtlast updated 2018/11/274485 tcpAssyst Data Repository Serviceassyst-drlast updated 2018/11/274485 udpReservedN/Alast updated 2018/11/274486 tcpIntegrated Client Message Serviceicmslast updated 2018/11/274486 udpIntegrated Client Message Serviceicmslast updated 2018/11/274487 tcpProtocol for Remote Execution over TCPprex-tcplast updated 2018/11/274487 udpReservedN/Alast updated 2018/11/274488 tcpApple Wide Area Connectivity Service ICE Bootstrapawacs-icelast updated 2018/11/274488 udpApple Wide Area Connectivity Service ICE Bootstrapawacs-icelast updated 2018/11/274489-4499 UnassignedN/Alast updated 2018/11/274500 tcpIPsec NAT-Traversalipsec-nat-tlast updated 2018/11/274500 udpIPsec NAT-Traversalipsec-nat-tlast updated 2018/11/274501 UnassignedN/Alast updated 2018/11/274502 sctpA25 (FAP-FGW)a25-fap-fgwlast updated 2018/11/274503-4533 UnassignedN/Alast updated 2018/11/274534 tcpReservedN/Alast updated 2018/11/274534 udpArmagetron Advanced Game Serverarmagetronadlast updated 2018/11/274535 tcpEvent Heap Serverehslast updated 2018/11/274535 udpEvent Heap Serverehslast updated 2018/11/274536 tcpEvent Heap Server SSLehs-ssllast updated 2018/11/274536 udpEvent Heap Server SSLehs-ssllast updated 2018/11/274537 tcpWSS Security Servicewssauthsvclast updated 2018/11/274537 udpWSS Security Servicewssauthsvclast updated 2018/11/274538 tcpSoftware Data Exchange Gatewayswx-gatelast updated 2018/11/274538 udpSoftware Data Exchange Gatewayswx-gatelast updated 2018/11/274539-4544 UnassignedN/Alast updated 2018/11/274545 tcpWorldScoresworldscoreslast updated 2018/11/274545 udpWorldScoresworldscoreslast updated 2018/11/274546 tcpSF License Manager (Sentinel)sf-lmlast updated 2018/11/274546 udpSF License Manager (Sentinel)sf-lmlast updated 2018/11/274547 tcpLanner License Managerlanner-lmlast updated 2018/11/274547 udpLanner License Managerlanner-lmlast updated 2018/11/274548 tcpSynchromeshsynchromeshlast updated 2018/11/274548 udpSynchromeshsynchromeshlast updated 2018/11/274549 tcpAegate PMR Serviceaegatelast updated 2018/11/274549 udpAegate PMR Serviceaegatelast updated 2018/11/274550 tcpPerman I Interbase Servergds-adppiw-dblast updated 2018/11/274550 udpPerman I Interbase Servergds-adppiw-dblast updated 2018/11/274551 tcpMIH Servicesieee-mihlast updated 2018/11/274551 udpMIH Servicesieee-mihlast updated 2018/11/274552 tcpMen and Mice Monitoringmenandmice-monlast updated 2018/11/274552 udpMen and Mice Monitoringmenandmice-monlast updated 2018/11/274553 tcpICS host servicesicshostsvclast updated 2018/11/274553 udpReservedN/Alast updated 2018/11/274554 tcpMS FRS Replicationmsfrslast updated 2018/11/274554 udpMS FRS Replicationmsfrslast updated 2018/11/274555 tcpRSIP Portrsiplast updated 2018/11/274555 udpRSIP Portrsiplast updated 2018/11/274556 tcpDTN Bundle TCP CL Protocoldtn-bundlelast updated 2018/11/274556 udpDTN Bundle UDP CL Protocoldtn-bundlelast updated 2018/11/274556 dccpDTN Bundle DCCP CL Protocoldtn-bundlelast updated 2018/11/274557 tcpReservedN/Alast updated 2018/11/274557 udpMarathon everRun Quorum Service Servermtcevrunqsslast updated 2018/11/274558 tcpReservedN/Alast updated 2018/11/274558 udpMarathon everRun Quorum Service Managermtcevrunqmanlast updated 2018/11/274559 tcpHylaFAXhylafaxlast updated 2018/11/274559 udpHylaFAXhylafaxlast updated 2018/11/274560-4562 UnassignedN/Alast updated 2018/11/274563 tcpAmahi Anywhereamahi-anywherelast updated 2018/11/274563 udpReservedN/Alast updated 2018/11/274564-4565 UnassignedN/Alast updated 2018/11/274566 tcpKids Watch Time Control Servicekwtclast updated 2018/11/274566 udpKids Watch Time Control Servicekwtclast updated 2018/11/274567 tcpTRAMtramlast updated 2018/11/274567 udpTRAMtramlast updated 2018/11/274568 tcpBMC Reportingbmc-reportinglast updated 2018/11/274568 udpBMC Reportingbmc-reportinglast updated 2018/11/274569 tcpInter-Asterisk eXchangeiaxlast updated 2018/11/274569 udpInter-Asterisk eXchangeiaxlast updated 2018/11/274570 tcpService to distribute and update within a site deployment information for Oracle Communications Suitedeploymentmaplast updated 2018/11/274570 udpReservedN/Alast updated 2018/11/274571-4572 UnassignedN/Alast updated 2018/11/274573 tcpA port for communication between a server and client for a custom backup systemcardifftec-backlast updated 2018/11/274573 udpReservedN/Alast updated 2018/11/274574-4589 UnassignedN/Alast updated 2018/11/274590 tcpRID over HTTP/TLSridlast updated 2018/11/274590 udpReservedN/Alast updated 2018/11/274591 tcpHRPD L3T (AT-AN)l3t-at-anlast updated 2018/11/274591 udpHRPD L3T (AT-AN)l3t-at-anlast updated 2018/11/274592 tcpReservedN/Alast updated 2018/11/274592 udpHRPD-ITH (AT-AN)hrpd-ith-at-anlast updated 2018/11/274593 tcpIPT (ANRI-ANRI)ipt-anri-anrilast updated 2018/11/274593 udpIPT (ANRI-ANRI)ipt-anri-anrilast updated 2018/11/274594 tcpIAS-Session (ANRI-ANRI)ias-sessionlast updated 2018/11/274594 udpIAS-Session (ANRI-ANRI)ias-sessionlast updated 2018/11/274595 tcpIAS-Paging (ANRI-ANRI)ias-paginglast updated 2018/11/274595 udpIAS-Paging (ANRI-ANRI)ias-paginglast updated 2018/11/274596 tcpIAS-Neighbor (ANRI-ANRI)ias-neighborlast updated 2018/11/274596 udpIAS-Neighbor (ANRI-ANRI)ias-neighborlast updated 2018/11/274597 tcpA21 (AN-1xBS)a21-an-1xbslast updated 2018/11/274597 udpA21 (AN-1xBS)a21-an-1xbslast updated 2018/11/274598 tcpA16 (AN-AN)a16-an-anlast updated 2018/11/274598 udpA16 (AN-AN)a16-an-anlast updated 2018/11/274599 tcpA17 (AN-AN)a17-an-anlast updated 2018/11/274599 udpA17 (AN-AN)a17-an-anlast updated 2018/11/274600 tcpPiranha1piranha1last updated 2018/11/274600 udpPiranha1piranha1last updated 2018/11/274601 tcpPiranha2piranha2last updated 2018/11/274601 udpPiranha2piranha2last updated 2018/11/274602 tcpEAX MTS Servermtsserverlast updated 2018/11/274602 udpReservedN/Alast updated 2018/11/274603 tcpMen & Mice Upgrade Agentmenandmice-upglast updated 2018/11/274603 udpReservedN/Alast updated 2018/11/274604 tcpIdentity Registration Protocolirplast updated 2018/11/274604 udpReservedN/Alast updated 2018/11/274605 tcpDirect End to End Secure Chat Protocolsixchatlast updated 2018/11/274605 udpReservedN/Alast updated 2018/11/274606-4620 UnassignedN/Alast updated 2018/11/274621 tcpReservedN/Alast updated 2018/11/274621 udpBidirectional single port remote radio VOIP and Control streamventosolast updated 2018/11/274622-4657 UnassignedN/Alast updated 2018/11/274658 tcpPlayStation2 App Portplaysta2-applast updated 2018/11/274658 udpPlayStation2 App Portplaysta2-applast updated 2018/11/274659 tcpPlayStation2 Lobby Portplaysta2-loblast updated 2018/11/274659 udpPlayStation2 Lobby Portplaysta2-loblast updated 2018/11/274660 tcpsmaclmgrsmaclmgrlast updated 2018/11/274660 udpsmaclmgrsmaclmgrlast updated 2018/11/274661 tcpKar2ouche Peer location servicekar2ouchelast updated 2018/11/274661 udpKar2ouche Peer location servicekar2ouchelast updated 2018/11/274662 tcpOrbitNet Message Serviceomslast updated 2018/11/274662 udpOrbitNet Message Serviceomslast updated 2018/11/274663 tcpNote It! Message Servicenoteitlast updated 2018/11/274663 udpNote It! Message Servicenoteitlast updated 2018/11/274664 tcpRimage Messaging Serveremslast updated 2018/11/274664 udpRimage Messaging Serveremslast updated 2018/11/274665 tcpContainer Client Message Servicecontclientmslast updated 2018/11/274665 udpContainer Client Message Servicecontclientmslast updated 2018/11/274666 tcpE-Port Message Serviceeportcommlast updated 2018/11/274666 udpE-Port Message Serviceeportcommlast updated 2018/11/274667 tcpMMA Comm Servicesmmacommlast updated 2018/11/274667 udpMMA Comm Servicesmmacommlast updated 2018/11/274668 tcpMMA EDS Servicemmaedslast updated 2018/11/274668 udpMMA EDS Servicemmaedslast updated 2018/11/274669 tcpE-Port Data Serviceeportcommdatalast updated 2018/11/274669 udpE-Port Data Serviceeportcommdatalast updated 2018/11/274670 tcpLight packets transfer protocollightlast updated 2018/11/274670 udpLight packets transfer protocollightlast updated 2018/11/274671 tcpBull RSF action serveracterlast updated 2018/11/274671 udpBull RSF action serveracterlast updated 2018/11/274672 tcpremote file access serverrfalast updated 2018/11/274672 udpremote file access serverrfalast updated 2018/11/274673 tcpCXWS Operationscxwslast updated 2018/11/274673 udpCXWS Operationscxwslast updated 2018/11/274674 tcpAppIQ Agent Managementappiq-mgmtlast updated 2018/11/274674 udpAppIQ Agent Managementappiq-mgmtlast updated 2018/11/274675 tcpBIAP Device Statusdhct-statuslast updated 2018/11/274675 udpBIAP Device Statusdhct-statuslast updated 2018/11/274676 tcpBIAP Generic Alertdhct-alertslast updated 2018/11/274676 udpBIAP Generic Alertdhct-alertslast updated 2018/11/274677 tcpBusiness Continuity Servibcslast updated 2018/11/274677 udpBusiness Continuity Servibcslast updated 2018/11/274678 tcpboundary traversaltraversallast updated 2018/11/274678 udpboundary traversaltraversallast updated 2018/11/274679 tcpMGE UPS Supervisionmgesupervisionlast updated 2018/11/274679 udpMGE UPS Supervisionmgesupervisionlast updated 2018/11/274680 tcpMGE UPS Managementmgemanagementlast updated 2018/11/274680 udpMGE UPS Managementmgemanagementlast updated 2018/11/274681 tcpParliant Telephony Systemparliantlast updated 2018/11/274681 udpParliant Telephony Systemparliantlast updated 2018/11/274682 tcpfinisarfinisarlast updated 2018/11/274682 udpfinisarfinisarlast updated 2018/11/274683 tcpSpike Clipboard Servicespikelast updated 2018/11/274683 udpSpike Clipboard Servicespikelast updated 2018/11/274684 tcpRFID Reader Protocol 1.0rfid-rp1last updated 2018/11/274684 udpRFID Reader Protocol 1.0rfid-rp1last updated 2018/11/274685 tcpAutopac Protocolautopaclast updated 2018/11/274685 udpAutopac Protocolautopaclast updated 2018/11/274686 tcpManina Service Protocolmsp-oslast updated 2018/11/274686 udpManina Service Protocolmsp-oslast updated 2018/11/274687 tcpNetwork Scanner Tool FTPnstlast updated 2018/11/274687 udpNetwork Scanner Tool FTPnstlast updated 2018/11/274688 tcpMobile P2P Servicemobile-p2plast updated 2018/11/274688 udpMobile P2P Servicemobile-p2plast updated 2018/11/274689 tcpAltova DatabaseCentralaltovacentrallast updated 2018/11/274689 udpAltova DatabaseCentralaltovacentrallast updated 2018/11/274690 tcpPrelude IDS message protopreludelast updated 2018/11/274690 udpPrelude IDS message protopreludelast updated 2018/11/274691 tcpmonotone Netsync Protocolmtnlast updated 2018/11/274691 udpmonotone Netsync Protocolmtnlast updated 2018/11/274692 tcpConspiracy messagingconspiracylast updated 2018/11/274692 udpConspiracy messagingconspiracylast updated 2018/11/274693-4699 UnassignedN/Alast updated 2018/11/274700 tcpNetXMS Agentnetxms-agentlast updated 2018/11/274700 udpNetXMS Agentnetxms-agentlast updated 2018/11/274701 tcpNetXMS Managementnetxms-mgmtlast updated 2018/11/274701 udpNetXMS Managementnetxms-mgmtlast updated 2018/11/274702 tcpNetXMS Server Synchronizationnetxms-synclast updated 2018/11/274702 udpNetXMS Server Synchronizationnetxms-synclast updated 2018/11/274703 tcpNetwork Performance Quality Evaluation System Test Servicenpqes-testlast updated 2018/11/274703 udpReservedN/Alast updated 2018/11/274704 tcpAssuria Insiderassuria-inslast updated 2018/11/274704 udpReservedN/Alast updated 2018/11/274705-4710 UnassignedN/Alast updated 2018/11/274711 tcpTrinity Trust Network Node Communicationtrinity-distlast updated 2018/11/274711 udpTrinity Trust Network Node Communicationtrinity-distlast updated 2018/11/274711 sctpTrinity Trust Network Node Communicationtrinity-distlast updated 2018/11/274712-4724 UnassignedN/Alast updated 2018/11/274725 tcpTruckStar Servicetruckstarlast updated 2018/11/274725 udpTruckStar Servicetruckstarlast updated 2018/11/274726 tcpReservedN/Alast updated 2018/11/274726 udpA26 (FAP-FGW)a26-fap-fgwlast updated 2018/11/274727 tcpF-Link Client Information Servicefcislast updated 2018/11/274727 udpF-Link Client Information Service Discoveryfcis-disclast updated 2018/11/274728 tcpCA Port Multiplexercapmuxlast updated 2018/11/274728 udpCA Port Multiplexercapmuxlast updated 2018/11/274729 tcpReservedN/Alast updated 2018/11/274729 udpGSM Interface Tapgsmtaplast updated 2018/11/274730 tcpGearman Job Queue Systemgearmanlast updated 2018/11/274730 udpGearman Job Queue Systemgearmanlast updated 2018/11/274731 tcpRemote Capture Protocolremcaplast updated 2018/11/274731 udpReservedN/Alast updated 2018/11/274732 tcpReservedN/Alast updated 2018/11/274732 udpOHM server triggerohmtriggerlast updated 2018/11/274733 tcpRES Orchestration Catalog Servicesresorcslast updated 2018/11/274733 udpReservedN/Alast updated 2018/11/274734-4736 UnassignedN/Alast updated 2018/11/274737 tcpIPDR/SPipdr-splast updated 2018/11/274737 udpIPDR/SPipdr-splast updated 2018/11/274738 tcpSoleraTec Locatorsolera-lpnlast updated 2018/11/274738 udpSoleraTec Locatorsolera-lpnlast updated 2018/11/274739 tcpIP Flow Info Exportipfixlast updated 2018/11/274739 udpIP Flow Info Exportipfixlast updated 2018/11/274739 sctpIP Flow Info Exportipfixlast updated 2018/11/274740 tcpipfix protocol over TLSipfixslast updated 2018/11/274740 sctpipfix protocol over DTLSipfixslast updated 2018/11/274740 udpipfix protocol over DTLSipfixslast updated 2018/11/274741 tcpLuminizer Managerlumimgrdlast updated 2018/11/274741 udpLuminizer Managerlumimgrdlast updated 2018/11/274742 tcpSICCTsicctlast updated 2018/11/274742 udpSICCT Service Discovery Protocolsicct-sdplast updated 2018/11/274743 tcpopenhpi HPI serviceopenhpidlast updated 2018/11/274743 udpopenhpi HPI serviceopenhpidlast updated 2018/11/274744 tcpInternet File Synchronization Protocolifsplast updated 2018/11/274744 udpInternet File Synchronization Protocolifsplast updated 2018/11/274745 tcpFunambol Mobile Pushfmplast updated 2018/11/274745 udpFunambol Mobile Pushfmplast updated 2018/11/274746 