Sideway
output.to from Sideway
Draft for Information Only

Content

Service Name and Transport Protocol Port Number Registry
‚ÄÉTable of Service Name and Transport Protocol Port Number Registry

Service Name and Transport Protocol Port Number Registry

Last updated: 22 Nov 2018

Source:
https://www.iana.org/assignments/service-names-port-numbers/service-names-port-numbers.xhtml?&page=142
https://en.wikipedia.org/wiki/List_of_TCP_and_UDP_port_numbers

Table of Service Name and Transport Protocol Port Number Registry

Port
Transport Protocol
DescriptionService NameLast Update
0 tcpReservedN/Alast updated 27 Nov 20180 udpReservedN/Alast updated 27 Nov 20181 tcpTCP Port Service Multiplexertcpmuxlast updated 27 Nov 20181 udpTCP Port Service Multiplexertcpmuxlast updated 27 Nov 20182 tcpManagement Utilitycompressnetlast updated 27 Nov 20182 udpManagement Utilitycompressnetlast updated 27 Nov 20183 tcpCompression Processcompressnetlast updated 27 Nov 20183 udpCompression Processcompressnetlast updated 27 Nov 20184 tcpUnassignedN/Alast updated 27 Nov 20184 udpUnassignedN/Alast updated 27 Nov 20185 tcpRemote Job Entryrjelast updated 27 Nov 20185 udpRemote Job Entryrjelast updated 27 Nov 20186 tcpUnassignedN/Alast updated 27 Nov 20186 udpUnassignedN/Alast updated 27 Nov 20187 tcpEchoecholast updated 27 Nov 20187 udpEchoecholast updated 27 Nov 20188 tcpUnassignedN/Alast updated 27 Nov 20188 udpUnassignedN/Alast updated 27 Nov 20189 tcpDiscarddiscardlast updated 27 Nov 20189 udpDiscarddiscardlast updated 27 Nov 20189 sctpDiscarddiscardlast updated 27 Nov 20189 dccpDiscarddiscardlast updated 27 Nov 201810 tcpUnassignedN/Alast updated 27 Nov 201810 udpUnassignedN/Alast updated 27 Nov 201811 tcpActive Userssystatlast updated 27 Nov 201811 udpActive Userssystatlast updated 27 Nov 201812 tcpUnassignedN/Alast updated 27 Nov 201812 udpUnassignedN/Alast updated 27 Nov 201813 tcpDaytimedaytimelast updated 27 Nov 201813 udpDaytimedaytimelast updated 27 Nov 201814 tcpUnassignedN/Alast updated 27 Nov 201814 udpUnassignedN/Alast updated 27 Nov 201815 tcpUnassigned [was netstat]N/Alast updated 27 Nov 201815 udpUnassignedN/Alast updated 27 Nov 201816 tcpUnassignedN/Alast updated 27 Nov 201816 udpUnassignedN/Alast updated 27 Nov 201817 tcpQuote of the Dayqotdlast updated 27 Nov 201817 udpQuote of the Dayqotdlast updated 27 Nov 201818 tcpMessage Send Protocol (historic)msplast updated 27 Nov 201818 udpMessage Send Protocol (historic)msplast updated 27 Nov 201819 tcpCharacter Generatorchargenlast updated 27 Nov 201819 udpCharacter Generatorchargenlast updated 27 Nov 201820 tcpFile Transfer [Default Data]ftp-datalast updated 27 Nov 201820 udpFile Transfer [Default Data]ftp-datalast updated 27 Nov 201820 sctpFTPftp-datalast updated 27 Nov 201821 tcpFile Transfer Protocol [Control]ftplast updated 27 Nov 201821 udpFile Transfer Protocol [Control]ftplast updated 27 Nov 201821 sctpFTPftplast updated 27 Nov 201822 tcpThe Secure Shell (SSH) Protocolsshlast updated 27 Nov 201822 udpThe Secure Shell (SSH) Protocolsshlast updated 27 Nov 201822 sctpSSHsshlast updated 27 Nov 201823 tcpTelnettelnetlast updated 27 Nov 201823 udpTelnettelnetlast updated 27 Nov 201824 tcpany private mail systemN/Alast updated 27 Nov 201824 udpany private mail systemN/Alast updated 27 Nov 201825 tcpSimple Mail Transfersmtplast updated 27 Nov 201825 udpSimple Mail Transfersmtplast updated 27 Nov 201826 tcpUnassignedN/Alast updated 27 Nov 201826 udpUnassignedN/Alast updated 27 Nov 201827 tcpNSW User System FEnsw-felast updated 27 Nov 201827 udpNSW User System FEnsw-felast updated 27 Nov 201828 tcpUnassignedN/Alast updated 27 Nov 201828 udpUnassignedN/Alast updated 27 Nov 201829 tcpMSG ICPmsg-icplast updated 27 Nov 201829 udpMSG ICPmsg-icplast updated 27 Nov 201830 tcpUnassignedN/Alast updated 27 Nov 201830 udpUnassignedN/Alast updated 27 Nov 201831 tcpMSG Authenticationmsg-authlast updated 27 Nov 201831 udpMSG Authenticationmsg-authlast updated 27 Nov 201832 tcpUnassignedN/Alast updated 27 Nov 201832 udpUnassignedN/Alast updated 27 Nov 201833 tcpDisplay Support Protocoldsplast updated 27 Nov 201833 udpDisplay Support Protocoldsplast updated 27 Nov 201834 tcpUnassignedN/Alast updated 27 Nov 201834 udpUnassignedN/Alast updated 27 Nov 201835 tcpany private printer serverN/Alast updated 27 Nov 201835 udpany private printer serverN/Alast updated 27 Nov 201836 tcpUnassignedN/Alast updated 27 Nov 201836 udpUnassignedN/Alast updated 27 Nov 201837 tcpTimetimelast updated 27 Nov 201837 udpTimetimelast updated 27 Nov 201838 tcpRoute Access Protocolraplast updated 27 Nov 201838 udpRoute Access Protocolraplast updated 27 Nov 201839 tcpResource Location Protocolrlplast updated 27 Nov 201839 udpResource Location Protocolrlplast updated 27 Nov 201840 tcpUnassignedN/Alast updated 27 Nov 201840 udpUnassignedN/Alast updated 27 Nov 201841 tcpGraphicsgraphicslast updated 27 Nov 201841 udpGraphicsgraphicslast updated 27 Nov 201842 tcp (name)Host Name Servernamelast updated 27 Nov 201842 udp (name)Host Name Servernamelast updated 27 Nov 201842 tcpHost Name Servernameserverlast updated 27 Nov 201842 udpHost Name Servernameserverlast updated 27 Nov 201843 tcpWho Isnicnamelast updated 27 Nov 201843 udpWho Isnicnamelast updated 27 Nov 201844 tcpMPM FLAGS Protocolmpm-flagslast updated 27 Nov 201844 udpMPM FLAGS Protocolmpm-flagslast updated 27 Nov 201845 tcpMessage Processing Module [recv]mpmlast updated 27 Nov 201845 udpMessage Processing Module [recv]mpmlast updated 27 Nov 201846 tcpMPM [default send]mpm-sndlast updated 27 Nov 201846 udpMPM [default send]mpm-sndlast updated 27 Nov 201847 tcpReservedN/Alast updated 27 Nov 201847 udpReservedN/Alast updated 27 Nov 201848 tcpDigital Audit Daemonauditdlast updated 27 Nov 201848 udpDigital Audit Daemonauditdlast updated 27 Nov 201849 tcpLogin Host Protocol (TACACS)tacacslast updated 27 Nov 201849 udpLogin Host Protocol (TACACS)tacacslast updated 27 Nov 201850 tcpRemote Mail Checking Protocolre-mail-cklast updated 27 Nov 201850 udpRemote Mail Checking Protocolre-mail-cklast updated 27 Nov 201851 ReservedN/Alast updated 27 Nov 201852 tcpXNS Time Protocolxns-timelast updated 27 Nov 201852 udpXNS Time Protocolxns-timelast updated 27 Nov 201853 tcpDomain Name Serverdomainlast updated 27 Nov 201853 udpDomain Name Serverdomainlast updated 27 Nov 201854 tcpXNS Clearinghousexns-chlast updated 27 Nov 201854 udpXNS Clearinghousexns-chlast updated 27 Nov 201855 tcpISI Graphics Languageisi-gllast updated 27 