tcpReservedN/Alast updated 2018/11/274746 udpIntelliAdmin Discoveryintelliadm-disclast updated 2018/11/274747 udppeer-to-peer file exchange protocolbuschtrommellast updated 2018/11/274747 tcpReservedN/Alast updated 2018/11/274748-4748 UnassignedN/Alast updated 2018/11/274749 tcpProfile for Macprofilemaclast updated 2018/11/274749 udpProfile for Macprofilemaclast updated 2018/11/274750 tcpSimple Service Auto Discoveryssadlast updated 2018/11/274750 udpSimple Service Auto Discoveryssadlast updated 2018/11/274751 tcpSimple Policy Control Protocolspocplast updated 2018/11/274751 udpSimple Policy Control Protocolspocplast updated 2018/11/274752 tcpSimple Network Audio Protocolsnaplast updated 2018/11/274752 udpSimple Network Audio Protocolsnaplast updated 2018/11/274753 tcpSimple Invocation of Methods Over Network (SIMON)simonlast updated 2018/11/274753 udpSimple Invocation of Methods Over Network (SIMON) Discoverysimon-disclast updated 2018/11/274754 tcpReservedN/Alast updated 2018/11/274754 udpGRE-in-UDP Encapsulationgre-in-udplast updated 2018/11/274755 tcpReservedN/Alast updated 2018/11/274755 udpGRE-in-UDP Encapsulation with DTLSgre-udp-dtlslast updated 2018/11/274756 tcpReticle Decision CenterRDCenterlast updated 2018/11/274756 udpReservedN/Alast updated 2018/11/274757-4773 UnassignedN/Alast updated 2018/11/274774 tcpConverge RPCconvergelast updated 2018/11/274774 udpReservedN/Alast updated 2018/11/274775-4783 UnassignedN/Alast updated 2018/11/274784 tcpBFD Multihop Controlbfd-multi-ctllast updated 2018/11/274784 udpBFD Multihop Controlbfd-multi-ctllast updated 2018/11/274785 tcpReservedN/Alast updated 2018/11/274785 udpCisco Nexus Control Protocolcncplast updated 2018/11/274786 tcpSmart Install Servicesmart-installlast updated 2018/11/274786 udpReservedN/Alast updated 2018/11/274787 tcpService Insertion Architecture (SIA) Control-Planesia-ctrl-planelast updated 2018/11/274787 udpReservedN/Alast updated 2018/11/274788 tcpeXtensible Messaging Client Protocolxmcplast updated 2018/11/274788 udpReservedN/Alast updated 2018/11/274789 udpVirtual eXtensible Local Area Network (VXLAN)vxlanlast updated 2018/11/274789 tcpReservedN/Alast updated 2018/11/274790 udpGeneric Protocol Extension for Virtual eXtensible Local Area Network (VXLAN)vxlan-gpelast updated 2018/11/274790 tcpReservedN/Alast updated 2018/11/274791 udpIP Routable RocErocelast updated 2018/11/274791 tcpReservedN/Alast updated 2018/11/274792-4799 UnassignedN/Alast updated 2018/11/274800 tcpIcona Instant Messenging Systemiimslast updated 2018/11/274800 udpIcona Instant Messenging Systemiimslast updated 2018/11/274801 tcpIcona Web Embedded Chatiweclast updated 2018/11/274801 udpIcona Web Embedded Chatiweclast updated 2018/11/274802 tcpIcona License System Serverilsslast updated 2018/11/274802 udpIcona License System Serverilsslast updated 2018/11/274803 tcpNotateit Messagingnotateitlast updated 2018/11/274803 udpNotateit Messaging Discoverynotateit-disclast updated 2018/11/274804 tcpReservedN/Alast updated 2018/11/274804 udpAJA ntv4 Video System Discoveryaja-ntv4-disclast updated 2018/11/274805-4826 UnassignedN/Alast updated 2018/11/274827 tcpHTCPhtcplast updated 2018/11/274827 udpHTCPhtcplast updated 2018/11/274828-4836 UnassignedN/Alast updated 2018/11/274837 tcpVaradero-0varadero-0last updated 2018/11/274837 udpVaradero-0varadero-0last updated 2018/11/274838 tcpVaradero-1varadero-1last updated 2018/11/274838 udpVaradero-1varadero-1last updated 2018/11/274839 tcpVaradero-2varadero-2last updated 2018/11/274839 udpVaradero-2varadero-2last updated 2018/11/274840 tcpOPC UA Connection Protocolopcua-tcplast updated 2018/11/274840 udpOPC UA Multicast Datagram Protocolopcua-udplast updated 2018/11/274841 tcpQUOSA Virtual Library Servicequosalast updated 2018/11/274841 udpQUOSA Virtual Library Servicequosalast updated 2018/11/274842 tcpnCode ICE-flow Library AppServergw-asvlast updated 2018/11/274842 udpnCode ICE-flow Library AppServergw-asvlast updated 2018/11/274843 tcpOPC UA TCP Protocol over TLS/SSLopcua-tlslast updated 2018/11/274843 udpOPC UA TCP Protocol over TLS/SSLopcua-tlslast updated 2018/11/274844 tcpnCode ICE-flow Library LogServergw-loglast updated 2018/11/274844 udpnCode ICE-flow Library LogServergw-loglast updated 2018/11/274845 tcpWordCruncher Remote Library Servicewcr-remliblast updated 2018/11/274845 udpWordCruncher Remote Library Servicewcr-remliblast updated 2018/11/274846 tcpContamac ICM Service IANA assigned this well-formed service name as a replacement for "contamac_icm".contamac-icmlast updated 2018/11/274846 tcp (contamac_icm)Contamac ICM Servicecontamac_icmlast updated 2018/11/274846 udpContamac ICM Service IANA assigned this well-formed service name as a replacement for "contamac_icm".contamac-icmlast updated 2018/11/274846 udp (contamac_icm)Contamac ICM Servicecontamac_icmlast updated 2018/11/274847 tcpWeb Fresh Communicationwfclast updated 2018/11/274847 udpWeb Fresh Communicationwfclast updated 2018/11/274848 tcpApp Server - Admin HTTPappserv-httplast updated 2018/11/274848 udpApp Server - Admin HTTPappserv-httplast updated 2018/11/274849 tcpApp Server - Admin HTTPSappserv-httpslast updated 2018/11/274849 udpApp Server - Admin HTTPSappserv-httpslast updated 2018/11/274850 tcpSun App Server - NAsun-as-nodeagtlast updated 2018/11/274850 udpSun App Server - NAsun-as-nodeagtlast updated 2018/11/274851 tcpApache Derby Replicationderby-replilast updated 2018/11/274851 udpApache Derby Replicationderby-replilast updated 2018/11/274852-4866 UnassignedN/Alast updated 2018/11/274867 tcpUnify Debuggerunify-debuglast updated 2018/11/274867 udpUnify Debuggerunify-debuglast updated 2018/11/274868 tcpPhoton Relayphrelaylast updated 2018/11/274868 udpPhoton Relayphrelaylast updated 2018/11/274869 tcpPhoton Relay Debugphrelaydbglast updated 2018/11/274869 udpPhoton Relay Debugphrelaydbglast updated 2018/11/274870 tcpCitcom Tracking Servicecc-trackinglast updated 2018/11/274870 udpCitcom Tracking Servicecc-trackinglast updated 2018/11/274871 tcpWiredwiredlast updated 2018/11/274871 udpWiredwiredlast updated 2018/11/274872-4875 UnassignedN/Alast updated 2018/11/274876 tcpTritium CAN Bus Bridge Servicetritium-canlast updated 2018/11/274876 udpTritium CAN Bus Bridge Servicetritium-canlast updated 2018/11/274877 tcpLighting Management Control Systemlmcslast updated 2018/11/274877 udpLighting Management Control Systemlmcslast updated 2018/11/274878 tcpReservedN/Alast updated 2018/11/274878 udpAgilent Instrument Discoveryinst-discoverylast updated 2018/11/274879 tcpWSDL Event Receiverwsdl-eventlast updated 2018/11/274879 udpReservedN/Alast updated 2018/11/274880 tcpIVI High-Speed LAN Instrument Protocolhisliplast updated 2018/11/274880 udpReservedN/Alast updated 2018/11/274881 tcpReservedN/Alast updated 2018/11/274881 udpSOCP Time Synchronization Protocolsocp-tlast updated 2018/11/274882 tcpReservedN/Alast updated 2018/11/274882 udpSOCP Control Protocolsocp-clast updated 2018/11/274883 tcpMeier-Phelps License Serverwmlserverlast updated 2018/11/274883 udpReservedN/Alast updated 2018/11/274884 tcpHiveStor Distributed File Systemhivestorlast updated 2018/11/274884 udpHiveStor Distributed File Systemhivestorlast updated 2018/11/274885 tcpABBSabbslast updated 2018/11/274885 udpABBSabbslast updated 2018/11/274886-4887 UnassignedN/Alast updated 2018/11/274888 tcpxcap code analysis portal public user accessxcap-portallast updated 2018/11/274888 udpReservedN/Alast updated 2018/11/274889 tcpxcap code analysis portal cluster control and administrationxcap-controllast updated 2018/11/274889 udpReservedN/Alast updated 2018/11/274890-4893 UnassignedN/Alast updated 2018/11/274894 tcpLysKOM Protocol Alyskomlast updated 2018/11/274894 udpLysKOM Protocol Alyskomlast updated 2018/11/274895-4898 UnassignedN/Alast updated 2018/11/274899 tcpRAdmin Portradmin-portlast updated 2018/11/274899 udpRAdmin Portradmin-portlast updated 2018/11/274900 tcpHFSQL Client/Server Database Enginehfcslast updated 2018/11/274900 udpHFSQL Client/Server Database Enginehfcslast updated 2018/11/274901 tcpFileLocator Remote Search Agent IANA assigned this well-formed service name as a replacement for "flr_agent".flr-agentlast updated 2018/11/274901 tcp (flr_agent)FileLocator Remote Search Agentflr_agentlast updated 2018/11/274901 udpReservedN/Alast updated 2018/11/274902 tcpmagicCONROL RF and Data Interfacemagiccontrollast updated 2018/11/274902 udpReservedN/Alast updated 2018/11/274903-4911 UnassignedN/Alast updated 2018/11/274912 tcpTechnicolor LUT Access Protocollutaplast updated 2018/11/274912 udpReservedN/Alast updated 2018/11/274913 tcpLUTher Control Protocollutcplast updated 2018/11/274914 tcpBones Remote Controlboneslast updated 2018/11/274914 udpBones Remote Controlboneslast updated 2018/11/274915 tcpFibics Remote Control Servicefrcslast updated 2018/11/274915 udpReservedN/Alast updated 2018/11/274916-4935 UnassignedN/Alast updated 2018/11/274936 udpSignal protocol port for autonomic networkingan-signalinglast updated 2018/11/274936 tcpReservedN/Alast updated 2018/11/274937 tcpReservedN/Alast updated 2018/11/274937 udpATSC-M/H Service Signaling Channelatsc-mh-ssclast updated 2018/11/274938-4939 UnassignedN/Alast updated 2018/11/274940 tcpEquitrac Officeeq-office-4940last updated 2018/11/274940 udpEquitrac Officeeq-office-4940last updated 2018/11/274941 tcpEquitrac Officeeq-office-4941last updated 2018/11/274941 udpEquitrac Officeeq-office-4941last updated 2018/11/274942 tcpEquitrac Officeeq-office-4942last updated 2018/11/274942 udpEquitrac Officeeq-office-4942last updated 2018/11/274943-4948 UnassignedN/Alast updated 2018/11/274949 tcpMunin Graphing Frameworkmuninlast updated 2018/11/274949 udpMunin Graphing Frameworkmuninlast updated 2018/11/274950 tcpSybase Server Monitorsybasesrvmonlast updated 2018/11/274950 udpSybase Server Monitorsybasesrvmonlast updated 2018/11/274951 tcpPWG WIMSpwgwimslast updated 2018/11/274951 udpPWG WIMSpwgwimslast updated 2018/11/274952 tcpSAG Directory Serversagxtsdslast updated 2018/11/274952 udpSAG Directory Serversagxtsdslast updated 2018/11/274953 tcpSynchronization Arbiterdbsyncarbiterlast updated 2018/11/274953 udpReservedN/Alast updated 2018/11/274954-4968 UnassignedN/Alast updated 2018/11/274969 tcpCCSS QMessageMonitorccss-qmmlast updated 2018/11/274969 udpCCSS QMessageMonitorccss-qmmlast updated 2018/11/274970 tcpCCSS QSystemMonitorccss-qsmlast updated 2018/11/274970 udpCCSS QSystemMonitorccss-qsmlast updated 2018/11/274971 tcpBackUp and Restore Programburplast updated 2018/11/274971 udpReservedN/Alast updated 2018/11/274972-4979 UnassignedN/Alast updated 2018/11/274980 udpCitrix Virtual Pathctxs-vpplast updated 2018/11/274980 tcpReservedN/Alast updated 2018/11/274981-4982 UnassignedN/Alast updated 2018/11/274983 UnassignedN/Alast updated 2018/11/274984 tcpWebYastwebyastlast updated 2018/11/274984 udpReservedN/Alast updated 2018/11/274985 tcpGER HC Standardgerhcslast updated 2018/11/274985 udpReservedN/Alast updated 2018/11/274986 tcpModel Railway Interface Programmriplast updated 2018/11/274986 udpModel Railway Interface Programmriplast updated 2018/11/274987 tcpSMAR Ethernet Port 1smar-se-port1last updated 2018/11/274987 udpSMAR Ethernet Port 1smar-se-port1last updated 2018/11/274988 tcpSMAR Ethernet Port 2smar-se-port2last updated 2018/11/274988 udpSMAR Ethernet Port 2smar-se-port2last updated 2018/11/274989 tcpParallel for GAUSS (tm)parallellast updated 2018/11/274989 udpParallel for GAUSS (tm)parallellast updated 2018/11/274990 tcpBusySync Calendar Synch. Protocolbusycallast updated 2018/11/274990 udpBusySync Calendar Synch. Protocolbusycallast updated 2018/11/274991 tcpVITA Radio Transportvrtlast updated 2018/11/274991 udpVITA Radio Transportvrtlast updated 2018/11/274992-4998 UnassignedN/Alast updated 2018/11/274999 tcpHFSQL Client/Server Database Engine Managerhfcs-managerlast updated 2018/11/274999 udpHFSQL Client/Server Database Engine Managerhfcs-managerlast updated 2018/11/275000 tcpcommplex-mainlast updated 2018/11/275000 udpcommplex-mainlast updated 2018/11/275001 tcpcommplex-linklast updated 2018/11/275001 udpcommplex-linklast updated 2018/11/275002 tcpradio free ethernetrfelast updated 2018/11/275002 udpradio free ethernetrfelast updated 2018/11/275003 tcpFileMaker, Inc. - Proprietary transportfmpro-internallast updated 2018/11/275003 udpFileMaker, Inc. - Proprietary name bindingfmpro-internallast updated 2018/11/275004 tcpRTP media dataavt-profile-1last updated 2018/11/275004 udpRTP media dataavt-profile-1last updated 2018/11/275004 dccpRTP media dataavt-profile-1last updated 2018/11/275005 tcpRTP control protocolavt-profile-2last updated 2018/11/275005 udpRTP control protocolavt-profile-2last updated 2018/11/275005 dccpRTP control protocolavt-profile-2last updated 2018/11/275006 tcpwsm serverwsm-serverlast updated 2018/11/275006 udpwsm serverwsm-serverlast updated 2018/11/275007 tcpwsm server sslwsm-server-ssllast updated 2018/11/275007 udpwsm server sslwsm-server-ssllast updated 2018/11/275008 tcpSynapsis EDGEsynapsis-edgelast updated 2018/11/275008 udpSynapsis EDGEsynapsis-edgelast updated 2018/11/275009 tcpMicrosoft Windows Filesystemwinfslast updated 2018/11/275009 udpMicrosoft Windows Filesystemwinfslast updated 2018/11/275010 tcpTelepathStarttelelpathstartlast updated 2018/11/275010 udpTelepathStarttelelpathstartlast updated 2018/11/275011 tcpTelepathAttacktelelpathattacklast updated 2018/11/275011 udpTelepathAttacktelelpathattacklast updated 2018/11/275012 tcpNetOnTap Servicensplast updated 2018/11/275012 udpNetOnTap Servicensplast updated 2018/11/275013 tcpFileMaker, Inc. - Proprietary transportfmpro-v6last updated 2018/11/275013 udpFileMaker, Inc. - Proprietary transportfmpro-v6last updated 2018/11/275014 tcpReservedN/Alast updated 2018/11/275014 udpOverlay Network Protocolonpsocketlast updated 2018/11/275015 tcpFileMaker, Inc. - Web publishingfmwplast updated 2018/11/275015 udpReservedN/Alast updated 2018/11/275016-5019 UnassignedN/Alast updated 2018/11/275020 tcpzenginkyo-1zenginkyo-1last updated 2018/11/275020 udpzenginkyo-1zenginkyo-1last updated 2018/11/275021 tcpzenginkyo-2zenginkyo-2last updated 2018/11/275021 udpzenginkyo-2zenginkyo-2last updated 2018/11/275022 tcpmice servermicelast updated 2018/11/275022 udpmice servermicelast updated 2018/11/275023 tcpHtuil Server for PLD2htuilsrvlast updated 2018/11/275023 udpHtuil Server for PLD2htuilsrvlast updated 2018/11/275024 tcpSCPI-TELNETscpi-telnetlast updated 2018/11/275024 udpSCPI-TELNETscpi-telnetlast updated 2018/11/275025 tcpSCPI-RAWscpi-rawlast updated 2018/11/275025 udpSCPI-RAWscpi-rawlast updated 2018/11/275026 tcpStorix I/O daemon (data)strexec-dlast updated 2018/11/275026 udpStorix I/O daemon (data)strexec-dlast updated 2018/11/275027 tcpStorix I/O daemon (stat)strexec-slast updated 2018/11/275027 udpStorix I/O daemon (stat)strexec-slast updated 2018/11/275028 tcpQuiqum Virtual Relaisqvrlast updated 2018/11/275028 udpReservedN/Alast updated 2018/11/275029 tcpInfobright Database Serverinfobrightlast updated 2018/11/275029 udpInfobright Database Serverinfobrightlast updated 2018/11/275030 tcpSurfPasssurfpasslast updated 2018/11/275030 udpSurfPasssurfpasslast updated 2018/11/275031 tcpReservedN/Alast updated 2018/11/275031 udpDirect Message Protocoldmplast updated 2018/11/275032 tcpSignaCert Enterprise Trust Server Agentsignacert-agentlast updated 2018/11/275032 udpReservedN/Alast updated 2018/11/275033 tcpJanstor Secure Datajtnetd-serverlast updated 2018/11/275033 udpReservedN/Alast updated 2018/11/275034 tcpJanstor Statusjtnetd-statuslast updated 2018/11/275034 udpReservedN/Alast updated 2018/11/275035-5041 UnassignedN/Alast updated 2018/11/275042 tcpasnaacceler8dbasnaacceler8dblast updated 2018/11/275042 udpasnaacceler8dbasnaacceler8dblast updated 2018/11/275043 tcpShopWorX Administrationswxadminlast updated 2018/11/275043 udpShopWorX Administrationswxadminlast updated 2018/11/275044 tcpLXI Event Servicelxi-evntsvclast updated 2018/11/275044 udpLXI Event Servicelxi-evntsvclast updated 2018/11/275045 tcpOpen Settlement Protocolosplast updated 2018/11/275045 udpReservedN/Alast updated 2018/11/275046 tcpReservedN/Alast updated 2018/11/275046 udpVishay PM UDP Servicevpm-udplast updated 2018/11/275047 tcpReservedN/Alast updated 2018/11/275047 udpiSCAPE Data Broadcastingiscapelast updated 2018/11/275048 tcpTexai Message Servicetexailast updated 2018/11/275048 udpReservedN/Alast updated 2018/11/275049 tcpiVocalize Web Conferenceivocalizelast updated 2018/11/275049 udpiVocalize Web Conferenceivocalizelast updated 2018/11/275050 tcpmultimedia conference control toolmmcclast updated 2018/11/275050 udpmultimedia conference control toolmmcclast updated 2018/11/275051 tcpITA Agentita-agentlast updated 2018/11/275051 udpITA Agentita-agentlast updated 2018/11/275052 tcpITA Managerita-managerlast updated 2018/11/275052 udpITA Managerita-managerlast updated 2018/11/275053 tcpRLM License Serverrlmlast updated 2018/11/275053 udpRLM Discovery Serverrlm-disclast updated 2018/11/275054 tcpRLM administrative interfacerlm-adminlast updated 2018/11/275054 udpReservedN/Alast updated 2018/11/275055 tcpUNOTunotlast updated 2018/11/275055 udpUNOTunotlast updated 2018/11/275056 tcpIntecom Pointspan 1intecom-ps1last updated 2018/11/275056 udpIntecom Pointspan 1intecom-ps1last updated 2018/11/275057 tcpIntecom Pointspan 2intecom-ps2last updated 2018/11/275057 udpIntecom Pointspan 2intecom-ps2last updated 2018/11/275058 tcpReservedN/Alast updated 2018/11/275058 udpLocus Discoverylocus-disclast updated 2018/11/275059 tcpSIP Directory Servicessdslast updated 2018/11/275059 udpSIP Directory Servicessdslast updated 2018/11/275060 tcpSIPsiplast updated 2018/11/275060 udpSIPsiplast updated 2018/11/275060 sctpSIPsiplast updated 2018/11/275061 tcpSIP-TLSsipslast updated 2018/11/275061 udpSIP-TLSsipslast updated 2018/11/275061 sctpSIP-TLSsipslast updated 2018/11/275062 tcpLocalisation accessna-localiselast updated 2018/11/275062 udpLocalisation accessna-localiselast updated 2018/11/275063 tcpcentrify secure RPCcsrpclast updated 2018/11/275063 udpReservedN/Alast updated 2018/11/275064 tcpChannel Access 1ca-1last updated 2018/11/275064 udpChannel Access 1ca-1last updated 2018/11/275065 tcpChannel Access 2ca-2last updated 2018/11/275065 udpChannel Access 2ca-2last updated 2018/11/275066 tcpSTANAG-5066-SUBNET-INTFstanag-5066last updated 2018/11/275066 udpSTANAG-5066-SUBNET-INTFstanag-5066last updated 2018/11/275067 tcpAuthentx Serviceauthentxlast updated 2018/11/275067 udpAuthentx Serviceauthentxlast updated 2018/11/275068 tcpBitforest Data Servicebitforestsrvlast updated 2018/11/275068 udpReservedN/Alast updated 2018/11/275069 tcpI/Net 2000-NPRi-net-2000-nprlast updated 2018/11/275069 udpI/Net 2000-NPRi-net-2000-nprlast updated 2018/11/275070 tcpVersaTrans Server Agent Servicevtsaslast updated 2018/11/275070 udpVersaTrans Server Agent Servicevtsaslast updated 2018/11/275071 tcpPowerSchoolpowerschoollast updated 2018/11/275071 udpPowerSchoolpowerschoollast updated 2018/11/275072 tcpAnything In Anythingayiyalast updated 2018/11/275072 udpAnything In Anythingayiyalast updated 2018/11/275073 tcpAdvantage Group Port Mgrtag-pmlast updated 2018/11/275073 udpAdvantage Group Port Mgrtag-pmlast updated 2018/11/275074 tcpALES Queryalesquerylast updated 2018/11/275074 udpALES Queryalesquerylast updated 2018/11/275075 tcpExperimental Physics and Industrial Control Systempvaccesslast updated 2018/11/275075 udpReservedN/Alast updated 2018/11/275076-5077 UnassignedN/Alast updated 2018/11/275078 udpPixelPusher pixel datapixelpusherlast updated 2018/11/275078 tcpReservedN/Alast updated 2018/11/275079 tcpReservedN/Alast updated 2018/11/275079 udpCambridge Pixel SPx Reportscp-spxrptslast updated 2018/11/275080 tcpOnScreen Data Collection Serviceonscreenlast updated 2018/11/275080 udpOnScreen Data Collection Serviceonscreenlast updated 2018/11/275081 tcpSDL - Ent Trans Serversdl-etslast updated 2018/11/275081 udpSDL - Ent Trans Serversdl-etslast updated 2018/11/275082 tcpQpur Communication Protocolqcplast updated 2018/11/275082 udpQpur Communication Protocolqcplast updated 2018/11/275083 tcpQpur File Protocolqfplast updated 2018/11/275083 udpQpur File Protocolqfplast updated 2018/11/275084 tcpEPCglobal Low-Level Reader Protocolllrplast updated 2018/11/275084 udpEPCglobal Low-Level Reader Protocolllrplast updated 2018/11/275085 tcpEPCglobal Encrypted LLRPencrypted-llrplast updated 2018/11/275085 udpEPCglobal Encrypted LLRPencrypted-llrplast updated 2018/11/275086 tcpAprigo Collection Serviceaprigo-cslast updated 2018/11/275086 udpReservedN/Alast updated 2018/11/275087 tcpBIOTIC - Binary Internet of Things Interoperable Communicationbioticlast updated 2018/11/275087 udpReservedN/Alast updated 2018/11/275088-5089 UnassignedN/Alast updated 2018/11/275090 sctpCandidate ARcarlast updated 2018/11/275091 sctpContext Transfer Protocolcxtplast updated 2018/11/275092 tcpReservedN/Alast updated 2018/11/275092 udpMagpie Binarymagpielast updated 2018/11/275093 tcpSentinel LMsentinel-lmlast updated 2018/11/275093 udpSentinel LMsentinel-lmlast updated 2018/11/275094 tcpHART-IPhart-iplast updated 2018/11/275094 udpHART-IPhart-iplast updated 2018/11/275095-5098 UnassignedN/Alast updated 2018/11/275099 tcpSentLM Srv2Srvsentlm-srv2srvlast updated 2018/11/275099 udpSentLM Srv2Srvsentlm-srv2srvlast updated 2018/11/275100 tcpSocalia service muxsocalialast updated 2018/11/275100 udpSocalia service muxsocalialast updated 2018/11/275101 tcpTalarian_TCPtalarian-tcplast updated 2018/11/275101 udpTalarian_UDPtalarian-udplast updated 2018/11/275102 tcpOracle OMS non-secureoms-nonsecurelast updated 2018/11/275102 udpOracle OMS non-secureoms-nonsecurelast updated 2018/11/275103 tcpActifio C2Cactifio-c2clast updated 2018/11/275103 udpReservedN/Alast updated 2018/11/275104 tcpReservedN/Alast updated 2018/11/275104 udpTinyMessagetinymessagelast updated 2018/11/275105 tcpReservedN/Alast updated 2018/11/275105 udpHughes Association Protocolhughes-aplast updated 2018/11/275106 tcpActifio UDS Agentactifioudsagentlast updated 2018/11/275106 udpReservedN/Alast updated 2018/11/275107 tcpDisk to Disk replication between Actifio Clustersactifiorepliclast updated 2018/11/275107 udpReservedN/Alast updated 2018/11/275108-5110 UnassignedN/Alast updated 2018/11/275111 tcpTAEP AS servicetaep-as-svclast updated 2018/11/275111 udpTAEP AS servicetaep-as-svclast updated 2018/11/275112 tcpPeerMe Msg Cmd Servicepm-cmdsvrlast updated 2018/11/275112 udpPeerMe Msg Cmd Servicepm-cmdsvrlast updated 2018/11/275113 UnassignedN/Alast updated 2018/11/275114 tcpEnterprise Vault Servicesev-serviceslast updated 2018/11/275114 udpReservedN/Alast updated 2018/11/275115 tcpSymantec Autobuild Serviceautobuildlast updated 2018/11/275115 udpReservedN/Alast updated 2018/11/275116 tcpReservedN/Alast updated 2018/11/275116 udpEPSON Projecter Image Transferemb-proj-cmdlast updated 2018/11/275117 tcpGradeCam Image Processinggradecamlast updated 2018/11/275117 udpReservedN/Alast updated 2018/11/275118-5119 UnassignedN/Alast updated 2018/11/275120 tcpBarracuda Backup Protocolbarracuda-bbslast updated 2018/11/275120 udpBarracuda Backup Protocolbarracuda-bbslast updated 2018/11/275121-5132 UnassignedN/Alast updated 2018/11/275133 tcpPolicy Commandernbt-pclast updated 2018/11/275133 udpPolicy Commandernbt-pclast updated 2018/11/275134 tcpPP ActivationServerppactivationlast updated 2018/11/275134 udpReservedN/Alast updated 2018/11/275135 tcpERP-Scaleerp-scalelast updated 2018/11/275135 udpReservedN/Alast updated 2018/11/275136 tcpReservedN/Alast updated 2018/11/275136 udpMinotaur SAminotaur-salast updated 2018/11/275137 tcpMyCTS server portctsdlast updated 2018/11/275137 udpMyCTS server portctsdlast updated 2018/11/275138-5144 UnassignedN/Alast updated 2018/11/275145 tcpRMONITOR SECURE IANA assigned this well-formed service name as a replacement for "rmonitor_secure".rmonitor-securelast updated 2018/11/275145 tcp (rmonitor_secure)RMONITOR SECURErmonitor_securelast updated 2018/11/275145 udpRMONITOR SECURE IANA assigned this well-formed service name as a replacement for "rmonitor_secure".rmonitor-securelast updated 2018/11/275145 udp (rmonitor_secure)RMONITOR SECURErmonitor_securelast updated 2018/11/275146 tcpSocial Alarm Servicesocial-alarmlast updated 2018/11/275146 udpReservedN/Alast updated 2018/11/275147-5149 UnassignedN/Alast updated 2018/11/275150 tcpAscend Tunnel Management Protocolatmplast updated 2018/11/275150 udpAscend Tunnel Management Protocolatmplast updated 2018/11/275151 tcpESRI SDE Instance IANA assigned this well-formed service name as a replacement for "esri_sde".esri-sdelast updated 2018/11/275151 tcp (esri_sde)ESRI SDE Instanceesri_sdelast updated 2018/11/275151 udpESRI SDE Remote Start IANA assigned this well-formed service name as a replacement for "esri_sde".esri-sdelast updated 2018/11/275151 udp (esri_sde)ESRI SDE Remote Startesri_sdelast updated 2018/11/275152 tcpESRI SDE Instance Discoverysde-discoverylast updated 2018/11/275152 udpESRI SDE Instance Discoverysde-discoverylast updated 2018/11/275153 tcpReservedN/Alast updated 2018/11/275153 udpReservedN/Alast updated 2018/11/275154 tcpBZFlag game serverbzflaglast updated 2018/11/275154 udpBZFlag game serverbzflaglast updated 2018/11/275155 tcpOracle asControl Agentasctrl-agentlast updated 2018/11/275155 udpOracle asControl Agentasctrl-agentlast updated 2018/11/275156 tcpRussian Online Gamerugameonlinelast updated 2018/11/275156 udpReservedN/Alast updated 2018/11/275157 tcpMediat Remote Object Exchangemediatlast updated 2018/11/275157 udpReservedN/Alast updated 2018/11/275158-5160 UnassignedN/Alast updated 2018/11/275161 tcpSNMP over SSH Transport Modelsnmpsshlast updated 2018/11/275161 udpReservedN/Alast updated 2018/11/275162 tcpSNMP Notification over SSH Transport Modelsnmpssh-traplast updated 2018/11/275162 udpReservedN/Alast updated 2018/11/275163 tcpShadow Backupsbackuplast updated 2018/11/275163 udpReservedN/Alast updated 2018/11/275164 tcpVirtual Protocol Adaptervpalast updated 2018/11/275164 udpVirtual Protocol Adapter Discoveryvpa-disclast updated 2018/11/275165 tcpife_1corp IANA assigned this well-formed service name as a replacement for "ife_icorp".ife-icorplast updated 2018/11/275165 tcp (ife_icorp)ife_1corpife_icorplast updated 2018/11/275165 udpife_1corp IANA assigned this well-formed service name as a replacement for "ife_icorp".ife-icorplast updated 2018/11/275165 udp (ife_icorp)ife_1corpife_icorplast updated 2018/11/275166 tcpWinPCS Service Connectionwinpcslast updated 2018/11/275166 udpWinPCS Service Connectionwinpcslast updated 2018/11/275167 tcpSCTE104 Connectionscte104last updated 2018/11/275167 udpSCTE104 Connectionscte104last updated 2018/11/275168 tcpSCTE30 Connectionscte30last updated 2018/11/275168 udpSCTE30 Connectionscte30last updated 2018/11/275169-5171 UnassignedN/Alast updated 2018/11/275172 tcpPC over IP Endpoint Managementpcoip-mgmtlast updated 2018/11/275172 udpReservedN/Alast updated 2018/11/275173-5189 UnassignedN/Alast updated 2018/11/275190 tcpAmerica-Onlineaollast updated 2018/11/275190 udpAmerica-Onlineaollast updated 2018/11/275191 tcpAmericaOnline1aol-1last updated 2018/11/275191 udpAmericaOnline1aol-1last updated 2018/11/275192 tcpAmericaOnline2aol-2last updated 2018/11/275192 udpAmericaOnline2aol-2last updated 2018/11/275193 tcpAmericaOnline3aol-3last updated 2018/11/275193 udpAmericaOnline3aol-3last updated 2018/11/275194 tcpCipherPoint Config Servicecpscommlast updated 2018/11/275194 udpReservedN/Alast updated 2018/11/275195 