Nov 201855 udpISI Graphics Languageisi-gllast updated 27 Nov 201856 tcpXNS Authenticationxns-authlast updated 27 Nov 201856 udpXNS Authenticationxns-authlast updated 27 Nov 201857 tcpany private terminal accessN/Alast updated 27 Nov 201857 udpany private terminal accessN/Alast updated 27 Nov 201858 tcpXNS Mailxns-maillast updated 27 Nov 201858 udpXNS Mailxns-maillast updated 27 Nov 201859 tcpany private file serviceN/Alast updated 27 Nov 201859 udpany private file serviceN/Alast updated 27 Nov 201860 tcpUnassignedN/Alast updated 27 Nov 201860 udpUnassignedN/Alast updated 27 Nov 201861 tcpReservedN/Alast updated 27 Nov 201861 udpReservedN/Alast updated 27 Nov 201862 tcpACA Servicesacaslast updated 27 Nov 201862 udpACA Servicesacaslast updated 27 Nov 201863 tcpwhois++ IANA assigned this well-formed service name as a replacement for "whois++".whoispplast updated 27 Nov 201863 tcp (whois++)whois++whois++last updated 27 Nov 201863 udpwhois++ IANA assigned this well-formed service name as a replacement for "whois++".whoispplast updated 27 Nov 201863 udp (whois++)whois++whois++last updated 27 Nov 201864 tcpCommunications Integrator (CI)covialast updated 27 Nov 201864 udpCommunications Integrator (CI)covialast updated 27 Nov 201865 tcpTACACS-Database Servicetacacs-dslast updated 27 Nov 201865 udpTACACS-Database Servicetacacs-dslast updated 27 Nov 201866 tcpOracle SQL*NET IANA assigned this well-formed service name as a replacement for "sql*net".sql-netlast updated 27 Nov 201866 tcp (sql*net)Oracle SQL*NETsql*netlast updated 27 Nov 201866 udpOracle SQL*NET IANA assigned this well-formed service name as a replacement for "sql*net".sql-netlast updated 27 Nov 201866 udp (sql*net)Oracle SQL*NETsql*netlast updated 27 Nov 201867 tcpBootstrap Protocol Serverbootpslast updated 27 Nov 201867 udpBootstrap Protocol Serverbootpslast updated 27 Nov 201868 tcpBootstrap Protocol Clientbootpclast updated 27 Nov 201868 udpBootstrap Protocol Clientbootpclast updated 27 Nov 201869 tcpTrivial File Transfertftplast updated 27 Nov 201869 udpTrivial File Transfertftplast updated 27 Nov 201870 tcpGophergopherlast updated 27 Nov 201870 udpGophergopherlast updated 27 Nov 201871 tcpRemote Job Servicenetrjs-1last updated 27 Nov 201871 udpRemote Job Servicenetrjs-1last updated 27 Nov 201872 tcpRemote Job Servicenetrjs-2last updated 27 Nov 201872 udpRemote Job Servicenetrjs-2last updated 27 Nov 201873 tcpRemote Job Servicenetrjs-3last updated 27 Nov 201873 udpRemote Job Servicenetrjs-3last updated 27 Nov 201874 tcpRemote Job Servicenetrjs-4last updated 27 Nov 201874 udpRemote Job Servicenetrjs-4last updated 27 Nov 201875 tcpany private dial out serviceN/Alast updated 27 Nov 201875 udpany private dial out serviceN/Alast updated 27 Nov 201876 tcpDistributed External Object Storedeoslast updated 27 Nov 201876 udpDistributed External Object Storedeoslast updated 27 Nov 201877 tcpany private RJE serviceN/Alast updated 27 Nov 201877 udpany private RJE serviceN/Alast updated 27 Nov 201878 tcpvettcpvettcplast updated 27 Nov 201878 udpvettcpvettcplast updated 27 Nov 201879 tcpFingerfingerlast updated 27 Nov 201879 udpFingerfingerlast updated 27 Nov 201880 tcpWorld Wide Web HTTPhttplast updated 27 Nov 201880 udpWorld Wide Web HTTPhttplast updated 27 Nov 201880 tcp (www)World Wide Web HTTPwwwlast updated 27 Nov 201880 udp (www)World Wide Web HTTPwwwlast updated 27 Nov 201880 tcp (www-http)World Wide Web HTTPwww-httplast updated 27 Nov 201880 udp (www-http)World Wide Web HTTPwww-httplast updated 27 Nov 201880 sctpHTTPhttplast updated 27 Nov 201881 UnassignedN/Alast updated 27 Nov 201882 tcpXFER Utilityxferlast updated 27 Nov 201882 udpXFER Utilityxferlast updated 27 Nov 201883 tcpMIT ML Devicemit-ml-devlast updated 27 Nov 201883 udpMIT ML Devicemit-ml-devlast updated 27 Nov 201884 tcpCommon Trace Facilityctflast updated 27 Nov 201884 udpCommon Trace Facilityctflast updated 27 Nov 201885 tcpMIT ML Devicemit-ml-devlast updated 27 Nov 201885 udpMIT ML Devicemit-ml-devlast updated 27 Nov 201886 tcpMicro Focus Cobolmfcobollast updated 27 Nov 201886 udpMicro Focus Cobolmfcobollast updated 27 Nov 201887 tcpany private terminal linkN/Alast updated 27 Nov 201887 udpany private terminal linkN/Alast updated 27 Nov 201888 tcpKerberoskerberoslast updated 27 Nov 201888 udpKerberoskerberoslast updated 27 Nov 201889 tcpSU/MIT Telnet Gatewaysu-mit-tglast updated 27 Nov 201889 udpSU/MIT Telnet Gatewaysu-mit-tglast updated 27 Nov 201890 tcpDNSIX Securit Attribute Token Mapdnsixlast updated 27 Nov 201890 udpDNSIX Securit Attribute Token Mapdnsixlast updated 27 Nov 201891 tcpMIT Dover Spoolermit-dovlast updated 27 Nov 201891 udpMIT Dover Spoolermit-dovlast updated 27 Nov 201892 tcpNetwork Printing Protocolnpplast updated 27 Nov 201892 udpNetwork Printing Protocolnpplast updated 27 Nov 201893 tcpDevice Control Protocoldcplast updated 27 Nov 201893 udpDevice Control Protocoldcplast updated 27 Nov 201894 tcpTivoli Object Dispatcherobjcalllast updated 27 Nov 201894 udpTivoli Object Dispatcherobjcalllast updated 27 Nov 201895 tcpSUPDUPsupduplast updated 27 Nov 201895 udpSUPDUPsupduplast updated 27 Nov 201896 tcpDIXIE Protocol Specificationdixielast updated 27 Nov 201896 udpDIXIE Protocol Specificationdixielast updated 27 Nov 201897 tcpSwift Remote Virtural File Protocolswift-rvflast updated 27 Nov 201897 udpSwift Remote Virtural File Protocolswift-rvflast updated 27 Nov 201898 tcpTAC Newstacnewslast updated 27 Nov 201898 udpTAC Newstacnewslast updated 27 Nov 201899 tcpMetagram Relaymetagramlast updated 27 Nov 201899 udpMetagram Relaymetagramlast updated 27 Nov 2018100 UnassignedN/Alast updated 27 Nov 2018101 tcpNIC Host Name Serverhostnamelast updated 27 Nov 2018101 udpNIC Host Name Serverhostnamelast updated 27 Nov 2018102 tcpISO-TSAP Class 0iso-tsaplast updated 27 Nov 2018102 udpISO-TSAP Class 0iso-tsaplast updated 27 Nov 2018103 tcpGenesis Point-to-Point Trans Netgppitnplast updated 27 Nov 2018103 udpGenesis Point-to-Point Trans Netgppitnplast updated 27 Nov 2018104 tcpACR-NEMA Digital Imag. & Comm. 300acr-nemalast updated 27 Nov 2018104 udpACR-NEMA Digital Imag. & Comm. 300acr-nemalast updated 27 Nov 2018105 tcp (cso)CCSO name server protocolcsolast updated 27 Nov 2018105 udp (cso)CCSO name server protocolcsolast updated 27 Nov 2018105 tcp (csnet)Mailbox Name Nameservercsnet-nslast updated 27 Nov 2018105 udp (csnet)Mailbox Name Nameservercsnet-nslast updated 27 Nov 2018106 tcp3COM-TSMUX3com-tsmuxlast updated 27 Nov 2018106 