tcpThe protocol is used by a license server and client programs to control use of program licenses that float to networked machinesampl-liclast updated 2018/11/275195 udpReservedN/Alast updated 2018/11/275196 tcpThe protocol is used by two programs that exchange "table" data used in the AMPL modeling languageampl-tableproxylast updated 2018/11/275196 udpReservedN/Alast updated 2018/11/275197 tcpTunstall Lone worker device interfacetunstall-lwplast updated 2018/11/275197 udpReservedN/Alast updated 2018/11/275198-5199 UnassignedN/Alast updated 2018/11/275200 tcpTARGUS GetDatatargus-getdatalast updated 2018/11/275200 udpTARGUS GetDatatargus-getdatalast updated 2018/11/275201 tcpTARGUS GetData 1targus-getdata1last updated 2018/11/275201 udpTARGUS GetData 1targus-getdata1last updated 2018/11/275202 tcpTARGUS GetData 2targus-getdata2last updated 2018/11/275202 udpTARGUS GetData 2targus-getdata2last updated 2018/11/275203 tcpTARGUS GetData 3targus-getdata3last updated 2018/11/275203 udpTARGUS GetData 3targus-getdata3last updated 2018/11/275204-5208 UnassignedN/Alast updated 2018/11/275209 tcpNomad Device Video Transfernomadlast updated 2018/11/275209 udpReservedN/Alast updated 2018/11/275210-5214 UnassignedN/Alast updated 2018/11/275215 tcpNOTEZA Data Safety Servicenotezalast updated 2018/11/275215 udpReservedN/Alast updated 2018/11/275215 sctpNOTEZA Data Safety Servicenotezalast updated 2018/11/275216-5220 UnassignedN/Alast updated 2018/11/275221 tcp3eTI Extensible Management Protocol for OAMP3exmplast updated 2018/11/275221 udpReservedN/Alast updated 2018/11/275222 tcpXMPP Client Connectionxmpp-clientlast updated 2018/11/275222 udpReservedN/Alast updated 2018/11/275223 tcpHP Virtual Machine Group Managementhpvirtgrplast updated 2018/11/275223 udpHP Virtual Machine Group Managementhpvirtgrplast updated 2018/11/275224 tcpHP Virtual Machine Console Operationshpvirtctrllast updated 2018/11/275224 udpHP Virtual Machine Console Operationshpvirtctrllast updated 2018/11/275225 tcpHP Serverhp-serverlast updated 2018/11/275225 udpHP Serverhp-serverlast updated 2018/11/275226 tcpHP Statushp-statuslast updated 2018/11/275226 udpHP Statushp-statuslast updated 2018/11/275227 tcpHP System Performance Metric Serviceperfdlast updated 2018/11/275227 udpHP System Performance Metric Serviceperfdlast updated 2018/11/275228 tcpHP Virtual Room Servicehpvroomlast updated 2018/11/275228 udpReservedN/Alast updated 2018/11/275229 tcpNetflow/IPFIX/sFlow Collector and Forwarder Managementjaxflowlast updated 2018/11/275229 udpReservedN/Alast updated 2018/11/275230 tcpJaxMP RealFlow application and protocol datajaxflow-datalast updated 2018/11/275230 udpReservedN/Alast updated 2018/11/275231 tcpRemote Control of Scan Software for Cruse Scannerscrusecontrollast updated 2018/11/275231 udpReservedN/Alast updated 2018/11/275232 tcpCruse Scanning System Servicecsedaemonlast updated 2018/11/275232 udpReservedN/Alast updated 2018/11/275233 tcpEtinnae Network File Serviceenfslast updated 2018/11/275233 udpReservedN/Alast updated 2018/11/275234 tcpEEnet communicationseenetlast updated 2018/11/275234 udpEEnet communicationseenetlast updated 2018/11/275235 tcpGalaxy Network Servicegalaxy-networklast updated 2018/11/275235 udpGalaxy Network Servicegalaxy-networklast updated 2018/11/275236 tcppadl2simlast updated 2018/11/275236 udppadl2simlast updated 2018/11/275237 tcpm-net discoverymnet-discoverylast updated 2018/11/275237 udpm-net discoverymnet-discoverylast updated 2018/11/275238-5244 UnassignedN/Alast updated 2018/11/275245 tcpDownTools Control Protocoldowntoolslast updated 2018/11/275245 udpDownTools Discovery Protocoldowntools-disclast updated 2018/11/275246 tcpReservedN/Alast updated 2018/11/275246 udpCAPWAP Control Protocolcapwap-controllast updated 2018/11/275247 tcpReservedN/Alast updated 2018/11/275247 udpCAPWAP Data Protocolcapwap-datalast updated 2018/11/275248 tcpCA Access Control Web Servicecaacwslast updated 2018/11/275248 udpCA Access Control Web Servicecaacwslast updated 2018/11/275249 tcpCA AC Lang Servicecaaclang2last updated 2018/11/275249 udpCA AC Lang Servicecaaclang2last updated 2018/11/275250 tcpsoaGatewaysoagatewaylast updated 2018/11/275250 udpsoaGatewaysoagatewaylast updated 2018/11/275251 tcpCA eTrust VM Servicecaevmslast updated 2018/11/275251 udpCA eTrust VM Servicecaevmslast updated 2018/11/275252 tcpMovaz SSCmovaz-ssclast updated 2018/11/275252 udpMovaz SSCmovaz-ssclast updated 2018/11/275253 tcpKohler Power Device Protocolkpdplast updated 2018/11/275253 udpReservedN/Alast updated 2018/11/275254 tcpLogCabin storage servicelogcabinlast updated 2018/11/275254 udpReservedN/Alast updated 2018/11/275255-5263 UnassignedN/Alast updated 2018/11/275264 tcp3Com Network Jack Port 13com-njack-1last updated 2018/11/275264 udp3Com Network Jack Port 13com-njack-1last updated 2018/11/275265 tcp3Com Network Jack Port 23com-njack-2last updated 2018/11/275265 udp3Com Network Jack Port 23com-njack-2last updated 2018/11/275266-5268 UnassignedN/Alast updated 2018/11/275269 tcpXMPP Server Connectionxmpp-serverlast updated 2018/11/275269 udpReservedN/Alast updated 2018/11/275270 tcpCartographer XMPcartographerxmplast updated 2018/11/275270 udpCartographer XMPcartographerxmplast updated 2018/11/275271 tcpStageSoft CueLink messagingcuelinklast updated 2018/11/275271 udpStageSoft CueLink discoverycuelink-disclast updated 2018/11/275272 tcpPKpklast updated 2018/11/275272 udpPKpklast updated 2018/11/275273-5279 UnassignedN/Alast updated 2018/11/275280 tcpBidirectional-streams Over Synchronous HTTP (BOSH)xmpp-boshlast updated 2018/11/275280 udpReservedN/Alast updated 2018/11/275281 tcpUndo License Managerundo-lmlast updated 2018/11/275281 udpReservedN/Alast updated 2018/11/275282 tcpMarimba Transmitter Porttransmit-portlast updated 2018/11/275282 udpMarimba Transmitter Porttransmit-portlast updated 2018/11/275283-5297 UnassignedN/Alast updated 2018/11/275298 tcpXMPP Link-Local Messagingpresencelast updated 2018/11/275298 udpXMPP Link-Local Messagingpresencelast updated 2018/11/275299 tcpNLG Data Servicenlg-datalast updated 2018/11/275299 udpNLG Data Servicenlg-datalast updated 2018/11/275300 tcpHA cluster heartbeathacl-hblast updated 2018/11/275300 udpHA cluster heartbeathacl-hblast updated 2018/11/275301 tcpHA cluster general serviceshacl-gslast updated 2018/11/275301 udpHA cluster general serviceshacl-gslast updated 2018/11/275302 tcpHA cluster configurationhacl-cfglast updated 2018/11/275302 udpHA cluster configurationhacl-cfglast updated 2018/11/275303 tcpHA cluster probinghacl-probelast updated 2018/11/275303 udpHA cluster probinghacl-probelast updated 2018/11/275304 tcpHA Cluster Commandshacl-locallast updated 2018/11/275304 udpHA Cluster Commandshacl-locallast updated 2018/11/275305 tcpHA Cluster Testhacl-testlast updated 2018/11/275305 udpHA Cluster Testhacl-testlast updated 2018/11/275306 tcpSun MC Groupsun-mc-grplast updated 2018/11/275306 udpSun MC Groupsun-mc-grplast updated 2018/11/275307 tcpSCO AIPsco-aiplast updated 2018/11/275307 udpSCO AIPsco-aiplast updated 2018/11/275308 tcpCFenginecfenginelast updated 2018/11/275308 udpCFenginecfenginelast updated 2018/11/275309 tcpJ Printerjprinterlast updated 2018/11/275309 udpJ Printerjprinterlast updated 2018/11/275310 tcpOutlawsoutlawslast updated 2018/11/275310 udpOutlawsoutlawslast updated 2018/11/275311 UnassignedN/Alast updated 2018/11/275312 tcpPermabit Client-Serverpermabit-cslast updated 2018/11/275312 udpPermabit Client-Serverpermabit-cslast updated 2018/11/275313 tcpReal-time & Reliable Datarrdplast updated 2018/11/275313 udpReal-time & Reliable Datarrdplast updated 2018/11/275314 tcpopalis-rbt-ipcopalis-rbt-ipclast updated 2018/11/275314 udpopalis-rbt-ipcopalis-rbt-ipclast updated 2018/11/275315 tcpHA Cluster UDP Pollinghacl-polllast updated 2018/11/275315 udpHA Cluster UDP Pollinghacl-polllast updated 2018/11/275316 tcpHPBladeSystem Monitor Servicehpblademslast updated 2018/11/275316 udpUnassignedN/Alast updated 2018/11/275317 tcpHP Device Monitor Servicehpdevmslast updated 2018/11/275317 udpReservedN/Alast updated 2018/11/275318 tcpPKIX Certificate Management using CMS (CMC)pkix-cmclast updated 2018/11/275318 udpReservedN/Alast updated 2018/11/275319 UnassignedN/Alast updated 2018/11/275320 tcpWebservices-based Zn interface of BSFbsfserver-znlast updated 2018/11/275320 udpReservedN/Alast updated 2018/11/275321 tcpWebservices-based Zn interface of BSF over SSLbsfsvr-zn-ssllast updated 2018/11/275321 udpReservedN/Alast updated 2018/11/275322-5342 UnassignedN/Alast updated 2018/11/275343 tcpSculptor Database Serverkfserverlast updated 2018/11/275343 udpSculptor Database Serverkfserverlast updated 2018/11/275344 tcpxkoto DRCPxkotodrcplast updated 2018/11/275344 udpxkoto DRCPxkotodrcplast updated 2018/11/275345-5348 UnassignedN/Alast updated 2018/11/275349 tcpSTUN over TLSstunslast updated 2018/11/275349 udpSTUN over DTLSstunslast updated 2018/11/275349 tcp (turns)TURN over TLSturnslast updated 2018/11/275349 udp (turns)TURN over DTLSturnslast updated 2018/11/275349 tcp (stun-behaviors)STUN Behavior Discovery over TLSstun-behaviorslast updated 2018/11/275349 udp (stun-behaviors)Reserved for a future enhancement of STUN-BEHAVIORstun-behaviorslast updated 2018/11/275350 tcpReservedN/Alast updated 2018/11/275350 udpPort Control Protocol Multicastpcp-multicastlast updated 2018/11/275351 tcpReservedN/Alast updated 2018/11/275351 udpPort Control Protocolpcplast updated 2018/11/275352 tcpDNS Long-Lived Queriesdns-llqlast updated 2018/11/275352 udpDNS Long-Lived Queriesdns-llqlast updated 2018/11/275353 tcpMulticast DNSmdnslast updated 2018/11/275353 udpMulticast DNSmdnslast updated 2018/11/275354 tcpMulticast DNS Responder IPCmdnsresponderlast updated 2018/11/275354 udpMulticast DNS Responder IPCmdnsresponderlast updated 2018/11/275355 tcpLLMNRllmnrlast updated 2018/11/275355 udpLLMNRllmnrlast updated 2018/11/275356 tcpMicrosoft Small Businessms-smlbizlast updated 2018/11/275356 udpMicrosoft Small Businessms-smlbizlast updated 2018/11/275357 tcpWeb Services for Deviceswsdapilast updated 2018/11/275357 udpWeb Services for Deviceswsdapilast updated 2018/11/275358 tcpWS for Devices Securedwsdapi-slast updated 2018/11/275358 udpWS for Devices Securedwsdapi-slast updated 2018/11/275359 tcpMicrosoft Alerterms-alerterlast updated 2018/11/275359 udpMicrosoft Alerterms-alerterlast updated 2018/11/275360 tcpProtocol for Windows SideShowms-sideshowlast updated 2018/11/275360 udpProtocol for Windows SideShowms-sideshowlast updated 2018/11/275361 tcpSecure Protocol for Windows SideShowms-s-sideshowlast updated 2018/11/275361 udpSecure Protocol for Windows SideShowms-s-sideshowlast updated 2018/11/275362 tcpMicrosoft Windows Server WSD2 Serviceserverwsd2last updated 2018/11/275362 udpMicrosoft Windows Server WSD2 Serviceserverwsd2last updated 2018/11/275363 tcpWindows Network Projectionnet-projectionlast updated 2018/11/275363 udpWindows Network Projectionnet-projectionlast updated 2018/11/275364 udpMicrosoft Kernel Debuggerkdnetlast updated 2018/11/275364 tcpReservedN/Alast updated 2018/11/275365-5396 UnassignedN/Alast updated 2018/11/275397 tcpStressTester(tm) Injectorstresstesterlast updated 2018/11/275397 udpStressTester(tm) Injectorstresstesterlast updated 2018/11/275398 tcpElektron Administrationelektron-adminlast updated 2018/11/275398 udpElektron Administrationelektron-adminlast updated 2018/11/275399 tcpSecurityChasesecuritychaselast updated 2018/11/275399 udpSecurityChasesecuritychaselast updated 2018/11/275400 tcpExcerpt Searchexcerptlast updated 2018/11/275400 udpExcerpt Searchexcerptlast updated 2018/11/275401 tcpExcerpt Search Secureexcerptslast updated 2018/11/275401 udpExcerpt Search Secureexcerptslast updated 2018/11/275402 tcpOmniCast MFTPmftplast updated 2018/11/275402 udpOmniCast MFTPmftplast updated 2018/11/275403 tcpHPOMS-CI-LSTNhpoms-ci-lstnlast updated 2018/11/275403 udpHPOMS-CI-LSTNhpoms-ci-lstnlast updated 2018/11/275404 tcpHPOMS-DPS-LSTNhpoms-dps-lstnlast updated 2018/11/275404 udpHPOMS-DPS-LSTNhpoms-dps-lstnlast updated 2018/11/275405 tcpNetSupportnetsupportlast updated 2018/11/275405 udpNetSupportnetsupportlast updated 2018/11/275406 tcpSystemics Soxsystemics-soxlast updated 2018/11/275406 udpSystemics Soxsystemics-soxlast updated 2018/11/275407 tcpForesyte-Clearforesyte-clearlast updated 2018/11/275407 udpForesyte-Clearforesyte-clearlast updated 2018/11/275408 tcpForesyte-Secforesyte-seclast updated 2018/11/275408 udpForesyte-Secforesyte-seclast updated 2018/11/275409 tcpSalient Data Serversalient-dtasrvlast updated 2018/11/275409 udpSalient Data Serversalient-dtasrvlast updated 2018/11/275410 tcpSalient User Managersalient-usrmgrlast updated 2018/11/275410 udpSalient User Managersalient-usrmgrlast updated 2018/11/275411 tcpActNetactnetlast updated 2018/11/275411 udpActNetactnetlast updated 2018/11/275412 tcpContinuuscontinuuslast updated 2018/11/275412 udpContinuuscontinuuslast updated 2018/11/275413 tcpWWIOTALKwwiotalklast updated 2018/11/275413 udpWWIOTALKwwiotalklast updated 2018/11/275414 tcpStatusDstatusdlast updated 2018/11/275414 udpStatusDstatusdlast updated 2018/11/275415 tcpNS Serverns-serverlast updated 2018/11/275415 udpNS Serverns-serverlast updated 2018/11/275416 tcpSNS Gatewaysns-gatewaylast updated 2018/11/275416 udpSNS Gatewaysns-gatewaylast updated 2018/11/275417 tcpSNS Agentsns-agentlast updated 2018/11/275417 udpSNS Agentsns-agentlast updated 2018/11/275418 tcpMCNTPmcntplast updated 2018/11/275418 udpMCNTPmcntplast updated 2018/11/275419 tcpDJ-ICEdj-icelast updated 2018/11/275419 udpDJ-ICEdj-icelast updated 2018/11/275420 tcpCylink-Ccylink-clast updated 2018/11/275420 udpCylink-Ccylink-clast updated 2018/11/275421 tcpNet Support 2netsupport2last updated 2018/11/275421 udpNet Support 2netsupport2last updated 2018/11/275422 tcpSalient MUXsalient-muxlast updated 2018/11/275422 udpSalient MUXsalient-muxlast updated 2018/11/275423 tcpVIRTUALUSERvirtualuserlast updated 2018/11/275423 udpVIRTUALUSERvirtualuserlast updated 2018/11/275424 tcpBeyond Remotebeyond-remotelast updated 2018/11/275424 udpBeyond Remotebeyond-remotelast updated 2018/11/275425 tcpBeyond Remote Command Channelbr-channellast updated 2018/11/275425 udpBeyond Remote Command Channelbr-channellast updated 2018/11/275426 tcpDEVBASICdevbasiclast updated 2018/11/275426 udpDEVBASICdevbasiclast updated 2018/11/275427 tcpSCO-PEER-TTAsco-peer-ttalast updated 2018/11/275427 udpSCO-PEER-TTAsco-peer-ttalast updated 2018/11/275428 tcpTELACONSOLEtelaconsolelast updated 2018/11/275428 udpTELACONSOLEtelaconsolelast updated 2018/11/275429 tcpBilling and Accounting System Exchangebaselast updated 2018/11/275429 udpBilling and Accounting System Exchangebaselast updated 2018/11/275430 tcpRADEC CORPradec-corplast updated 2018/11/275430 udpRADEC CORPradec-corplast updated 2018/11/275431 tcpPARK AGENTpark-agentlast updated 2018/11/275431 udpPARK AGENTpark-agentlast updated 2018/11/275432 tcpPostgreSQL Databasepostgresqllast updated 2018/11/275432 udpPostgreSQL Databasepostgresqllast updated 2018/11/275433 tcpPyrrho DBMSpyrrholast updated 2018/11/275433 udpPyrrho DBMSpyrrholast updated 2018/11/275434 tcpSGI Array Services Daemonsgi-arraydlast updated 2018/11/275434 udpSGI Array Services Daemonsgi-arraydlast updated 2018/11/275435 tcpSCEANICS situation and action notificationsceanicslast updated 2018/11/275435 udpSCEANICS situation and action notificationsceanicslast updated 2018/11/275436 tcpReservedN/Alast updated 2018/11/275436 udppmip6-cntlpmip6-cntllast updated 2018/11/275437 tcpReservedN/Alast updated 2018/11/275437 udppmip6-datapmip6-datalast updated 2018/11/275438-5442 UnassignedN/Alast updated 2018/11/275443 tcpPearson HTTPSspsslast updated 2018/11/275443 udpPearson HTTPSspsslast updated 2018/11/275444 UnassignedN/Alast updated 2018/11/275445 tcpServer Message Block over Remote Direct Memory Accesssmbdirectlast updated 2018/11/275445 udpReservedN/Alast updated 2018/11/275445 sctpServer Message Block over Remote Direct Memory Accesssmbdirectlast updated 2018/11/275446-5449 UnassignedN/Alast updated 2018/11/275450 tcpTiePie engineering data acquisitiontiepielast updated 2018/11/275450 udpTiePie engineering data acquisition (discovery)tiepie-disclast updated 2018/11/275451-5452 UnassignedN/Alast updated 2018/11/275453 tcpSureBoxsureboxlast updated 2018/11/275453 udpSureBoxsureboxlast updated 2018/11/275454 tcpAPC 5454apc-5454last updated 2018/11/275454 udpAPC 5454apc-5454last updated 2018/11/275455 tcpAPC 5455apc-5455last updated 2018/11/275455 udpAPC 5455apc-5455last updated 2018/11/275456 tcpAPC 5456apc-5456last updated 2018/11/275456 udpAPC 5456apc-5456last updated 2018/11/275457-5460 UnassignedN/Alast updated 2018/11/275461 tcpSILKMETERsilkmeterlast updated 2018/11/275461 udpSILKMETERsilkmeterlast updated 2018/11/275462 tcpTTL Publisherttl-publisherlast updated 2018/11/275462 udpTTL Publisherttl-publisherlast updated 2018/11/275463 tcpTTL Price Proxyttlpriceproxylast updated 2018/11/275463 udpTTL Price Proxyttlpriceproxylast updated 2018/11/275464 tcpQuail Networks Object Brokerquailnetlast updated 2018/11/275464 udpQuail Networks Object Brokerquailnetlast updated 2018/11/275465 tcpNETOPS-BROKERnetops-brokerlast updated 2018/11/275465 udpNETOPS-BROKERnetops-brokerlast updated 2018/11/275466-5469 UnassignedN/Alast updated 2018/11/275470 tcpThe Apsolab company's data collection protocol (native api)apsolab-collast updated 2018/11/275470 udpReservedN/Alast updated 2018/11/275471 tcpThe Apsolab company's secure data collection protocol (native api)apsolab-colslast updated 2018/11/275471 udpReservedN/Alast updated 2018/11/275472 tcpThe Apsolab company's dynamic tag protocolapsolab-taglast updated 2018/11/275472 udpReservedN/Alast updated 2018/11/275473 tcpThe Apsolab company's secure dynamic tag protocolapsolab-tagslast updated 2018/11/275473 udpReservedN/Alast updated 2018/11/275474 udpThe Apsolab company's status query protocolapsolab-rpclast updated 2018/11/275474 tcpReservedN/Alast updated 2018/11/275475 tcpThe Apsolab company's data retrieval protocolapsolab-datalast updated 2018/11/275475 udpReservedN/Alast updated 2018/11/275476-5499 UnassignedN/Alast updated 2018/11/275500 tcpfcp-addr-srvr1fcp-addr-srvr1last updated 2018/11/275500 udpfcp-addr-srvr1fcp-addr-srvr1last updated 2018/11/275501 tcpfcp-addr-srvr2fcp-addr-srvr2last updated 2018/11/275501 udpfcp-addr-srvr2fcp-addr-srvr2last updated 2018/11/275502 tcpfcp-srvr-inst1fcp-srvr-inst1last updated 2018/11/275502 udpfcp-srvr-inst1fcp-srvr-inst1last updated 2018/11/275503 tcpfcp-srvr-inst2fcp-srvr-inst2last updated 2018/11/275503 udpfcp-srvr-inst2fcp-srvr-inst2last updated 2018/11/275504 tcpfcp-cics-gw1fcp-cics-gw1last updated 2018/11/275504 udpfcp-cics-gw1fcp-cics-gw1last updated 2018/11/275505 tcpCheckout Databasecheckoutdblast updated 2018/11/275505 udpCheckout Databasecheckoutdblast updated 2018/11/275506 tcpAmcom Mobile Connectamclast updated 2018/11/275506 udpAmcom Mobile Connectamclast updated 2018/11/275507 tcpPowerSysLab Electrical Managementpsl-managementlast updated 2018/11/275507 udpReservedN/Alast updated 2018/11/275508-5549 UnassignedN/Alast updated 2018/11/275550 tcpModel Railway control using the CBUS message protocolcbuslast updated 2018/11/275550 udpReservedN/Alast updated 2018/11/275551-5552 UnassignedN/Alast updated 2018/11/275553 tcpSGI Eventmond Portsgi-eventmondlast updated 2018/11/275553 udpSGI Eventmond Portsgi-eventmondlast updated 2018/11/275554 tcpSGI ESP HTTPsgi-esphttplast updated 2018/11/275554 udpSGI ESP HTTPsgi-esphttplast updated 2018/11/275555 tcpPersonal Agentpersonal-agentlast updated 2018/11/275555 udpPersonal Agentpersonal-agentlast updated 2018/11/275556 tcpFreeciv gameplayfreecivlast updated 2018/11/275556 udpFreeciv gameplayfreecivlast updated 2018/11/275557 tcpSandlab FARENETfarenetlast updated 2018/11/275557 udpReservedN/Alast updated 2018/11/275558-5564 UnassignedN/Alast updated 2018/11/275565 tcpHPE Advanced BURAhpe-dp-buralast updated 2018/11/275565 udpReservedN/Alast updated 2018/11/275566 tcpWestec Connectwestec-connectlast updated 2018/11/275566 udpReservedN/Alast updated 2018/11/275567 tcpDOF Protocol Stack Multicast/Secure Transportdof-dps-mc-seclast updated 2018/11/275567 udpDOF Protocol Stack Multicast/Secure Transportdof-dps-mc-seclast updated 2018/11/275568 tcpSession Data Transport Multicastsdtlast updated 2018/11/275568 udpSession Data Transport Multicastsdtlast updated 2018/11/275569 tcpPLASA E1.33, Remote Device Management (RDM) controller status notificationsrdmnet-ctrllast updated 2018/11/275569 udpPLASA E1.33, Remote Device Management (RDM) messagesrdmnet-devicelast updated 2018/11/275570-5572 UnassignedN/Alast updated 2018/11/275573 tcpSAS Domain Management Messaging Protocolsdmmplast updated 2018/11/275573 udpSAS Domain Management Messaging Protocolsdmmplast updated 2018/11/275574 tcpSAS IO Forwardinglsi-bobcatlast updated 2018/11/275574 udpReservedN/Alast updated 2018/11/275575 tcpOracle Access Protocolora-oaplast updated 2018/11/275575 udpReservedN/Alast updated 2018/11/275576-5578 UnassignedN/Alast updated 2018/11/275579 tcpFleetDisplay Tracking Servicefdtrackslast updated 2018/11/275579 udpReservedN/Alast updated 2018/11/275580 tcpT-Mobile SMS Protocol Message 0tmosms0last updated 2018/11/275580 udpT-Mobile SMS Protocol Message 0tmosms0last updated 2018/11/275581 tcpT-Mobile SMS Protocol Message 1tmosms1last updated 2018/11/275581 udpT-Mobile SMS Protocol Message 1tmosms1last updated 2018/11/275582 tcpT-Mobile SMS Protocol Message 3fac-restorelast updated 2018/11/275582 udpT-Mobile SMS Protocol Message 3fac-restorelast updated 2018/11/275583 tcpT-Mobile SMS Protocol Message 2tmo-icon-synclast updated 2018/11/275583 udpT-Mobile SMS Protocol Message 2tmo-icon-synclast updated 2018/11/275584 tcpBeInSync-Webbis-weblast updated 2018/11/275584 udpBeInSync-Webbis-weblast updated 2018/11/275585 tcpBeInSync-syncbis-synclast updated 2018/11/275585 udpBeInSync-syncbis-synclast updated 2018/11/275586 tcpPlanning to send mobile terminated SMS to the specific port so that the SMS is not visible to the clientatt-mt-smslast updated 2018/11/275586 udpReservedN/Alast updated 2018/11/275587-5596 UnassignedN/Alast updated 2018/11/275597 tcpinin secure messagingininmessaginglast updated 2018/11/275597 udpinin secure messagingininmessaginglast updated 2018/11/275598 tcpMCT Market Data Feedmctfeedlast updated 2018/11/275598 udpMCT Market Data Feedmctfeedlast updated 2018/11/275599 tcpEnterprise Security Remote Installesinstalllast updated 2018/11/275599 udpEnterprise Security Remote Installesinstalllast updated 2018/11/275600 tcpEnterprise Security Manageresmmanagerlast updated 2018/11/275600 udpEnterprise Security Manageresmmanagerlast updated 2018/11/275601 tcpEnterprise Security Agentesmagentlast updated 2018/11/275601 udpEnterprise Security Agentesmagentlast updated 2018/11/275602 tcpA1-MSCa1-msclast updated 2018/11/275602 udpA1-MSCa1-msclast updated 2018/11/275603 tcpA1-BSa1-bslast updated 2018/11/275603 udpA1-BSa1-bslast updated 2018/11/275604 tcpA3-SDUNodea3-sdunodelast updated 2018/11/275604 udpA3-SDUNodea3-sdunodelast updated 2018/11/275605 tcpA4-SDUNodea4-sdunodelast updated 2018/11/275605 udpA4-SDUNodea4-sdunodelast updated 2018/11/275606-5617 UnassignedN/Alast updated 2018/11/275618 tcpFiscal Registering Protocolefrlast updated 2018/11/275618 udpReservedN/Alast updated 2018/11/275619-5626 UnassignedN/Alast updated 2018/11/275627 tcpNode Initiated Network Association Formaninaflast updated 2018/11/275627 udpNode Initiated Network Association Formaninaflast updated 2018/11/275628 tcpHTrust APIhtrustlast updated 2018/11/275628 udpHTrust APIhtrustlast updated 2018/11/275629 tcpSymantec Storage Foundation for Databasesymantec-sfdblast updated 2018/11/275629 udpSymantec Storage Foundation for Databasesymantec-sfdblast updated 2018/11/275630 tcpPreciseCommunicationprecise-commlast updated 2018/11/275630 udpPreciseCommunicationprecise-commlast updated 2018/11/275631 tcppcANYWHEREdatapcanywheredatalast updated 2018/11/275631 udppcANYWHEREdatapcanywheredatalast updated 2018/11/275632 tcppcANYWHEREstatpcanywherestatlast updated 2018/11/275632 udppcANYWHEREstatpcanywherestatlast updated 2018/11/275633 tcpBE Operations Request Listenerbeorllast updated 2018/11/275633 udpBE Operations Request Listenerbeorllast updated 2018/11/275634 tcpSF Message Servicexprtldlast updated 2018/11/275634 udpSF Message Servicexprtldlast updated 2018/11/275635 tcpSFM Authentication Subsystemsfmssolast updated 2018/11/275635 udpReservedN/Alast updated 2018/11/275636 tcpSFMdb - SFM DB serversfm-db-serverlast updated 2018/11/275636 udpReservedN/Alast updated 2018/11/275637 tcpSymantec CSSCcssclast updated 2018/11/275637 udpReservedN/Alast updated 2018/11/275638 tcpSymantec Fingerprint Lookup and Container Reference Serviceflcrslast updated 2018/11/275638 udpReservedN/Alast updated 2018/11/275639 tcpSymantec Integrity Checking Serviceicslast updated 2018/11/275639 udpReservedN/Alast updated 2018/11/275640-5645 UnassignedN/Alast updated 2018/11/275646 tcpVentureforth Mobilevfmobilelast updated 2018/11/275646 udpReservedN/Alast updated 2018/11/275647-5665 UnassignedN/Alast updated 2018/11/275666 tcpNagios Remote Plugin Executornrpelast updated 2018/11/275666 udpReservedN/Alast updated 2018/11/275667-5669 UnassignedN/Alast updated 2018/11/275670 tcpZeroMQ file publish-subscribe protocolfilemqlast updated 2018/11/275670 udpLocal area discovery and messaging over ZeroMQzre-disclast updated 2018/11/275671 tcpamqp protocol over TLS/SSLamqpslast updated 2018/11/275671 udpamqp protocol over TLS/SSLamqpslast updated 2018/11/275672 tcpAMQPamqplast updated 2018/11/275672 udpAMQPamqplast updated 2018/11/275672 sctpAMQPamqplast updated 2018/11/275673 tcpJACL Message Serverjmslast updated 2018/11/275673 udpJACL Message Serverjmslast updated 2018/11/275674 tcpHyperSCSI Porthyperscsi-portlast updated 2018/11/275674 udpHyperSCSI Porthyperscsi-portlast updated 2018/11/275675 tcpV5UA application portv5ualast updated 2018/11/275675 udpV5UA application portv5ualast updated 2018/11/275675 sctpV5UA application portv5ualast updated 2018/11/275676 tcpRA Administrationraadminlast updated 2018/11/275676 udpRA Administrationraadminlast updated 2018/11/275677 tcpQuest Central DB2 Launchrquestdb2-lnchrlast updated 2018/11/275677 udpQuest Central DB2 Launchrquestdb2-lnchrlast updated 2018/11/275678 tcpRemote Replication Agent Connectionrraclast updated 2018/11/275678 udpRemote Replication Agent Connectionrraclast updated 2018/11/275679 tcpDirect Cable Connect Managerdccmlast updated 2018/11/275679 udpDirect Cable Connect Managerdccmlast updated 2018/11/275680 tcpAuriga Router Serviceauriga-routerlast updated 2018/11/275680 udpAuriga Router Serviceauriga-routerlast updated 2018/11/275681 tcpNet-coneX Control Protocolncxcplast updated 2018/11/275681 udpNet-coneX Control Protocolncxcplast updated 2018/11/275682 tcpReservedN/Alast updated 2018/11/275682 udpBrightCore control & data transfer exchangebrightcorelast updated 2018/11/275683 tcpConstrained Application Protocol (CoAP)coaplast updated 2018/11/275683 udpConstrained Application Protocolcoaplast updated 2018/11/275684 tcpConstrained Application Protocol (CoAP)coapslast updated 2018/11/275684 udpDTLS-secured CoAPcoapslast updated 2018/11/275685-5686 UnassignedN/Alast updated 2018/11/275687 udpGOG multiplayer game protocolgog-multiplayerlast updated 2018/11/275687 tcpReservedN/Alast updated 2018/11/275688 tcpGGZ Gaming Zoneggzlast updated 2018/11/275688 