udp3COM-TSMUX3com-tsmuxlast updated 27 Nov 2018107 tcpRemote Telnet Servicertelnetlast updated 27 Nov 2018107 udpRemote Telnet Servicertelnetlast updated 27 Nov 2018108 tcpSNA Gateway Access Serversnagaslast updated 27 Nov 2018108 udpSNA Gateway Access Serversnagaslast updated 27 Nov 2018109 tcpPost Office Protocol - Version 2pop2last updated 27 Nov 2018109 udpPost Office Protocol - Version 2pop2last updated 27 Nov 2018110 tcpPost Office Protocol - Version 3pop3last updated 27 Nov 2018110 udpPost Office Protocol - Version 3pop3last updated 27 Nov 2018111 tcpSUN Remote Procedure Callsunrpclast updated 27 Nov 2018111 udpSUN Remote Procedure Callsunrpclast updated 27 Nov 2018112 tcpMcIDAS Data Transmission Protocolmcidaslast updated 27 Nov 2018112 udpMcIDAS Data Transmission Protocolmcidaslast updated 27 Nov 2018113 tcp (ident)-identlast updated 27 Nov 2018113 tcpAuthentication Serviceauthlast updated 27 Nov 2018113 udpAuthentication Serviceauthlast updated 27 Nov 2018114 unassignedN/Alast updated 27 Nov 2018115 tcpSimple File Transfer Protocolsftplast updated 27 Nov 2018115 udpSimple File Transfer Protocolsftplast updated 27 Nov 2018116 tcpANSA REX Notifyansanotifylast updated 27 Nov 2018116 udpANSA REX Notifyansanotifylast updated 27 Nov 2018117 tcpUUCP Path Serviceuucp-pathlast updated 27 Nov 2018117 udpUUCP Path Serviceuucp-pathlast updated 27 Nov 2018118 tcpSQL Servicessqlservlast updated 27 Nov 2018118 udpSQL Servicessqlservlast updated 27 Nov 2018119 tcpNetwork News Transfer Protocolnntplast updated 27 Nov 2018119 udpNetwork News Transfer Protocolnntplast updated 27 Nov 2018120 tcpCFDPTKTcfdptktlast updated 27 Nov 2018120 udpCFDPTKTcfdptktlast updated 27 Nov 2018121 tcpEncore Expedited Remote Pro.Callerpclast updated 27 Nov 2018121 udpEncore Expedited Remote Pro.Callerpclast updated 27 Nov 2018122 tcpSMAKYNETsmakynetlast updated 27 Nov 2018122 udpSMAKYNETsmakynetlast updated 27 Nov 2018123 tcpNetwork Time Protocolntplast updated 27 Nov 2018123 udpNetwork Time Protocolntplast updated 27 Nov 2018124 tcpANSA REX Traderansatraderlast updated 27 Nov 2018124 udpANSA REX Traderansatraderlast updated 27 Nov 2018125 tcpLocus PC-Interface Net Map Serlocus-maplast updated 27 Nov 2018125 udpLocus PC-Interface Net Map Serlocus-maplast updated 27 Nov 2018126 tcpNXEditnxeditlast updated 27 Nov 2018126 udpNXEditnxeditlast updated 27 Nov 2018127 tcpLocus PC-Interface Conn Serverlocus-conlast updated 27 Nov 2018127 udpLocus PC-Interface Conn Serverlocus-conlast updated 27 Nov 2018128 tcpGSS X License Verificationgss-xlicenlast updated 27 Nov 2018128 udpGSS X License Verificationgss-xlicenlast updated 27 Nov 2018129 tcpPassword Generator Protocolpwdgenlast updated 27 Nov 2018129 udpPassword Generator Protocolpwdgenlast updated 27 Nov 2018130 tcpcisco FNATIVEcisco-fnalast updated 27 Nov 2018130 udpcisco FNATIVEcisco-fnalast updated 27 Nov 2018131 tcpcisco TNATIVEcisco-tnalast updated 27 Nov 2018131 udpcisco TNATIVEcisco-tnalast updated 27 Nov 2018132 tcpcisco SYSMAINTcisco-syslast updated 27 Nov 2018132 udpcisco SYSMAINTcisco-syslast updated 27 Nov 2018133 tcpStatistics Servicestatsrvlast updated 27 Nov 2018133 udpStatistics Servicestatsrvlast updated 27 Nov 2018134 tcpINGRES-NET Serviceingres-netlast updated 27 Nov 2018134 udpINGRES-NET Serviceingres-netlast updated 27 Nov 2018135 tcpDCE endpoint resolutionepmaplast updated 27 Nov 2018135 udpDCE endpoint resolutionepmaplast updated 27 Nov 2018136 tcpPROFILE Naming Systemprofilelast updated 27 Nov 2018136 udpPROFILE Naming Systemprofilelast updated 27 Nov 2018137 tcpNETBIOS Name Servicenetbios-nslast updated 27 Nov 2018137 udpNETBIOS Name Servicenetbios-nslast updated 27 Nov 2018138 tcpNETBIOS Datagram Servicenetbios-dgmlast updated 27 Nov 2018138 udpNETBIOS Datagram Servicenetbios-dgmlast updated 27 Nov 2018139 tcpNETBIOS Session Servicenetbios-ssnlast updated 27 Nov 2018139 udpNETBIOS Session Servicenetbios-ssnlast updated 27 Nov 2018140 tcpEMFIS Data Serviceemfis-datalast updated 27 Nov 2018140 udpEMFIS Data Serviceemfis-datalast updated 27 Nov 2018141 tcpEMFIS Control Serviceemfis-cntllast updated 27 Nov 2018141 udpEMFIS Control Serviceemfis-cntllast updated 27 Nov 2018142 tcpBritton-Lee IDMbl-idmlast updated 27 Nov 2018142 udpBritton-Lee IDMbl-idmlast updated 27 Nov 2018143 tcpInternet Message Access Protocolimaplast updated 27 Nov 2018143 udpInternet Message Access Protocolimaplast updated 27 Nov 2018144 tcpUniversal Management Architectureumalast updated 27 Nov 2018144 udpUniversal Management Architectureumalast updated 27 Nov 2018145 tcpUAAC Protocoluaaclast updated 27 Nov 2018145 udpUAAC Protocoluaaclast updated 27 Nov 2018146 tcpISO-IP0iso-tp0last updated 27 Nov 2018146 udpISO-IP0iso-tp0last updated 27 Nov 2018147 tcpISO-IPiso-iplast updated 27 Nov 2018147 udpISO-IPiso-iplast updated 27 Nov 2018148 tcpJargonjargonlast updated 27 Nov 2018148 udpJargonjargonlast updated 27 Nov 2018149 tcpAED 512 Emulation Serviceaed-512last updated 27 Nov 2018149 udpAED 512 Emulation Serviceaed-512last updated 27 Nov 2018150 tcpSQL-NETsql-netlast updated 27 Nov 2018150 udpSQL-NETsql-netlast updated 27 Nov 2018151 tcpHEMShemslast updated 27 Nov 2018151 udpHEMShemslast updated 27 Nov 2018152 tcpBackground File Transfer Programbftplast updated 27 Nov 2018152 udpBackground File Transfer Programbftplast updated 27 Nov 2018153 tcpSGMPsgmplast updated 27 Nov 2018153 udpSGMPsgmplast updated 27 Nov 2018154 tcpNETSCnetsc-prodlast updated 27 Nov 2018154 udpNETSCnetsc-prodlast updated 27 Nov 2018155 tcpNETSCnetsc-devlast updated 27 Nov 2018155 udpNETSCnetsc-devlast updated 27 Nov 2018156 tcpSQL Servicesqlsrvlast updated 27 Nov 2018156 udpSQL Servicesqlsrvlast updated 27 Nov 2018157 tcpKNET/VM Command/Message Protocolknet-cmplast updated 27 Nov 2018157 udpKNET/VM Command/Message Protocolknet-cmplast updated 27 Nov 2018158 tcpPCMail Serverpcmail-srvlast updated 27 Nov 2018158 udpPCMail Serverpcmail-srvlast updated 27 Nov 2018159 tcpNSS-Routingnss-routinglast updated 27 Nov 2018159 udpNSS-Routingnss-routinglast updated 27 Nov 2018160 tcpSGMP-TRAPSsgmp-trapslast updated 27 Nov 2018160 udpSGMP-TRAPSsgmp-trapslast updated 27 Nov 2018161 tcpSNMPsnmplast updated 27 Nov 2018161 udpSNMPsnmplast updated 27 Nov 2018162 tcpSNMPTRAPsnmptraplast updated 27 Nov 2018162 udpSNMPTRAPsnmptraplast updated 27 Nov 2018163 tcpCMIP/TCP Managercmip-manlast updated 27 Nov 2018163 udpCMIP/TCP Managercmip-manlast updated 27 Nov 2018164 tcpCMIP/TCP Agentcmip-agentlast