udpGGZ Gaming Zoneggzlast updated 2018/11/275689 tcpQM video network management protocolqmvideolast updated 2018/11/275689 udpQM video network management protocolqmvideolast updated 2018/11/275690-5692 UnassignedN/Alast updated 2018/11/275693 tcpRobert Bosch Data Transferrbsystemlast updated 2018/11/275693 udpReservedN/Alast updated 2018/11/275694-5695 UnassignedN/Alast updated 2018/11/275696 tcpKey Management Interoperability Protocolkmiplast updated 2018/11/275696 udpReservedN/Alast updated 2018/11/275697-5699 UnassignedN/Alast updated 2018/11/275700 tcpDell SupportAssist data center managementsupportassistlast updated 2018/11/275700 udpReservedN/Alast updated 2018/11/275701-5704 UnassignedN/Alast updated 2018/11/275705 tcpStorageOS REST APIstorageoslast updated 2018/11/275705 udpReservedN/Alast updated 2018/11/275706-5712 UnassignedN/Alast updated 2018/11/275713 tcpproshare conf audioproshareaudiolast updated 2018/11/275713 udpproshare conf audioproshareaudiolast updated 2018/11/275714 tcpproshare conf videoprosharevideolast updated 2018/11/275714 udpproshare conf videoprosharevideolast updated 2018/11/275715 tcpproshare conf dataprosharedatalast updated 2018/11/275715 udpproshare conf dataprosharedatalast updated 2018/11/275716 tcpproshare conf requestprosharerequestlast updated 2018/11/275716 udpproshare conf requestprosharerequestlast updated 2018/11/275717 tcpproshare conf notifyprosharenotifylast updated 2018/11/275717 udpproshare conf notifyprosharenotifylast updated 2018/11/275718 tcpDPM Communication Serverdpmlast updated 2018/11/275718 udpDPM Communication Serverdpmlast updated 2018/11/275719 tcpDPM Agent Coordinatordpm-agentlast updated 2018/11/275719 udpDPM Agent Coordinatordpm-agentlast updated 2018/11/275720 tcpMS-Licensingms-licensinglast updated 2018/11/275720 udpMS-Licensingms-licensinglast updated 2018/11/275721 tcpDesktop Passthru Servicedtptlast updated 2018/11/275721 udpDesktop Passthru Servicedtptlast updated 2018/11/275722 tcpMicrosoft DFS Replication Servicemsdfsrlast updated 2018/11/275722 udpMicrosoft DFS Replication Servicemsdfsrlast updated 2018/11/275723 tcpOperations Manager - Health Serviceomhslast updated 2018/11/275723 udpOperations Manager - Health Serviceomhslast updated 2018/11/275724 tcpOperations Manager - SDK Serviceomsdklast updated 2018/11/275724 udpOperations Manager - SDK Serviceomsdklast updated 2018/11/275725 tcpMicrosoft Identity Lifecycle Managerms-ilmlast updated 2018/11/275725 udpReservedN/Alast updated 2018/11/275726 tcpMicrosoft Lifecycle Manager Secure Token Servicems-ilm-stslast updated 2018/11/275726 udpReservedN/Alast updated 2018/11/275727 tcpASG Event Notification Frameworkasgenflast updated 2018/11/275727 udpReservedN/Alast updated 2018/11/275728 tcpDist. I/O Comm. Service Data and Controlio-dist-datalast updated 2018/11/275728 udpDist. I/O Comm. Service Group Membershipio-dist-grouplast updated 2018/11/275729 tcpOpenmail User Agent Layeropenmaillast updated 2018/11/275729 udpOpenmail User Agent Layeropenmaillast updated 2018/11/275730 tcpSteltor's calendar accessunienglast updated 2018/11/275730 udpSteltor's calendar accessunienglast updated 2018/11/275731-5740 UnassignedN/Alast updated 2018/11/275741 tcpIDA Discover Port 1ida-discover1last updated 2018/11/275741 udpIDA Discover Port 1ida-discover1last updated 2018/11/275742 tcpIDA Discover Port 2ida-discover2last updated 2018/11/275742 udpIDA Discover Port 2ida-discover2last updated 2018/11/275743 tcpWatchdoc NetPOD Protocolwatchdoc-podlast updated 2018/11/275743 udpWatchdoc NetPOD Protocolwatchdoc-podlast updated 2018/11/275744 tcpWatchdoc Serverwatchdoclast updated 2018/11/275744 udpWatchdoc Serverwatchdoclast updated 2018/11/275745 tcpfcopy-serverfcopy-serverlast updated 2018/11/275745 udpfcopy-serverfcopy-serverlast updated 2018/11/275746 tcpfcopys-serverfcopys-serverlast updated 2018/11/275746 udpfcopys-serverfcopys-serverlast updated 2018/11/275747 tcpWildbits Tunatictunaticlast updated 2018/11/275747 udpWildbits Tunatictunaticlast updated 2018/11/275748 tcpWildbits Tunalyzertunalyzerlast updated 2018/11/275748 udpWildbits Tunalyzertunalyzerlast updated 2018/11/275749 UnassignedN/Alast updated 2018/11/275750 tcpBladelogic Agent Servicerscdlast updated 2018/11/275750 udpBladelogic Agent Servicerscdlast updated 2018/11/275751-5754 UnassignedN/Alast updated 2018/11/275755 tcpOpenMail Desk Gateway serveropenmailglast updated 2018/11/275755 udpOpenMail Desk Gateway serveropenmailglast updated 2018/11/275756 UnassignedN/Alast updated 2018/11/275757 tcpOpenMail X.500 Directory Serverx500mslast updated 2018/11/275757 udpOpenMail X.500 Directory Serverx500mslast updated 2018/11/275758-5765 UnassignedN/Alast updated 2018/11/275766 tcpOpenMail NewMail Serveropenmailnslast updated 2018/11/275766 udpOpenMail NewMail Serveropenmailnslast updated 2018/11/275767 tcpOpenMail Suer Agent Layer (Secure)s-openmaillast updated 2018/11/275767 udpOpenMail Suer Agent Layer (Secure)s-openmaillast updated 2018/11/275768 tcpOpenMail CMTS Serveropenmailpxylast updated 2018/11/275768 udpOpenMail CMTS Serveropenmailpxylast updated 2018/11/275769 tcpx509solutions Internal CAspramscalast updated 2018/11/275769 udpx509solutions Internal CAspramscalast updated 2018/11/275770 tcpx509solutions Secure Dataspramsdlast updated 2018/11/275770 udpx509solutions Secure Dataspramsdlast updated 2018/11/275771 tcpNetAgentnetagentlast updated 2018/11/275771 udpNetAgentnetagentlast updated 2018/11/275772-5776 UnassignedN/Alast updated 2018/11/275777 tcpDALI Portdali-portlast updated 2018/11/275777 udpDALI Portdali-portlast updated 2018/11/275778-5779 UnassignedN/Alast updated 2018/11/275780 tcpVisual Tag System RPCvts-rpclast updated 2018/11/275780 udpReservedN/Alast updated 2018/11/275781 tcp3PAR Event Reporting Service3par-evtslast updated 2018/11/275781 udp3PAR Event Reporting Service3par-evtslast updated 2018/11/275782 tcp3PAR Management Service3par-mgmtlast updated 2018/11/275782 udp3PAR Management Service3par-mgmtlast updated 2018/11/275783 tcp3PAR Management Service with SSL3par-mgmt-ssllast updated 2018/11/275783 udp3PAR Management Service with SSL3par-mgmt-ssllast updated 2018/11/275784 tcpReservedN/Alast updated 2018/11/275784 udpCisco Interbox Application Redundancyibarlast updated 2018/11/275785 tcp3PAR Inform Remote Copy3par-rcopylast updated 2018/11/275785 udp3PAR Inform Remote Copy3par-rcopylast updated 2018/11/275786 tcpReservedN/Alast updated 2018/11/275786 udpredundancy notificationcisco-redulast updated 2018/11/275787 tcpReservedN/Alast updated 2018/11/275787 udpCisco WAAS Cluster Protocolwaasclusterlast updated 2018/11/275788-5792 UnassignedN/Alast updated 2018/11/275793 tcpXtreamX Supervised Peer messagextreamxlast updated 2018/11/275793 udpXtreamX Supervised Peer messagextreamxlast updated 2018/11/275794 tcpReservedN/Alast updated 2018/11/275794 udpSimple Peered Discovery Protocolspdplast updated 2018/11/275795-5812 UnassignedN/Alast updated 2018/11/275813 tcpICMPDicmpdlast updated 2018/11/275813 udpICMPDicmpdlast updated 2018/11/275814 tcpSupport Automationspt-automationlast updated 2018/11/275814 udpSupport Automationspt-automationlast updated 2018/11/275815-5840 UnassignedN/Alast updated 2018/11/275841 tcpZ-firm ShipRush interface for web access and bidirectional datashiprush-d-chlast updated 2018/11/275841 udpReservedN/Alast updated 2018/11/275842 tcpReversion Backup/Restorereversionlast updated 2018/11/275842 udpReservedN/Alast updated 2018/11/275843-5858 UnassignedN/Alast updated 2018/11/275859 tcpWHEREHOOwherehoolast updated 2018/11/275859 udpWHEREHOOwherehoolast updated 2018/11/275860-5862 UnassignedN/Alast updated 2018/11/275863 tcpPlanetPress Suite Messengppsuitemsglast updated 2018/11/275863 udpPlanetPress Suite Messengppsuitemsglast updated 2018/11/275864-5867 UnassignedN/Alast updated 2018/11/275868 tcpDiameter over TLS/TCPdiameterslast updated 2018/11/275868 udpReservedN/Alast updated 2018/11/275868 sctpDiameter over DTLS/SCTPdiameterslast updated 2018/11/275869-5882 UnassignedN/Alast updated 2018/11/275883 tcpJavascript Unit Test Environmentjutelast updated 2018/11/275884-5899 UnassignedN/Alast updated 2018/11/275900 tcpRemote Framebufferrfblast updated 2018/11/275900 udpRemote Framebufferrfblast updated 2018/11/275901-5909 UnassignedN/Alast updated 2018/11/275910 tcpContext Managementcmlast updated 2018/11/275910 udpContext Managementcmlast updated 2018/11/275910 sctpContext Managementcmlast updated 2018/11/275911 tcpController Pilot Data Link Communicationcpdlclast updated 2018/11/275911 udpController Pilot Data Link Communicationcpdlclast updated 2018/11/275911 sctpController Pilot Data Link Communicationcpdlclast updated 2018/11/275912 tcpFlight Information Servicesfislast updated 2018/11/275912 udpFlight Information Servicesfislast updated 2018/11/275912 sctpFlight Information Servicesfislast updated 2018/11/275913 tcpAutomatic Dependent Surveillanceads-clast updated 2018/11/275913 udpAutomatic Dependent Surveillanceads-clast updated 2018/11/275913 sctpAutomatic Dependent Surveillanceads-clast updated 2018/11/275914-5962 UnassignedN/Alast updated 2018/11/275963 tcpIndy Application Serverindylast updated 2018/11/275963 udpIndy Application Serverindylast updated 2018/11/275964-5967 UnassignedN/Alast updated 2018/11/275968 tcpmppolicy-v5mppolicy-v5last updated 2018/11/275968 udpmppolicy-v5mppolicy-v5last updated 2018/11/275969 tcpmppolicy-mgrmppolicy-mgrlast updated 2018/11/275969 udpmppolicy-mgrmppolicy-mgrlast updated 2018/11/275970-5983 UnassignedN/Alast updated 2018/11/275984 tcpCouchDBcouchdblast updated 2018/11/275984 udpCouchDBcouchdblast updated 2018/11/275985 tcpWBEM WS-Management HTTPwsmanlast updated 2018/11/275985 udpWBEM WS-Management HTTPwsmanlast updated 2018/11/275986 tcpWBEM WS-Management HTTP over TLS/SSLwsmanslast updated 2018/11/275986 udpWBEM WS-Management HTTP over TLS/SSLwsmanslast updated 2018/11/275987 tcpWBEM RMIwbem-rmilast updated 2018/11/275987 udpWBEM RMIwbem-rmilast updated 2018/11/275988 tcpWBEM CIM-XML (HTTP)wbem-httplast updated 2018/11/275988 udpWBEM CIM-XML (HTTP)wbem-httplast updated 2018/11/275989 tcpWBEM CIM-XML (HTTPS)wbem-httpslast updated 2018/11/275989 udpWBEM CIM-XML (HTTPS)wbem-httpslast updated 2018/11/275990 tcpWBEM Export HTTPSwbem-exp-httpslast updated 2018/11/275990 udpWBEM Export HTTPSwbem-exp-httpslast updated 2018/11/275991 tcpNUXSLnuxsllast updated 2018/11/275991 udpNUXSLnuxsllast updated 2018/11/275992 tcpConsul InSight Securityconsul-insightlast updated 2018/11/275992 udpConsul InSight Securityconsul-insightlast updated 2018/11/275993 tcpDMTF WBEM CIM RESTcim-rslast updated 2018/11/275993 udpReservedN/Alast updated 2018/11/275994-5998 UnassignedN/Alast updated 2018/11/275999 tcpCVSupcvsuplast updated 2018/11/275999 udpCVSupcvsuplast updated 2018/11/276000-6063 tcpX Window Systemx11last updated 2018/11/276000-6063 udpX Window Systemx11last updated 2018/11/276064 tcpNDL-AHP-SVCndl-ahp-svclast updated 2018/11/276064 udpNDL-AHP-SVCndl-ahp-svclast updated 2018/11/276065 tcpWinPharaohwinpharaohlast updated 2018/11/276065 udpWinPharaohwinpharaohlast updated 2018/11/276066 tcpEWCTSPewctsplast updated 2018/11/276066 udpEWCTSPewctsplast updated 2018/11/276067 UnassignedN/Alast updated 2018/11/276068 tcpGSMP/ANCPgsmp-ancplast updated 2018/11/276068 udpReservedN/Alast updated 2018/11/276069 tcpTRIPtriplast updated 2018/11/276069 udpTRIPtriplast updated 2018/11/276070 tcpMessageasapmessageasaplast updated 2018/11/276070 udpMessageasapmessageasaplast updated 2018/11/276071 tcpSSDTPssdtplast updated 2018/11/276071 udpSSDTPssdtplast updated 2018/11/276072 tcpDIAGNOSE-PROCdiagnose-proclast updated 2018/11/276072 udpDIAGNOSE-PROCdiagnose-proclast updated 2018/11/276073 tcpDirectPlay8directplay8last updated 2018/11/276073 udpDirectPlay8directplay8last updated 2018/11/276074 tcpMicrosoft Maxmaxlast updated 2018/11/276074 udpMicrosoft Maxmaxlast updated 2018/11/276075 tcpMicrosoft DPM Access Control Managerdpm-acmlast updated 2018/11/276075 udpReservedN/Alast updated 2018/11/276076 tcpMicrosoft DPM WCF Certificatesmsft-dpm-certlast updated 2018/11/276076 udpReservedN/Alast updated 2018/11/276077 tcpiConstruct Servericonstructsrvlast updated 2018/11/276077 udpReservedN/Alast updated 2018/11/276078-6079 UnassignedN/Alast updated 2018/11/276080 udpGeneric UDP Encapsulationguelast updated 2018/11/276080 tcpReservedN/Alast updated 2018/11/276081 udpGeneric Network Virtualization Encapsulation (Geneve)genevelast updated 2018/11/276081 tcpReservedN/Alast updated 2018/11/276082 tcpReservedN/Alast updated 2018/11/276082 udpAPCO Project 25 Common Air Interface - UDP encapsulationp25cailast updated 2018/11/276083 tcpReservedN/Alast updated 2018/11/276083 udptelecomsoftware miami broadcastmiami-bcastlast updated 2018/11/276084 tcpPeer to Peer Infrastructure Configurationreload-configlast updated 2018/11/276084 udpReservedN/Alast updated 2018/11/276085 tcpkonspire2b p2p networkkonspire2blast updated 2018/11/276085 udpkonspire2b p2p networkkonspire2blast updated 2018/11/276086 tcpPDTP P2Ppdtplast updated 2018/11/276086 udpPDTP P2Ppdtplast updated 2018/11/276087 tcpLocal Download Sharing Serviceldsslast updated 2018/11/276087 udpLocal Download Sharing Serviceldsslast updated 2018/11/276088 tcpSuperDog License Managerdoglmslast updated 2018/11/276088 udpSuperDog License Manager Notifierdoglms-notifylast updated 2018/11/276089-6098 UnassignedN/Alast updated 2018/11/276099 tcpRAXA Managementraxa-mgmtlast updated 2018/11/276099 udpReservedN/Alast updated 2018/11/276100 tcpSynchroNet-dbsynchronet-dblast updated 2018/11/276100 udpSynchroNet-dbsynchronet-dblast updated 2018/11/276101 tcpSynchroNet-rtcsynchronet-rtclast updated 2018/11/276101 udpSynchroNet-rtcsynchronet-rtclast updated 2018/11/276102 