updated 27 Nov 2018164 udpCMIP/TCP Agentcmip-agentlast updated 27 Nov 2018165 tcpXeroxxns-courierlast updated 27 Nov 2018165 udpXeroxxns-courierlast updated 27 Nov 2018166 tcpSirius Systemss-netlast updated 27 Nov 2018166 udpSirius Systemss-netlast updated 27 Nov 2018167 tcpNAMPnamplast updated 27 Nov 2018167 udpNAMPnamplast updated 27 Nov 2018168 tcpRSVDrsvdlast updated 27 Nov 2018168 udpRSVDrsvdlast updated 27 Nov 2018169 tcpSENDsendlast updated 27 Nov 2018169 udpSENDsendlast updated 27 Nov 2018170 tcpNetwork PostScriptprint-srvlast updated 27 Nov 2018170 udpNetwork PostScriptprint-srvlast updated 27 Nov 2018171 tcpNetwork Innovations Multiplexmultiplexlast updated 27 Nov 2018171 udpNetwork Innovations Multiplexmultiplexlast updated 27 Nov 2018172 tcpNetwork Innovations CL/1 IANA assigned this well-formed service name as a replacement for "cl/1".cl-1last updated 27 Nov 2018172 tcp (cl/1)Network Innovations CL/1cl/1last updated 27 Nov 2018172 udpNetwork Innovations CL/1 IANA assigned this well-formed service name as a replacement for "cl/1".cl-1last updated 27 Nov 2018172 udp (cl/1)Network Innovations CL/1cl/1last updated 27 Nov 2018173 tcpXyplexxyplex-muxlast updated 27 Nov 2018173 udpXyplexxyplex-muxlast updated 27 Nov 2018174 tcpMAILQmailqlast updated 27 Nov 2018174 udpMAILQmailqlast updated 27 Nov 2018175 tcpVMNETvmnetlast updated 27 Nov 2018175 udpVMNETvmnetlast updated 27 Nov 2018176 tcpGENRAD-MUXgenrad-muxlast updated 27 Nov 2018176 udpGENRAD-MUXgenrad-muxlast updated 27 Nov 2018177 tcpX Display Manager Control Protocolxdmcplast updated 27 Nov 2018177 udpX Display Manager Control Protocolxdmcplast updated 27 Nov 2018178 tcpNextStep Window Servernextsteplast updated 27 Nov 2018178 udpNextStep Window Servernextsteplast updated 27 Nov 2018179 tcpBorder Gateway Protocolbgplast updated 27 Nov 2018179 udpBorder Gateway Protocolbgplast updated 27 Nov 2018179 sctpBGPbgplast updated 27 Nov 2018180 tcpIntergraphrislast updated 27 Nov 2018180 udpIntergraphrislast updated 27 Nov 2018181 tcpUnifyunifylast updated 27 Nov 2018181 udpUnifyunifylast updated 27 Nov 2018182 tcpUnisys Audit SITPauditlast updated 27 Nov 2018182 udpUnisys Audit SITPauditlast updated 27 Nov 2018183 tcpOCBinderocbinderlast updated 27 Nov 2018183 udpOCBinderocbinderlast updated 27 Nov 2018184 tcpOCServerocserverlast updated 27 Nov 2018184 udpOCServerocserverlast updated 27 Nov 2018185 tcpRemote-KISremote-kislast updated 27 Nov 2018185 udpRemote-KISremote-kislast updated 27 Nov 2018186 tcpKIS Protocolkislast updated 27 Nov 2018186 udpKIS Protocolkislast updated 27 Nov 2018187 tcpApplication Communication Interfaceacilast updated 27 Nov 2018187 udpApplication Communication Interfaceacilast updated 27 Nov 2018188 tcpPlus Five's MUMPSmumpslast updated 27 Nov 2018188 udpPlus Five's MUMPSmumpslast updated 27 Nov 2018189 tcpQueued File Transportqftlast updated 27 Nov 2018189 udpQueued File Transportqftlast updated 27 Nov 2018190 tcpGateway Access Control Protocolgacplast updated 27 Nov 2018190 udpGateway Access Control Protocolgacplast updated 27 Nov 2018191 tcpProspero Directory Serviceprosperolast updated 27 Nov 2018191 udpProspero Directory Serviceprosperolast updated 27 Nov 2018192 tcpOSU Network Monitoring Systemosu-nmslast updated 27 Nov 2018192 udpOSU Network Monitoring Systemosu-nmslast updated 27 Nov 2018193 tcpSpider Remote Monitoring Protocolsrmplast updated 27 Nov 2018193 udpSpider Remote Monitoring Protocolsrmplast updated 27 Nov 2018194 tcpInternet Relay Chat Protocolirclast updated 27 Nov 2018194 udpInternet Relay Chat Protocolirclast updated 27 Nov 2018195 tcpDNSIX Network Level Module Auditdn6-nlm-audlast updated 27 Nov 2018195 udpDNSIX Network Level Module Auditdn6-nlm-audlast updated 27 Nov 2018196 tcpDNSIX Session Mgt Module Audit Redirdn6-smm-redlast updated 27 Nov 2018196 udpDNSIX Session Mgt Module Audit Redirdn6-smm-redlast updated 27 Nov 2018197 tcpDirectory Location Servicedlslast updated 27 Nov 2018197 udpDirectory Location Servicedlslast updated 27 Nov 2018198 tcpDirectory Location Service Monitordls-monlast updated 27 Nov 2018198 udpDirectory Location Service Monitordls-monlast updated 27 Nov 2018199 tcpSMUXsmuxlast updated 27 Nov 2018199 udpSMUXsmuxlast updated 27 Nov 2018200 tcpIBM System Resource Controllersrclast updated 27 Nov 2018200 udpIBM System Resource Controllersrclast updated 27 Nov 2018201 tcpAppleTalk Routing Maintenanceat-rtmplast updated 27 Nov 2018201 udpAppleTalk Routing Maintenanceat-rtmplast updated 27 Nov 2018202 tcpAppleTalk Name Bindingat-nbplast updated 27 Nov 2018202 udpAppleTalk Name Bindingat-nbplast updated 27 Nov 2018203 tcpAppleTalk Unusedat-3last updated 27 Nov 2018203 udpAppleTalk Unusedat-3last updated 27 Nov 2018204 tcpAppleTalk Echoat-echolast updated 27 Nov 2018204 udpAppleTalk Echoat-echolast updated 27 Nov 2018205 tcpAppleTalk Unusedat-5last updated 27 Nov 2018205 udpAppleTalk Unusedat-5last updated 27 Nov 2018206 tcpAppleTalk Zone Informationat-zislast updated 27 Nov 2018206 udpAppleTalk Zone Informationat-zislast updated 27 Nov 2018207 tcpAppleTalk Unusedat-7last updated 27 Nov 2018207 udpAppleTalk Unusedat-7last updated 27 Nov 2018208 tcpAppleTalk Unusedat-8last updated 27 Nov 2018208 udpAppleTalk Unusedat-8last updated 27 Nov 2018209 tcpThe Quick Mail Transfer Protocolqmtplast updated 27 Nov 2018209 udpThe Quick Mail Transfer Protocolqmtplast updated 27 Nov 2018210 tcpANSI Z39.50 IANA assigned this well-formed service name as a replacement for "z39.50".z39-50last updated 27 Nov 2018210 tcp (z39.50)ANSI Z39.50z39.50last updated 27 Nov 2018210 udpANSI Z39.50 IANA assigned this well-formed service name as a replacement for "z39.50".z39-50last updated 27 Nov 2018210 udp (z39.50)ANSI Z39.50z39.50last updated 27 Nov 2018211 tcpTexas Instruments 914C/G Terminal IANA assigned this well-formed service name as a replacement for "914c/g".914c-glast updated 27 Nov 2018211 tcp (914c/g)Texas Instruments 914C/G Terminal914c/glast updated 27 Nov 2018211 udpTexas Instruments 914C/G Terminal IANA assigned this well-formed service name as a replacement for "914c/g".914c-glast updated 27 Nov 2018211 udp (914c/g)Texas Instruments 914C/G Terminal914c/glast updated 27 Nov 2018212 tcpATEXSSTRanetlast updated 27 Nov 2018212 udpATEXSSTRanetlast updated 27 Nov 2018213 tcpIPXipxlast updated 27 Nov 2018213 udpIPXipxlast updated 27 Nov 2018214 tcpVM PWSCSvmpwscslast updated 27 Nov 2018214 udpVM PWSCSvmpwscslast updated 27 Nov 2018215 tcpInsignia