tcpSynchroNet-updsynchronet-updlast updated 2018/11/276102 udpSynchroNet-updsynchronet-updlast updated 2018/11/276103 tcpRETSretslast updated 2018/11/276103 udpRETSretslast updated 2018/11/276104 tcpDBDBdbdblast updated 2018/11/276104 udpDBDBdbdblast updated 2018/11/276105 tcpPrima Serverprimaserverlast updated 2018/11/276105 udpPrima Serverprimaserverlast updated 2018/11/276106 tcpMPS Servermpsserverlast updated 2018/11/276106 udpMPS Servermpsserverlast updated 2018/11/276107 tcpETC Controletc-controllast updated 2018/11/276107 udpETC Controletc-controllast updated 2018/11/276108 tcpSercomm-SCAdminsercomm-scadminlast updated 2018/11/276108 udpSercomm-SCAdminsercomm-scadminlast updated 2018/11/276109 tcpGLOBECAST-IDglobecast-idlast updated 2018/11/276109 udpGLOBECAST-IDglobecast-idlast updated 2018/11/276110 tcpHP SoftBench CMsoftcmlast updated 2018/11/276110 udpHP SoftBench CMsoftcmlast updated 2018/11/276111 tcpHP SoftBench Sub-Process Controlspclast updated 2018/11/276111 udpHP SoftBench Sub-Process Controlspclast updated 2018/11/276112 tcpDesk-Top Sub-Process Control Daemondtspcdlast updated 2018/11/276112 udpDesk-Top Sub-Process Control Daemondtspcdlast updated 2018/11/276113 tcpDaylite Serverdayliteserverlast updated 2018/11/276113 udpReservedN/Alast updated 2018/11/276114 tcpWRspice IPC Servicewrspicelast updated 2018/11/276114 udpReservedN/Alast updated 2018/11/276115 tcpXic IPC Servicexiclast updated 2018/11/276115 udpReservedN/Alast updated 2018/11/276116 tcpXicTools License Manager Servicextlservlast updated 2018/11/276116 udpReservedN/Alast updated 2018/11/276117 tcpDaylite Touch Syncdaylitetouchlast updated 2018/11/276117 udpReservedN/Alast updated 2018/11/276118 udpTransparent Inter Process Communicationtipclast updated 2018/11/276118 tcpReservedN/Alast updated 2018/11/276119-6120 UnassignedN/Alast updated 2018/11/276121 tcpSPDY for a faster webspdylast updated 2018/11/276121 udpReservedN/Alast updated 2018/11/276122 tcpBackup Express Web Serverbex-webadminlast updated 2018/11/276122 udpBackup Express Web Serverbex-webadminlast updated 2018/11/276123 tcpBackup Expressbackup-expresslast updated 2018/11/276123 udpBackup Expressbackup-expresslast updated 2018/11/276124 tcpPhlexible Network Backup Servicepnbslast updated 2018/11/276124 udpPhlexible Network Backup Servicepnbslast updated 2018/11/276125-6129 UnassignedN/Alast updated 2018/11/276130 tcpThe DameWare Mobile Gateway Servicedamewaremobgtwylast updated 2018/11/276130 udpReservedN/Alast updated 2018/11/276131-6132 UnassignedN/Alast updated 2018/11/276133 tcpNew Boundary Tech WOLnbt-wollast updated 2018/11/276133 udpNew Boundary Tech WOLnbt-wollast updated 2018/11/276134-6139 UnassignedN/Alast updated 2018/11/276140 tcpPulsonix Network License Servicepulsonixnlslast updated 2018/11/276140 udpPulsonix Network License Servicepulsonixnlslast updated 2018/11/276141 tcpMeta Corporation License Managermeta-corplast updated 2018/11/276141 udpMeta Corporation License Managermeta-corplast updated 2018/11/276142 tcpAspen Technology License Manageraspentec-lmlast updated 2018/11/276142 udpAspen Technology License Manageraspentec-lmlast updated 2018/11/276143 tcpWatershed License Managerwatershed-lmlast updated 2018/11/276143 udpWatershed License Managerwatershed-lmlast updated 2018/11/276144 tcpStatSci License Manager - 1statsci1-lmlast updated 2018/11/276144 udpStatSci License Manager - 1statsci1-lmlast updated 2018/11/276145 tcpStatSci License Manager - 2statsci2-lmlast updated 2018/11/276145 udpStatSci License Manager - 2statsci2-lmlast updated 2018/11/276146 tcpLone Wolf Systems License Managerlonewolf-lmlast updated 2018/11/276146 udpLone Wolf Systems License Managerlonewolf-lmlast updated 2018/11/276147 tcpMontage License Managermontage-lmlast updated 2018/11/276147 udpMontage License Managermontage-lmlast updated 2018/11/276148 tcpRicardo North America License Managerricardo-lmlast updated 2018/11/276148 udpRicardo North America License Managerricardo-lmlast updated 2018/11/276149 tcptal-podtal-podlast updated 2018/11/276149 udptal-podtal-podlast updated 2018/11/276150-6158 UnassignedN/Alast updated 2018/11/276159 tcpEFB Application Control Interfaceefb-acilast updated 2018/11/276159 udpReservedN/Alast updated 2018/11/276160 tcpEmerson Extensible Control and Management Protocolecmplast updated 2018/11/276160 udpEmerson Extensible Control and Management Protocol Dataecmp-datalast updated 2018/11/276161 tcpPATROL Internet Srv Mgrpatrol-ismlast updated 2018/11/276161 udpPATROL Internet Srv Mgrpatrol-ismlast updated 2018/11/276162 tcpPATROL Collectorpatrol-colllast updated 2018/11/276162 udpPATROL Collectorpatrol-colllast updated 2018/11/276163 tcpPrecision Scribe Cnx Portpscribelast updated 2018/11/276163 udpPrecision Scribe Cnx Portpscribelast updated 2018/11/276164-6199 UnassignedN/Alast updated 2018/11/276200 tcpLM-X License Manager by X-Formationlm-xlast updated 2018/11/276200 udpLM-X License Manager by X-Formationlm-xlast updated 2018/11/276201 tcpReservedN/Alast updated 2018/11/276201 udpManagement of service nodes in a processing grid for thermodynamic calculationsthermo-calclast updated 2018/11/276202-6208 UnassignedN/Alast updated 2018/11/276209 tcpQMTP over TLSqmtpslast updated 2018/11/276209 udpQMTP over TLSqmtpslast updated 2018/11/276210-6221 UnassignedN/Alast updated 2018/11/276222 tcpRadmind Access Protocolradmindlast updated 2018/11/276222 udpRadmind Access Protocolradmindlast updated 2018/11/276223-6240 UnassignedN/Alast updated 2018/11/276241 tcpJEOL Network Services Data Transport Protocol 1jeol-nsdtp-1last updated 2018/11/276241 udpJEOL Network Services Dynamic Discovery Protocol 1jeol-nsddp-1last updated 2018/11/276242 tcpJEOL Network Services Data Transport Protocol 2jeol-nsdtp-2last updated 2018/11/276242 udpJEOL Network Services Dynamic Discovery Protocol 2jeol-nsddp-2last updated 2018/11/276243 tcpJEOL Network Services Data Transport Protocol 3jeol-nsdtp-3last updated 2018/11/276243 udpJEOL Network Services Dynamic Discovery Protocol 3jeol-nsddp-3last updated 2018/11/276244 tcpJEOL Network Services Data Transport Protocol 4jeol-nsdtp-4last updated 2018/11/276244 udpJEOL Network Services Dynamic Discovery Protocol 4jeol-nsddp-4last updated 2018/11/276245-6250 UnassignedN/Alast updated 2018/11/276251 tcpTL1 Raw Over SSL/TLStl1-raw-ssllast updated 2018/11/276251 udpTL1 Raw Over SSL/TLStl1-raw-ssllast updated 2018/11/276252 tcpTL1 over SSHtl1-sshlast updated 2018/11/276252 udpTL1 over SSHtl1-sshlast updated 2018/11/276253 tcpCRIPcriplast updated 2018/11/276253 udpCRIPcriplast updated 2018/11/276254-6266 UnassignedN/Alast updated 2018/11/276267 tcpGridLAB-D User Interfacegldlast updated 2018/11/276267 udpReservedN/Alast updated 2018/11/276268 tcpGrid Authenticationgridlast updated 2018/11/276268 udpGrid Authenticationgridlast updated 2018/11/276269 tcpGrid Authentication Altgrid-altlast updated 2018/11/276269 udpGrid Authentication Altgrid-altlast updated 2018/11/276270-6299 UnassignedN/Alast updated 2018/11/276300 tcpBMC GRXbmc-grxlast updated 2018/11/276300 udpBMC GRXbmc-grxlast updated 2018/11/276301 tcpBMC CONTROL-D LDAP SERVER IANA assigned this well-formed service name as a replacement for "bmc_ctd_ldap".bmc-ctd-ldaplast updated 2018/11/276301 tcp (bmc_ctd_ldap)BMC CONTROL-D LDAP SERVERbmc_ctd_ldaplast updated 2018/11/276301 udpBMC CONTROL-D LDAP SERVER IANA assigned this well-formed service name as a replacement for "bmc_ctd_ldap".bmc-ctd-ldaplast updated 2018/11/276301 udp (bmc_ctd_ldap)BMC CONTROL-D LDAP SERVERbmc_ctd_ldaplast updated 2018/11/276302-6305 UnassignedN/Alast updated 2018/11/276306 tcpUnified Fabric Management Protocolufmplast updated 2018/11/276306 udpUnified Fabric Management Protocolufmplast updated 2018/11/276307-6314 UnassignedN/Alast updated 2018/11/276315 tcpSensor Control Unit Protocolscuplast updated 2018/11/276315 udpSensor Control Unit Protocol Discovery Protocolscup-disclast updated 2018/11/276316 tcpEthernet Sensor Communications Protocolabb-escplast updated 2018/11/276316 udpEthernet Sensor Communications Protocolabb-escplast updated 2018/11/276317 tcpNavtech Radar Sensor Data Commandnav-data-cmdlast updated 2018/11/276317 udpNavtech Radar Sensor Datanav-datalast updated 2018/11/276318-6319 UnassignedN/Alast updated 2018/11/276320 tcpDouble-Take Replication Servicerepsvclast updated 2018/11/276320 udpDouble-Take Replication Servicerepsvclast updated 2018/11/276321 tcpEmpress Software Connectivity Server 1emp-server1last updated 2018/11/276321 udpEmpress Software Connectivity Server 1emp-server1last updated 2018/11/276322 tcpEmpress Software Connectivity Server 2emp-server2last updated 2018/11/276322 udpEmpress Software Connectivity Server 2emp-server2last updated 2018/11/276323 UnassignedN/Alast updated 2018/11/276324 tcpHR Device Network Configuration Servicehrd-ncslast updated 2018/11/276324 udpHR Device Network servicehrd-ns-disclast updated 2018/11/276325 tcpDouble-Take Management Servicedt-mgmtsvclast updated 2018/11/276325 udpReservedN/Alast updated 2018/11/276326 tcpDouble-Take Virtual Recovery Assistantdt-vralast updated 2018/11/276326 udpReservedN/Alast updated 2018/11/276327-6342 UnassignedN/Alast updated 2018/11/276343 tcpsFlow traffic monitoringsflowlast updated 2018/11/276343 udpsFlow traffic monitoringsflowlast updated 2018/11/276344 tcpArgus-Spectr security and fire-prevention systems servicestreletzlast updated 2018/11/276344 udpReservedN/Alast updated 2018/11/276345-6345 UnassignedN/Alast updated 2018/11/276346 tcpgnutella-svcgnutella-svclast updated 2018/11/276346 udpgnutella-svcgnutella-svclast updated 2018/11/276347 tcpgnutella-rtrgnutella-rtrlast updated 2018/11/276347 udpgnutella-rtrgnutella-rtrlast updated 2018/11/276348-6349 UnassignedN/Alast updated 2018/11/276350 tcpApp Discovery and Access Protocoladaplast updated 2018/11/276350 udpApp Discovery and Access Protocoladaplast updated 2018/11/276351-6354 UnassignedN/Alast updated 2018/11/276355 tcpPMCS applicationspmcslast updated 2018/11/276355 udpPMCS applicationspmcslast updated 2018/11/276356-6359 UnassignedN/Alast updated 2018/11/276360 tcpMetaEdit+ Multi-Usermetaedit-mulast updated 2018/11/276360 udpMetaEdit+ Multi-Usermetaedit-mulast updated 2018/11/276361-6362 UnassignedN/Alast updated 2018/11/276363 udpNamed Data Networkingndnlast updated 2018/11/276363 tcpReservedN/Alast updated 2018/11/276364-6369 UnassignedN/Alast updated 2018/11/276370 tcpMetaEdit+ Server Administrationmetaedit-selast updated 2018/11/276370 udpMetaEdit+ Server Administrationmetaedit-selast updated 2018/11/276371-6378 UnassignedN/Alast updated 2018/11/276379 tcpAn advanced key-value cache and storeredislast updated 2018/11/276379 udpReservedN/Alast updated 2018/11/276380-6381 UnassignedN/Alast updated 2018/11/276382 tcpMetatude Dialogue Servermetatude-mdslast updated 2018/11/276382 udpMetatude Dialogue Servermetatude-mdslast updated 2018/11/276383-6388 UnassignedN/Alast updated 2018/11/276389 tcpclariion-evr01clariion-evr01last updated 2018/11/276389 udpclariion-evr01clariion-evr01last updated 2018/11/276390 tcpMetaEdit+ WebService APImetaedit-wslast updated 2018/11/276390 udpMetaEdit+ WebService APImetaedit-wslast updated 2018/11/276391-6399 UnassignedN/Alast updated 2018/11/276400 Business Objects CMS contact portboe-cmslast updated 2018/11/276401 boe-wasboe-waslast updated 2018/11/276402 boe-eventsrvboe-eventsrvlast updated 2018/11/276403 boe-cachesvrboe-cachesvrlast updated 2018/11/276404 Business Objects Enterprise internal serverboe-filesvrlast updated 2018/11/276405 Business Objects Enterprise internal serverboe-pagesvrlast updated 2018/11/276406 Business Objects Enterprise internal serverboe-processsvrlast updated 2018/11/276407 Business Objects Enterprise internal serverboe-resssvr1last updated 2018/11/276408 Business Objects Enterprise internal serverboe-resssvr2last updated 2018/11/276409 Business Objects Enterprise internal serverboe-resssvr3last updated 2018/11/276410 Business Objects Enterprise internal serverboe-resssvr4last updated 2018/11/276411-6416 UnassignedN/Alast updated 2018/11/276417 tcpFaxcom Message Servicefaxcomservicelast updated 2018/11/276417 udpFaxcom Message Servicefaxcomservicelast updated 2018/11/276418 tcpSYserver remote commandssyserverremotelast updated 2018/11/276418 udpReservedN/Alast updated 2018/11/276419 tcpSimple VDR Protocolsvdrplast updated 2018/11/276419 udpSimple VDR Protocol Discoverysvdrp-disclast updated 2018/11/276420 tcpNIM_VDRShellnim-vdrshelllast updated 2018/11/276420 udpNIM_VDRShellnim-vdrshelllast updated 2018/11/276421 tcpNIM_WANnim-wanlast updated 2018/11/276421 udpNIM_WANnim-wanlast updated 2018/11/276422-6431 UnassignedN/Alast updated 2018/11/276432 tcpPgBouncerpgbouncerlast updated 2018/11/276432 udpReservedN/Alast updated 2018/11/276433-6441 UnassignedN/Alast updated 2018/11/276442 tcpTransitory Application Request Protocoltarplast updated 2018/11/276442 udpReservedN/Alast updated 2018/11/276443 tcpService Registry Default HTTPS Domainsun-sr-httpslast updated 2018/11/276443 udpService Registry Default HTTPS Domainsun-sr-httpslast updated 2018/11/276444 tcpGrid Engine Qmaster Service IANA assigned this well-formed service name as a replacement for "sge_qmaster".sge-qmasterlast updated 2018/11/276444 tcp (sge_qmaster)Grid Engine Qmaster Servicesge_qmasterlast updated 2018/11/276444 udpGrid Engine Qmaster Service IANA assigned this well-formed service name as a replacement for "sge_qmaster".sge-qmasterlast updated 2018/11/276444 udp (sge_qmaster)Grid Engine Qmaster Servicesge_qmasterlast updated 2018/11/276445 tcpGrid Engine Execution Service IANA assigned this well-formed service name as a replacement for "sge_execd".sge-execdlast updated 2018/11/276445 tcp (sge_execd)Grid Engine Execution