Solutionssoftpclast updated 27 Nov 2018215 udpInsignia Solutionssoftpclast updated 27 Nov 2018216 tcpComputer Associates Int'l License ServerCAIliclast updated 27 Nov 2018216 udpComputer Associates Int'l License ServerCAIliclast updated 27 Nov 2018217 tcpdBASE Unixdbaselast updated 27 Nov 2018217 udpdBASE Unixdbaselast updated 27 Nov 2018218 tcpNetix Message Posting Protocolmpplast updated 27 Nov 2018218 udpNetix Message Posting Protocolmpplast updated 27 Nov 2018219 tcpUnisys ARPsuarpslast updated 27 Nov 2018219 udpUnisys ARPsuarpslast updated 27 Nov 2018220 tcpInteractive Mail Access Protocol v3imap3last updated 27 Nov 2018220 udpInteractive Mail Access Protocol v3imap3last updated 27 Nov 2018221 tcpBerkeley rlogind with SPX authfln-spxlast updated 27 Nov 2018221 udpBerkeley rlogind with SPX authfln-spxlast updated 27 Nov 2018222 tcpBerkeley rshd with SPX authrsh-spxlast updated 27 Nov 2018222 udpBerkeley rshd with SPX authrsh-spxlast updated 27 Nov 2018223 tcpCertificate Distribution Centercdclast updated 27 Nov 2018223 udpCertificate Distribution Centercdclast updated 27 Nov 2018224 tcpmasqdialermasqdialerlast updated 27 Nov 2018224 udpmasqdialermasqdialerlast updated 27 Nov 2018225-241 ReservedN/Alast updated 27 Nov 2018242 tcpDirectdirectlast updated 27 Nov 2018242 udpDirectdirectlast updated 27 Nov 2018243 tcpSurvey Measurementsur-measlast updated 27 Nov 2018243 udpSurvey Measurementsur-measlast updated 27 Nov 2018244 tcpinbusinessinbusinesslast updated 27 Nov 2018244 udpinbusinessinbusinesslast updated 27 Nov 2018245 tcpLINKlinklast updated 27 Nov 2018245 udpLINKlinklast updated 27 Nov 2018246 tcpDisplay Systems Protocoldsp3270last updated 27 Nov 2018246 udpDisplay Systems Protocoldsp3270last updated 27 Nov 2018247 tcpSUBNTBCST_TFTP IANA assigned this well-formed service name as a replacement for "subntbcst_tftp".subntbcst-tftplast updated 27 Nov 2018247 tcp (subntbcst_tftp)SUBNTBCST_TFTPsubntbcst_tftplast updated 27 Nov 2018247 udpSUBNTBCST_TFTP IANA assigned this well-formed service name as a replacement for "subntbcst_tftp".subntbcst-tftplast updated 27 Nov 2018247 udp (subntbcst_tftp)SUBNTBCST_TFTPsubntbcst_tftplast updated 27 Nov 2018248 tcpbhfhsbhfhslast updated 27 Nov 2018248 udpbhfhsbhfhslast updated 27 Nov 2018249-255 ReservedN/Alast updated 27 Nov 2018256 tcpRAPraplast updated 27 Nov 2018256 udpRAPraplast updated 27 Nov 2018257 tcpSecure Electronic Transactionsetlast updated 27 Nov 2018257 udpSecure Electronic Transactionsetlast updated 27 Nov 2018258 UnassignedN/Alast updated 27 Nov 2018259 tcpEfficient Short Remote Operationsesro-genlast updated 27 Nov 2018259 udpEfficient Short Remote Operationsesro-genlast updated 27 Nov 2018260 tcpOpenportopenportlast updated 27 Nov 2018260 udpOpenportopenportlast updated 27 Nov 2018261 tcpIIOP Name Service over TLS/SSLnsiiopslast updated 27 Nov 2018261 udpIIOP Name Service over TLS/SSLnsiiopslast updated 27 Nov 2018262 tcpArcisdmsarcisdmslast updated 27 Nov 2018262 udpArcisdmsarcisdmslast updated 27 Nov 2018263 tcpHDAPhdaplast updated 27 Nov 2018263 udpHDAPhdaplast updated 27 Nov 2018264 tcpBGMPbgmplast updated 27 Nov 2018264 udpBGMPbgmplast updated 27 Nov 2018265 tcpX-Bone CTLx-bone-ctllast updated 27 Nov 2018265 udpX-Bone CTLx-bone-ctllast updated 27 Nov 2018266 tcpSCSI on STsstlast updated 27 Nov 2018266 udpSCSI on STsstlast updated 27 Nov 2018267 tcpTobit David Service Layertd-servicelast updated 27 Nov 2018267 udpTobit David Service Layertd-servicelast updated 27 Nov 2018268 tcpTobit David Replicatd-replicalast updated 27 Nov 2018268 udpTobit David Replicatd-replicalast updated 27 Nov 2018269 tcpMANET Protocolsmanetlast updated 27 Nov 2018269 udpMANET Protocolsmanetlast updated 27 Nov 2018270 tcpReservedN/Alast updated 27 Nov 2018270 udpQ-mode encapsulation for GIST messagesgistlast updated 27 Nov 2018271 tcpIETF Network Endpoint Assessment (NEA) Posture Transport Protocol over TLS (PT-TLS)pt-tlslast updated 27 Nov 2018271 udpReservedN/Alast updated 27 Nov 2018272-279 UnassignedN/Alast updated 27 Nov 2018280 tcphttp-mgmthttp-mgmtlast updated 27 Nov 2018280 udphttp-mgmthttp-mgmtlast updated 27 Nov 2018281 tcpPersonal Linkpersonal-linklast updated 27 Nov 2018281 udpPersonal Linkpersonal-linklast updated 27 Nov 2018282 tcpCable Port A/Xcableport-axlast updated 27 Nov 2018282 udpCable Port A/Xcableport-axlast updated 27 Nov 2018283 tcprescaprescaplast updated 27 Nov 2018283 udprescaprescaplast updated 27 Nov 2018284 tcpcorerjdcorerjdlast updated 27 Nov 2018284 udpcorerjdcorerjdlast updated 27 Nov 2018285 UnassignedN/Alast updated 27 Nov 2018286 tcpFXP Communicationfxplast updated 27 Nov 2018286 udpFXP Communicationfxplast updated 27 Nov 2018287 tcpK-BLOCKk-blocklast updated 27 Nov 2018287 udpK-BLOCKk-blocklast updated 27 Nov 2018288-307 UnassignedN/Alast updated 27 Nov 2018308 tcpNovastor Backupnovastorbakcuplast updated 27 Nov 2018308 udpNovastor Backupnovastorbakcuplast updated 27 Nov 2018309 tcpEntrustTimeentrusttimelast updated 27 Nov 2018309 udpEntrustTimeentrusttimelast updated 27 Nov 2018310 tcpbhmdsbhmdslast updated 27 Nov 2018310 udpbhmdsbhmdslast updated 27 Nov 2018311 tcpAppleShare IP WebAdminasip-webadminlast updated 27 Nov 2018311 udpAppleShare IP WebAdminasip-webadminlast updated 27 Nov 2018312 tcpVSLMPvslmplast updated 27 Nov 2018312 udpVSLMPvslmplast updated 27 Nov 2018313 tcpMagenta Logicmagenta-logiclast updated 27 Nov 2018313 udpMagenta Logicmagenta-logiclast updated 27 Nov 2018314 tcpOpalis Robotopalis-robotlast updated 27 Nov 2018314 udpOpalis Robotopalis-robotlast updated 27 Nov 2018315 tcpDPSIdpsilast updated 27 Nov 2018315 udpDPSIdpsilast updated 27 Nov 2018316 tcpdecAuthdecauthlast updated 27 Nov 2018316 udpdecAuthdecauthlast updated 27 Nov 2018317 tcpZannetzannetlast updated 27 Nov 2018317 udpZannetzannetlast updated 27 Nov 2018318 tcpPKIX TimeStamppkix-timestamplast updated 27 Nov 2018318 udpPKIX TimeStamppkix-timestamplast updated 27 Nov 2018319 tcpPTP Eventptp-eventlast updated 27 Nov 2018319 udpPTP Eventptp-eventlast updated 27 Nov 2018320 tcpPTP Generalptp-generallast updated 27 Nov 2018320 udpPTP Generalptp-generallast updated 27 Nov 2018321 tcpPIPpiplast updated 27 Nov 2018321 udpPIPpiplast updated 27 Nov 2018322 tcpRTSPSrtspslast updated 27 Nov 2018322 udpRTSPSrtspslast updated 27 Nov 2018323 tcpResource PKI to Router Protocolrpki-rtrlast updated 27 Nov 2018323 udpReservedN/Alast updated 27 Nov 2018324 tcpResource PKI to Router Protocol over TLSrpki-rtr-tlslast updated 27 Nov 2018324 udpReservedN/Alast updated 27 Nov 2018325-332 UnassignedN/Alast updated 27 Nov 2018333 tcpTexar Security Porttexarlast updated 27 Nov 2018333 udpTexar Security Porttexarlast updated 27 Nov 2018334-343 UnassignedN/Alast updated 27 Nov 2018344 tcpProspero Data Access Protocolpdaplast updated 27 Nov 2018344 udpProspero Data Access Protocolpdaplast updated 27 Nov 2018345 tcpPerf Analysis Workbenchpawservlast updated 27 Nov 2018345 udpPerf Analysis Workbenchpawservlast updated 27 Nov 2018346 tcpZebra serverzservlast updated 27 Nov 2018346 udpZebra serverzservlast updated 27 Nov 2018347 tcpFatmen Serverfatservlast updated 27 Nov 2018347 udpFatmen Serverfatservlast updated 27 Nov 2018348 tcpCabletron Management Protocolcsi-sgwplast updated 27 Nov 2018348 udpCabletron Management Protocolcsi-sgwplast updated 27 Nov 2018349 tcpmftpmftplast updated 27 Nov 2018349 udpmftpmftplast updated 27 Nov 2018350 tcpMATIP Type Amatip-type-alast updated 27 Nov 2018350 udpMATIP Type Amatip-type-alast updated 27 Nov 2018351 tcpMATIP Type Bmatip-type-blast updated 27 Nov 2018351 udpMATIP Type Bmatip-type-blast updated 27 Nov 2018351 tcp (bhoetty)bhoettybhoettylast updated 27 Nov 2018351 udp tcp (bhoetty)bhoettybhoettylast updated 27 Nov 2018352 tcpDTAGdtag-ste-sblast updated 27 Nov 2018352 udpDTAGdtag-ste-sblast updated 27 Nov 2018352 tcp (bhoedap4)bhoedap4bhoedap4last updated 27 Nov 2018352 udp (bhoedap4)bhoedap4bhoedap4last updated 27 Nov 2018353 tcpNDSAUTHndsauthlast updated 27 Nov 2018353 udpNDSAUTHndsauthlast updated 27 Nov 2018354 tcpbh611bh611last updated 27 Nov 2018354 udpbh611bh611last updated 27 Nov 2018355 tcpDATEX-ASNdatex-asnlast updated 27 Nov 2018355 udpDATEX-ASNdatex-asnlast updated 27 Nov 2018356 tcpCloanto Net 1cloanto-net-1last updated 27 Nov 2018356 udpCloanto Net 1cloanto-net-1last updated 27 Nov 2018357 tcpbheventbheventlast updated 27 Nov 2018357 udpbheventbheventlast updated 27 Nov 2018358 tcpShrinkwrapshrinkwraplast updated 27 Nov 2018358 udpShrinkwrapshrinkwraplast updated 27 Nov 2018359 tcpNetwork Security Risk Management Protocolnsrmplast updated 27 Nov 2018359 udpNetwork Security Risk Management Protocolnsrmplast updated 27 Nov 2018360 tcpscoi2odialogscoi2odialoglast updated 27 Nov 2018360 udpscoi2odialogscoi2odialoglast updated 27 Nov 2018361 tcpSemantixsemantixlast updated 27 Nov 2018361 udpSemantixsemantixlast updated 27 Nov 2018362 tcpSRS Sendsrssendlast updated 27 Nov 2018362 udpSRS Sendsrssendlast updated 27 Nov 2018363 tcpRSVP Tunnel IANA assigned this well-formed service name as a replacement for "rsvp_tunnel".rsvp-tunnellast updated 27 Nov 2018363 tcp (rsvp_tunnel)RSVP Tunnelrsvp_tunnellast updated 27 Nov 2018363 udpRSVP Tunnel IANA assigned this well-formed service name as a replacement for "rsvp_tunnel".rsvp-tunnellast updated 27 Nov 2018363 udp (rsvp_tunnel)RSVP Tunnelrsvp_tunnellast updated 27 Nov 2018364 tcpAurora CMGRaurora-cmgrlast updated 27 Nov 2018364 udpAurora CMGRaurora-cmgrlast updated 27 Nov 2018365 tcpDTKdtklast updated 27 Nov 2018365 udpDTKdtklast updated 27 Nov 2018366 tcpODMRodmrlast updated 27 Nov 2018366 udpODMRodmrlast updated 27 Nov 2018367 tcpMortgageWaremortgagewarelast updated 27 Nov 2018367 udpMortgageWaremortgagewarelast updated 27 Nov 2018368 tcpQbikGDPqbikgdplast updated 27 Nov 2018368 udpQbikGDPqbikgdplast updated 27 Nov 2018369 tcprpc2portmaprpc2portmaplast updated 27 Nov 2018369 udprpc2portmaprpc2portmaplast updated 27 Nov 2018370 tcpcodaauth2codaauth2last updated 27 Nov 2018370 udpcodaauth2codaauth2last updated 27 Nov 2018371 tcpClearcaseclearcaselast updated 27 Nov 2018371 udpClearcaseclearcaselast updated 27 Nov 2018372 tcpListProcessorulistproclast updated 27 Nov 2018372 udpListProcessorulistproclast updated 27 Nov 2018373 tcpLegent Corporationlegent-1last updated 27 Nov 2018373 udpLegent Corporationlegent-1last updated 27 Nov 2018374 tcpLegent Corporationlegent-2last updated 27 Nov 2018374 udpLegent Corporationlegent-2last updated 27 Nov 2018375 tcpHasslehasslelast updated 27 Nov 2018375 udpHasslehasslelast updated 27 Nov 2018376 tcpAmiga Envoy Network Inquiry Protoniplast updated 27 Nov 2018376 udpAmiga Envoy Network Inquiry Protoniplast updated 27 Nov 2018377 tcpNEC CorporationtnETOSlast updated 27 Nov 2018377 udpNEC CorporationtnETOSlast updated 27 Nov 2018378 tcpNEC CorporationdsETOSlast updated 27 Nov 2018378 udpNEC CorporationdsETOSlast updated 27 Nov 2018379 tcpTIA/EIA/IS-99 modem clientis99clast updated 27 Nov 2018379 udpTIA/EIA/IS-99 modem clientis99clast updated 27 Nov 2018380 tcpTIA/EIA/IS-99 modem serveris99slast updated 27 Nov 2018380 udpTIA/EIA/IS-99 modem serveris99slast updated 27 Nov 2018381 tcphp performance data collectorhp-collectorlast updated 27 Nov 2018381 udphp performance data collectorhp-collectorlast updated 27 Nov 2018382 tcphp performance data managed nodehp-managed-nodelast updated 27 Nov 2018382 udphp performance data managed nodehp-managed-nodelast updated 27 Nov 2018383 tcphp performance data alarm managerhp-alarm-mgrlast updated 27 Nov 2018383 udphp performance data alarm managerhp-alarm-mgrlast updated 27 Nov 2018384 tcpA Remote Network Server Systemarnslast updated 27 Nov 2018384 udpA Remote Network Server Systemarnslast updated 27 Nov 2018385 tcpIBM Applicationibm-applast updated 27 Nov 2018385 udpIBM Applicationibm-applast updated 27 Nov 2018386 tcpASA Message Router Object Def.asalast updated 27 Nov 2018386 udpASA Message Router Object Def.asalast updated 27 Nov 2018387 tcpAppletalk Update-Based Routing Pro.aurplast updated 27 Nov 2018387 udpAppletalk Update-Based Routing Pro.aurplast updated 27 Nov 2018388 tcpUnidata LDMunidata-ldmlast updated 27 Nov 2018388 udpUnidata LDMunidata-ldmlast updated 27 Nov 2018389 tcpLightweight Directory Access Protocolldaplast updated 27 Nov 2018389 udpLightweight Directory Access Protocolldaplast updated 27 Nov 2018390 tcpUISuislast updated 27 Nov 2018390 udpUISuislast updated 27 Nov 2018391 tcpSynOptics SNMP Relay Portsynotics-relaylast updated 27 Nov 2018391 udpSynOptics SNMP Relay Portsynotics-relaylast updated 27 Nov 2018392 tcpSynOptics Port Broker Portsynotics-brokerlast updated 27 Nov 2018392 udpSynOptics Port Broker Portsynotics-brokerlast updated 27 Nov 2018393 tcpMeta5meta5last updated 27 Nov 2018393 udpMeta5meta5last updated 27 Nov 2018394 tcpEMBL Nucleic Data Transferembl-ndtlast updated 27 Nov 2018394 udpEMBL Nucleic Data Transferembl-ndtlast updated 27 Nov 2018395 tcpNetScout Control