Servicesge_execdlast updated 2018/11/276445 udpGrid Engine Execution Service IANA assigned this well-formed service name as a replacement for "sge_execd".sge-execdlast updated 2018/11/276445 udp (sge_execd)Grid Engine Execution Servicesge_execdlast updated 2018/11/276446 tcpMySQL Proxymysql-proxylast updated 2018/11/276446 udpMySQL Proxymysql-proxylast updated 2018/11/276447-6454 UnassignedN/Alast updated 2018/11/276455 tcpSKIP Certificate Receiveskip-cert-recvlast updated 2018/11/276455 udpSKIP Certificate Receiveskip-cert-recvlast updated 2018/11/276456 tcpSKIP Certificate Sendskip-cert-sendlast updated 2018/11/276456 udpSKIP Certificate Sendskip-cert-sendlast updated 2018/11/276457-6463 UnassignedN/Alast updated 2018/11/276464 tcpPort assignment for medical device communication in accordance to IEEE 11073-20701ieee11073-20701last updated 2018/11/276464 udpPort assignment for medical device communication in accordance to IEEE 11073-20701ieee11073-20701last updated 2018/11/276465-6470 UnassignedN/Alast updated 2018/11/276471 tcpLVision License Managerlvision-lmlast updated 2018/11/276471 udpLVision License Managerlvision-lmlast updated 2018/11/276472-6479 UnassignedN/Alast updated 2018/11/276480 tcpService Registry Default HTTP Domainsun-sr-httplast updated 2018/11/276480 udpService Registry Default HTTP Domainsun-sr-httplast updated 2018/11/276481 tcpService Tagsservicetagslast updated 2018/11/276481 udpService Tagsservicetagslast updated 2018/11/276482 tcpLogical Domains Management Interfaceldoms-mgmtlast updated 2018/11/276482 udpLogical Domains Management Interfaceldoms-mgmtlast updated 2018/11/276483 tcpSunVTS RMISunVTS-RMIlast updated 2018/11/276483 udpSunVTS RMISunVTS-RMIlast updated 2018/11/276484 tcpService Registry Default JMS Domainsun-sr-jmslast updated 2018/11/276484 udpService Registry Default JMS Domainsun-sr-jmslast updated 2018/11/276485 tcpService Registry Default IIOP Domainsun-sr-iioplast updated 2018/11/276485 udpService Registry Default IIOP Domainsun-sr-iioplast updated 2018/11/276486 tcpService Registry Default IIOPS Domainsun-sr-iiopslast updated 2018/11/276486 udpService Registry Default IIOPS Domainsun-sr-iiopslast updated 2018/11/276487 tcpService Registry Default IIOPAuth Domainsun-sr-iiop-autlast updated 2018/11/276487 udpService Registry Default IIOPAuth Domainsun-sr-iiop-autlast updated 2018/11/276488 tcpService Registry Default JMX Domainsun-sr-jmxlast updated 2018/11/276488 udpService Registry Default JMX Domainsun-sr-jmxlast updated 2018/11/276489 tcpService Registry Default Admin Domainsun-sr-adminlast updated 2018/11/276489 udpService Registry Default Admin Domainsun-sr-adminlast updated 2018/11/276490-6499 UnassignedN/Alast updated 2018/11/276500 tcpBoKS Masterbokslast updated 2018/11/276500 udpBoKS Masterbokslast updated 2018/11/276501 tcpBoKS Servc IANA assigned this well-formed service name as a replacement for "boks_servc".boks-servclast updated 2018/11/276501 tcp (boks_servc)BoKS Servcboks_servclast updated 2018/11/276501 udpBoKS Servc IANA assigned this well-formed service name as a replacement for "boks_servc".boks-servclast updated 2018/11/276501 udp (boks_servc)BoKS Servcboks_servclast updated 2018/11/276502 tcpBoKS Servm IANA assigned this well-formed service name as a replacement for "boks_servm".boks-servmlast updated 2018/11/276502 tcp (boks_servm)BoKS Servmboks_servmlast updated 2018/11/276502 udpBoKS Servm IANA assigned this well-formed service name as a replacement for "boks_servm".boks-servmlast updated 2018/11/276502 udp (boks_servm)BoKS Servmboks_servmlast updated 2018/11/276503 tcpBoKS Clntd IANA assigned this well-formed service name as a replacement for "boks_clntd".boks-clntdlast updated 2018/11/276503 tcp (boks_clntd)BoKS Clntdboks_clntdlast updated 2018/11/276503 udpBoKS Clntd IANA assigned this well-formed service name as a replacement for "boks_clntd".boks-clntdlast updated 2018/11/276503 udp (boks_clntd)BoKS Clntdboks_clntdlast updated 2018/11/276504 UnassignedN/Alast updated 2018/11/276505 tcpBoKS Admin Private Port IANA assigned this well-formed service name as a replacement for "badm_priv".badm-privlast updated 2018/11/276505 tcp (badm_priv)BoKS Admin Private Portbadm_privlast updated 2018/11/276505 udpBoKS Admin Private Port IANA assigned this well-formed service name as a replacement for "badm_priv".badm-privlast updated 2018/11/276505 udp (badm_priv)BoKS Admin Private Portbadm_privlast updated 2018/11/276506 tcpBoKS Admin Public Port IANA assigned this well-formed service name as a replacement for "badm_pub".badm-publast updated 2018/11/276506 tcp (badm_pub)BoKS Admin Public Portbadm_publast updated 2018/11/276506 udpBoKS Admin Public Port IANA assigned this well-formed service name as a replacement for "badm_pub".badm-publast updated 2018/11/276506 udp (badm_pub)BoKS Admin Public Portbadm_publast updated 2018/11/276507 tcpBoKS Dir Server, Private Port IANA assigned this well-formed service name as a replacement for "bdir_priv".bdir-privlast updated 2018/11/276507 tcp (bdir_priv)BoKS Dir Server, Private Portbdir_privlast updated 2018/11/276507 udpBoKS Dir Server, Private Port IANA assigned this well-formed service name as a replacement for "bdir_priv".bdir-privlast updated 2018/11/276507 udp (bdir_priv)BoKS Dir Server, Private Portbdir_privlast updated 2018/11/276508 tcpBoKS Dir Server, Public Port IANA assigned this well-formed service name as a replacement for "bdir_pub".bdir-publast updated 2018/11/276508 tcp (bdir_pub)BoKS Dir Server, Public Portbdir_publast updated 2018/11/276508 udpBoKS Dir Server, Public Port IANA assigned this well-formed service name as a replacement for "bdir_pub".bdir-publast updated 2018/11/276508 udp (bdir_pub)BoKS Dir Server, Public Portbdir_publast updated 2018/11/276509 tcpMGCS-MFP Portmgcs-mfp-portlast updated 2018/11/276509 udpMGCS-MFP Portmgcs-mfp-portlast updated 2018/11/276510 tcpMCER Portmcer-portlast updated 2018/11/276510 udpMCER Portmcer-portlast updated 2018/11/276511 tcpReservedN/Alast updated 2018/11/276511 udpDatagram Congestion Control Protocol Encapsulation for NAT Traversaldccp-udplast updated 2018/11/276512-6512 UnassignedN/Alast updated 2018/11/276513 tcpNETCONF over TLSnetconf-tlslast updated 2018/11/276513 udpReservedN/Alast updated 2018/11/276514 tcpSyslog over TLSsyslog-tlslast updated 2018/11/276514 udpsyslog over DTLSsyslog-tlslast updated 2018/11/276514 dccpsyslog over DTLSsyslog-tlslast updated 2018/11/276515 tcpElipse RPC Protocolelipse-reclast updated 2018/11/276515 udpElipse RPC Protocolelipse-reclast updated 2018/11/276516-6542 UnassignedN/Alast updated 2018/11/276543 tcplds_distriblds-distriblast updated 2018/11/276543 udplds_distriblds-distriblast updated 2018/11/276544 tcpLDS Dump Servicelds-dumplast updated 2018/11/276544 udpLDS Dump Servicelds-dumplast updated 2018/11/276545-6546 UnassignedN/Alast updated 2018/11/276547 tcpAPC 6547apc-6547last updated 2018/11/276547 udpAPC 6547apc-6547last updated 2018/11/276548 tcpAPC 6548apc-6548last updated 2018/11/276548 udpAPC 6548apc-6548last updated 2018/11/276549 tcpAPC 6549apc-6549last updated 2018/11/276549 udpAPC 6549apc-6549last updated 2018/11/276550 tcpfg-sysupdatefg-sysupdatelast updated 2018/11/276550 udpfg-sysupdatefg-sysupdatelast updated 2018/11/276551 tcpSoftware Update Managersumlast updated 2018/11/276551 udpSoftware Update Managersumlast updated 2018/11/276552-6557 UnassignedN/Alast updated 2018/11/276558 tcpxdsxdmlast updated 2018/11/276558 udpxdsxdmlast updated 2018/11/276559-6565 UnassignedN/Alast updated 2018/11/276566 tcpSANE Control Portsane-portlast updated 2018/11/276566 udpSANE Control Portsane-portlast updated 2018/11/276567 ReservedN/Alast updated 2018/11/276568 tcpCanIt Storage Manager IANA assigned this well-formed service name as a replacement for "canit_store".canit-storelast updated 2018/11/276568 tcp (canit_store)CanIt Storage Managercanit_storelast updated 2018/11/276568 udpRoaring Penguin IP Address Reputation Collectionrp-reputationlast updated 2018/11/276569-6578 UnassignedN/Alast updated 2018/11/276579 tcpAffiliateaffiliatelast updated 2018/11/276579 udpAffiliateaffiliatelast updated 2018/11/276580 tcpParsec Masterserverparsec-masterlast updated 2018/11/276580 udpParsec Masterserverparsec-masterlast updated 2018/11/276581 tcpParsec Peer-to-Peerparsec-peerlast updated 2018/11/276581 udpParsec Peer-to-Peerparsec-peerlast updated 2018/11/276582 tcpParsec Gameserverparsec-gamelast updated 2018/11/276582 udpParsec Gameserverparsec-gamelast updated 2018/11/276583 tcpJOA Jewel SuitejoaJewelSuitelast updated 2018/11/276583 udpJOA Jewel SuitejoaJewelSuitelast updated 2018/11/276584-6587 UnassignedN/Alast updated 2018/11/276588 UnassignedN/Alast updated 2018/11/276589-6599 UnassignedN/Alast updated 2018/11/276600 tcpMicrosoft Hyper-V Live Migrationmshvlmlast updated 2018/11/276600 udpReservedN/Alast updated 2018/11/276601 tcpMicrosoft Threat Management Gateway SSTPmstmg-sstplast updated 2018/11/276601 udpReservedN/Alast updated 2018/11/276602 tcpWindows WSS Communication Frameworkwsscomfrmwklast updated 2018/11/276602 udpReservedN/Alast updated 2018/11/276603-6618 UnassignedN/Alast updated 2018/11/276619 tcpODETTE-FTP over TLS/SSLodette-ftpslast updated 2018/11/276619 udpODETTE-FTP over TLS/SSLodette-ftpslast updated 2018/11/276620 tcpKerberos V5 FTP Datakftp-datalast updated 2018/11/276620 udpKerberos V5 FTP Datakftp-datalast updated 2018/11/276621 tcpKerberos V5 FTP Controlkftplast updated 2018/11/276621 udpKerberos V5 FTP Controlkftplast updated 2018/11/276622 tcpMulticast FTPmcftplast updated 2018/11/276622 udpMulticast FTPmcftplast updated 2018/11/276623 tcpKerberos V5 Telnetktelnetlast updated 2018/11/276623 udpKerberos V5 Telnetktelnetlast updated 2018/11/276624 tcpDataScaler databasedatascaler-dblast updated 2018/11/276624 udpReservedN/Alast updated 2018/11/276625 tcpDataScaler controldatascaler-ctllast updated 2018/11/276625 udpReservedN/Alast updated 2018/11/276626 tcpWAGO Service and Updatewago-servicelast updated 2018/11/276626 udpWAGO Service and Updatewago-servicelast updated 2018/11/276627 tcpAllied Electronics NeXGennexgenlast updated 2018/11/276627 udpAllied Electronics NeXGennexgenlast updated 2018/11/276628 tcpAFE Stock Channel M/Cafesc-mclast updated 2018/11/276628 udpAFE Stock Channel M/Cafesc-mclast updated 2018/11/276629 tcpSecondary, (non ANDI) multi-protocol multi-function interface to the Allied ANDI-based family of forecourt controllersnexgen-auxlast updated 2018/11/276629 udpSecondary, (non ANDI) multi-protocol multi-function interface to the Allied ANDI-based family of forecourt controllersnexgen-auxlast updated 2018/11/276630 UnassignedN/Alast updated 2018/11/276631 UnassignedN/Alast updated 2018/11/276632 tcpeGenix mxODBC Connectmxodbc-connectlast updated 2018/11/276632 udpReservedN/Alast updated 2018/11/276633 tcpReservedN/Alast updated 2018/11/276633 udpCisco vPath Services Overlaycisco-vpath-tunlast updated 2018/11/276634 udpMPLS Performance Measurement out-of-band responsempls-pmlast updated 2018/11/276634 tcpReservedN/Alast updated 2018/11/276635 tcpReservedN/Alast updated 2018/11/276635 udpEncapsulate MPLS packets in UDP tunnels.mpls-udplast updated 2018/11/276636 tcpReservedN/Alast updated 2018/11/276636 udpEncapsulate MPLS packets in UDP tunnels with DTLS.mpls-udp-dtlslast updated 2018/11/276637-6639 UnassignedN/Alast updated 2018/11/276640 tcpOpen vSwitch Database protocolovsdblast updated 2018/11/276640 udpReservedN/Alast updated 2018/11/276641-6652 UnassignedN/Alast updated 2018/11/276653 tcpOpenFlowopenflowlast updated 2018/11/276653 udpOpenFlowopenflowlast updated 2018/11/276654 UnassignedN/Alast updated 2018/11/276655 tcpPC SOFT - Software factory UI/managerpcs-sf-ui-manlast updated 2018/11/276655 udpReservedN/Alast updated 2018/11/276656 tcpEmergency Message Control Serviceemgmsglast updated 2018/11/276656 udpReservedN/Alast updated 2018/11/276657 tcpReservedN/Alast updated 2018/11/276657 udpPalCom Discoverypalcom-disclast updated 2018/11/276658-6664 UnassignedN/Alast updated 2018/11/276665-6669 tcpIRCUirculast updated 2018/11/276665-6669 udpReservedN/Alast updated 2018/11/276670 tcpVocaltec Global Online Directoryvocaltec-goldlast updated 2018/11/276670 udpVocaltec Global Online Directoryvocaltec-goldlast updated 2018/11/276671 tcpP4P Portal Servicep4p-portallast updated 2018/11/276671 udpP4P Portal Servicep4p-portallast updated 2018/11/276672 tcpvision_server IANA assigned this well-formed service name as a replacement for "vision_server".vision-serverlast updated 2018/11/276672 tcp (vision_server)vision_servervision_serverlast updated 2018/11/276672 udpvision_server IANA assigned this well-formed service name as a replacement for "vision_server".vision-serverlast updated 2018/11/276672 udp (vision_server)vision_servervision_serverlast updated 2018/11/276673 tcpvision_elmd IANA assigned this well-formed service name as a replacement for "vision_elmd".vision-elmdlast updated 2018/11/276673 tcp (vision_elmd)vision_elmdvision_elmdlast updated 2018/11/276673 udpvision_elmd IANA assigned this well-formed service name as a replacement for "vision_elmd".vision-elmdlast updated 2018/11/276673 udp (vision_elmd)vision_elmdvision_elmdlast updated 2018/11/276674-6677 UnassignedN/Alast updated 2018/11/276678 tcpViscount Freedom Bridge Protocolvfbplast updated 2018/11/276678 udpViscount Freedom Bridge Discoveryvfbp-disclast updated 2018/11/276679 tcpOsorno Automationosautlast updated 2018/11/276679 udpOsorno Automationosautlast updated 2018/11/276680-6686 UnassignedN/Alast updated 2018/11/276687 tcpCleverView for cTrace Message Serviceclever-ctracelast updated 2018/11/276687 udpReservedN/Alast updated 2018/11/276688 tcpCleverView for TCP/IP Message Serviceclever-tcpiplast updated 2018/11/276688