Protocolnetcplast updated 27 Nov 2018395 udpNetScout Control Protocolnetcplast updated 27 Nov 2018396 tcpNovell Netware over IPnetware-iplast updated 27 Nov 2018396 udpNovell Netware over IPnetware-iplast updated 27 Nov 2018397 tcpMulti Protocol Trans. Net.mptnlast updated 27 Nov 2018397 udpMulti Protocol Trans. Net.mptnlast updated 27 Nov 2018398 tcpKryptolankryptolanlast updated 27 Nov 2018398 udpKryptolankryptolanlast updated 27 Nov 2018399 tcpISO Transport Class 2 Non-Control over TCPiso-tsap-c2last updated 27 Nov 2018399 udpISO Transport Class 2 Non-Control over UDPiso-tsap-c2last updated 27 Nov 2018400 tcpOracle Secure Backuposb-sdlast updated 27 Nov 2018400 udpOracle Secure Backuposb-sdlast updated 27 Nov 2018401 tcpUninterruptible Power Supplyupslast updated 27 Nov 2018401 udpUninterruptible Power Supplyupslast updated 27 Nov 2018402 tcpGenie Protocolgenielast updated 27 Nov 2018402 udpGenie Protocolgenielast updated 27 Nov 2018403 tcpdecapdecaplast updated 27 Nov 2018403 udpdecapdecaplast updated 27 Nov 2018404 tcpncedncedlast updated 27 Nov 2018404 udpncedncedlast updated 27 Nov 2018405 tcpncldncldlast updated 27 Nov 2018405 udpncldncldlast updated 27 Nov 2018406 tcpInteractive Mail Support Protocolimsplast updated 27 Nov 2018406 udpInteractive Mail Support Protocolimsplast updated 27 Nov 2018407 tcpTimbuktutimbuktulast updated 27 Nov 2018407 udpTimbuktutimbuktulast updated 27 Nov 2018408 tcpProspero Resource Manager Sys. Man.prm-smlast updated 27 Nov 2018408 udpProspero Resource Manager Sys. Man.prm-smlast updated 27 Nov 2018409 tcpProspero Resource Manager Node Man.prm-nmlast updated 27 Nov 2018409 udpProspero Resource Manager Node Man.prm-nmlast updated 27 Nov 2018410 tcpDECLadebug Remote Debug Protocoldecladebuglast updated 27 Nov 2018410 udpDECLadebug Remote Debug Protocoldecladebuglast updated 27 Nov 2018411 tcpRemote MT Protocolrmtlast updated 27 Nov 2018411 udpRemote MT Protocolrmtlast updated 27 Nov 2018412 tcpTrap Convention Portsynoptics-traplast updated 27 Nov 2018412 udpTrap Convention Portsynoptics-traplast updated 27 Nov 2018413 tcpStorage Management Services Protocolsmsplast updated 27 Nov 2018413 udpStorage Management Services Protocolsmsplast updated 27 Nov 2018414 tcpInfoSeekinfoseeklast updated 27 Nov 2018414 udpInfoSeekinfoseeklast updated 27 Nov 2018415 tcpBNetbnetlast updated 27 Nov 2018415 udpBNetbnetlast updated 27 Nov 2018416 tcpSilverplattersilverplatterlast updated 27 Nov 2018416 udpSilverplattersilverplatterlast updated 27 Nov 2018417 tcpOnmuxonmuxlast updated 27 Nov 2018417 udpOnmuxonmuxlast updated 27 Nov 2018418 tcpHyper-Ghyper-glast updated 27 Nov 2018418 udpHyper-Ghyper-glast updated 27 Nov 2018419 tcpAriel 1ariel1last updated 27 Nov 2018419 udpAriel 1ariel1last updated 27 Nov 2018420 tcpSMPTEsmptelast updated 27 Nov 2018420 udpSMPTEsmptelast updated 27 Nov 2018421 tcpAriel 2ariel2last updated 27 Nov 2018421 udpAriel 2ariel2last updated 27 Nov 2018422 tcpAriel 3ariel3last updated 27 Nov 2018422 udpAriel 3ariel3last updated 27 Nov 2018423 tcpIBM Operations Planning and Control Startopc-job-startlast updated 27 Nov 2018423 udpIBM Operations Planning and Control Startopc-job-startlast updated 27 Nov 2018424 tcpIBM Operations Planning and Control Trackopc-job-tracklast updated 27 Nov 2018424 udpIBM Operations Planning and Control Trackopc-job-tracklast updated 27 Nov 2018425 tcpICADicad-ellast updated 27 Nov 2018425 udpICADicad-ellast updated 27 Nov 2018426 tcpsmartsdpsmartsdplast updated 27 Nov 2018426 udpsmartsdpsmartsdplast updated 27 Nov 2018427 tcpServer Locationsvrloclast updated 27 Nov 2018427 udpServer Locationsvrloclast updated 27 Nov 2018428 tcpOCS_CMU IANA assigned this well-formed service name as a replacement for "ocs_cmu".ocs-cmulast updated 27 Nov 2018428 tcp (ocs_cmu)OCS_CMUocs_cmulast updated 27 Nov 2018428 udpOCS_CMU IANA assigned this well-formed service name as a replacement for "ocs_cmu".ocs-cmulast updated 27 Nov 2018428 udp (ocs_cmu)OCS_CMUocs_cmulast updated 27 Nov 2018429 tcpOCS_AMU IANA assigned this well-formed service name as a replacement for "ocs_amu".ocs-amulast updated 27 Nov 2018429 tcp (ocs_amu)OCS_AMUocs_amulast updated 27 Nov 2018429 udpOCS_AMU IANA assigned this well-formed service name as a replacement for "ocs_amu".ocs-amulast updated 27 Nov 2018429 udp (ocs_amu)OCS_AMUocs_amulast updated 27 Nov 2018430 tcpUTMPSDutmpsdlast updated 27 Nov 2018430 udpUTMPSDutmpsdlast updated 27 Nov 2018431 tcpUTMPCDutmpcdlast updated 27 Nov 2018431 udpUTMPCDutmpcdlast updated 27 Nov 2018432 tcpIASDiasdlast updated 27 Nov 2018432 udpIASDiasdlast updated 27 Nov 2018433 tcpNNTP for transit servers (NNSP)nnsplast updated 27 Nov 2018433 udpNNTP for transit servers (NNSP)nnsplast updated 27 Nov 2018434 tcpMobileIP-Agentmobileip-agentlast updated 27 Nov 2018434 udpMobileIP-Agentmobileip-agentlast updated 27 Nov 2018435 tcpMobilIP-MNmobilip-mnlast updated 27 Nov 2018435 udpMobilIP-MNmobilip-mnlast updated 27 Nov 2018436 tcpDNA-CMLdna-cmllast updated 27 Nov 2018436 udpDNA-CMLdna-cmllast updated 27 Nov 2018437 tcpcomscmcomscmlast updated 27 Nov 2018437 udpcomscmcomscmlast updated 27 Nov 2018438 tcpdsfgwdsfgwlast updated 27 Nov 2018438 udpdsfgwdsfgwlast updated 27 Nov 2018439 tcpdaspdasplast updated 27 Nov 2018439 udpdaspdasplast updated 27 Nov 2018440 tcpsgcpsgcplast updated 27 Nov 2018440 udpsgcpsgcplast updated 27 Nov 2018441 tcpdecvms-sysmgtdecvms-sysmgtlast updated 27 Nov 2018441 udpdecvms-sysmgtdecvms-sysmgtlast updated 27 Nov 2018442 tcpcvc_hostd IANA assigned this well-formed service name as a replacement for "cvc_hostd".cvc-hostdlast updated 27 Nov 2018442 tcp (cvc_hostd)cvc_hostdcvc_hostdlast updated 27 Nov 2018442 udpcvc_hostd IANA assigned this well-formed service name as a replacement for "cvc_hostd".cvc-hostdlast updated 27 Nov 2018442 udp (cvc_hostd)cvc_hostdcvc_hostdlast updated 27 Nov 2018443 tcphttp protocol over TLS/SSLhttpslast updated 27 Nov 2018443 udphttp protocol over TLS/SSLhttpslast updated 27 Nov 2018443 sctpHTTPShttpslast updated 27 Nov 2018444 tcpSimple Network Paging Protocolsnpplast updated 27 Nov 2018444 udpSimple Network Paging Protocolsnpplast updated 27 Nov 2018445 tcpMicrosoft-DSmicrosoft-dslast updated 27 Nov 2018445 udpMicrosoft-DSmicrosoft-dslast updated 27 Nov 2018446 tcpDDM-Remote Relational Database Accessddm-rdblast updated 27 Nov 2018446 udpDDM-Remote Relational Database Accessddm-rdblast updated 27 Nov 2018447 tcpDDM-Distributed File Managementddm-dfmlast updated 27 Nov 2018447 udpDDM-Distributed File Managementddm-dfmlast updated 27 Nov 2018448 tcpDDM-Remote DB Access Using Secure Socketsddm-ssllast updated 27 Nov 2018448 udpDDM-Remote DB Access Using Secure Socketsddm-ssllast updated 27 Nov 2018449 tcpAS Server Mapperas-servermaplast updated 27 Nov 2018449 udpAS Server Mapperas-servermaplast updated 27 Nov 2018450 tcpComputer Supported Telecomunication Applicationstserverlast updated 27 Nov 2018450 udpComputer Supported Telecomunication Applicationstserverlast updated 27 Nov 2018451 tcpCray Network Semaphore serversfs-smp-netlast updated 27 Nov 2018451 udpCray Network Semaphore serversfs-smp-netlast updated 27 Nov 2018452 tcpCray SFS config serversfs-configlast updated 27 Nov 2018452 udpCray SFS config serversfs-configlast updated 27 Nov 2018453 tcpCreativeServercreativeserverlast updated 27 Nov 2018453 udpCreativeServercreativeserverlast updated 27 Nov 2018454 tcpContentServercontentserverlast updated 27 Nov 2018454 udpContentServercontentserverlast updated 27 Nov 2018455 tcpCreativePartnrcreativepartnrlast updated 27 Nov 2018455 udpCreativePartnrcreativepartnrlast updated 27 Nov 2018456 tcpmacon-tcpmacon-tcplast updated 27 Nov 2018456 udpmacon-udpmacon-udplast updated 27 Nov 2018457 tcpscohelpscohelplast updated 27 Nov 2018457 udpscohelpscohelplast updated 27 Nov 2018458 tcpapple quick timeappleqtclast updated 27 Nov 2018458 udpapple quick timeappleqtclast updated 27 Nov 2018459 tcpampr-rcmdampr-rcmdlast updated 27 Nov 2018459 udpampr-rcmdampr-rcmdlast updated 27 Nov 2018460 tcpskronkskronklast updated 27 Nov 2018460 udpskronkskronklast updated 27 Nov 2018461 tcpDataRampSrvdatasurfsrvlast updated 27 Nov 2018461 udpDataRampSrvdatasurfsrvlast updated 27 Nov 2018462 tcpDataRampSrvSecdatasurfsrvseclast updated 27 Nov 2018462 udpDataRampSrvSecdatasurfsrvseclast updated 27 Nov 2018463 tcpalpesalpeslast updated 27 Nov 2018463 udpalpesalpeslast updated 27 Nov 2018464 tcpkpasswdkpasswdlast updated 27 Nov 2018464 udpkpasswdkpasswdlast updated 27 Nov 2018465 tcp (urd)URL Rendezvous Directory for SSMurdlast updated 27 Nov 2018465 tcpMessage Submission over TLS protocolsubmissionslast updated 27 Nov 2018465 udpIGMP over UDP for SSMigmpv3litelast updated 27 Nov 2018466 tcpdigital-vrcdigital-vrclast updated 27 Nov 2018466 udpdigital-vrcdigital-vrclast updated 27 Nov 2018467 tcpmylex-mapdmylex-mapdlast updated 27 Nov 2018467 udpmylex-mapdmylex-mapdlast updated 27 Nov 2018468 tcpproturisphoturislast updated 27 Nov 2018468 udpproturisphoturislast updated 27 Nov 2018469 tcpRadio Control Protocolrcplast updated 27 Nov 2018469 udpRadio Control Protocolrcplast updated 27 Nov 2018470 tcpscx-proxyscx-proxylast updated 27 Nov 2018470 udpscx-proxyscx-proxylast updated 27 Nov 2018471 tcpMondexmondexlast updated 27 Nov 2018471 udpMondexmondexlast updated 27 Nov 2018472 tcpljk-loginljk-loginlast updated 27 Nov 2018472 udpljk-loginljk-loginlast updated 27 Nov 2018473 tcphybrid-pophybrid-poplast updated 27 Nov 2018473 udphybrid-pophybrid-poplast updated 27 Nov 2018474 tcptn-tl-w1tn-tl-w1last updated 27 Nov 2018474 udptn-tl-w2tn-tl-w2last updated 27 Nov 2018475 tcptcpnethaspsrvtcpnethaspsrvlast updated 27 Nov 2018475 udptcpnethaspsrvtcpnethaspsrvlast updated 27 Nov 2018476 tcptn-tl-fd1tn-tl-fd1last updated 27 Nov 2018476 udptn-tl-fd1tn-tl-fd1last updated 27 Nov 2018477 tcpss7nsss7nslast updated 27 Nov 2018477 udpss7nsss7nslast updated 27 Nov 2018478 tcpspscspsclast updated 27 Nov 2018478 udpspscspsclast updated 27 Nov 2018479 tcpiafserveriafserverlast updated 27 Nov 2018479 udpiafserveriafserverlast updated 27 Nov 2018480 tcpiafdbaseiafdbaselast updated 27 Nov 2018480 udpiafdbaseiafdbaselast updated 27 Nov 2018481 tcpPh servicephlast updated 27 Nov 2018481 udpPh servicephlast updated 27 Nov 2018482 tcpbgs-nsibgs-nsilast updated 27 Nov 2018482 udpbgs-nsibgs-nsilast updated 27 Nov 2018483 tcpulpnetulpnetlast updated 27 Nov 2018483 udpulpnetulpnetlast updated 27 Nov 2018484 tcpIntegra Software Management Environmentintegra-smelast updated 27 Nov 2018484 udpIntegra Software Management Environmentintegra-smelast updated 27 Nov 2018485 tcpAir Soft Power Burstpowerburstlast updated 27 Nov 2018485 udpAir Soft Power Burstpowerburstlast updated 27 Nov 2018486 tcpavianavianlast updated 27 Nov 2018486 udpavianavianlast updated 27 Nov 2018487 tcpsaft Simple Asynchronous File Transfersaftlast updated 27 Nov 2018487 udpsaft Simple Asynchronous File Transfersaftlast updated 27 Nov 2018488 tcpgss-httpgss-httplast updated 27 Nov 2018488 udpgss-httpgss-httplast updated 27 Nov 2018489 tcpnest-protocolnest-protocollast updated 27 Nov 2018489 udpnest-protocolnest-protocollast updated 27 Nov 2018490 tcpmicom-pfsmicom-pfslast updated 27 Nov 2018490 udpmicom-pfsmicom-pfslast updated 27 Nov 2018491 tcpgo-logingo-loginlast updated 27 Nov 2018491 udpgo-logingo-loginlast updated 27 Nov 2018492 tcpTransport Independent Convergence for FNAticf-1last updated 27 Nov 2018492 udpTransport Independent Convergence for FNAticf-1last updated 27 Nov 2018493 tcpTransport Independent Convergence for FNAticf-2last updated 27 Nov 2018493 udpTransport Independent Convergence for FNAticf-2last updated 27 Nov 2018494 tcpPOV-Raypov-raylast updated 27 Nov 2018494 udpPOV-Raypov-raylast updated 27 Nov 2018495 tcpintecourierintecourierlast updated 27 Nov 2018495 udpintecourierintecourierlast updated 27 Nov 2018496 tcpPIM-RP-DISCpim-rp-disclast updated 27 Nov 2018496 udpPIM-RP-DISCpim-rp-disclast updated 27 Nov 2018497 tcpRetrospect backup and restore serviceretrospectlast updated 27 Nov 2018497 udpRetrospect backup and restore serviceretrospectlast updated 27 Nov 2018498 tcpsiamsiamlast updated 27 Nov 2018498 udpsiamsiamlast updated 27 Nov 2018499 tcpISO ILL Protocoliso-illlast updated 27 Nov 2018499 udpISO ILL Protocoliso-illlast updated 27 Nov 2018500 tcpisakmpisakmplast updated 27 Nov 2018500 udpisakmpisakmplast updated 27 Nov 2018501 tcpSTMFstmflast updated 27 Nov 2018501 udpSTMFstmflast updated 27 Nov 2018502 tcpModbus Application Protocolmbaplast updated 27 Nov 2018502 udpModbus Application Protocolmbaplast updated 27 Nov 2018503 tcpIntrinsaintrinsalast updated 27 Nov 2018503 udpIntrinsaintrinsalast updated 27 Nov 2018504 tcpcitadelcitadellast updated 27 Nov 2018504 udpcitadelcitadellast updated 27 Nov 2018505 tcpmailbox-lmmailbox-lmlast updated 27 Nov 2018505 udpmailbox-lmmailbox-lmlast updated 27 Nov 2018506 tcpohimsrvohimsrvlast updated 27 Nov 2018506 udpohimsrvohimsrvlast updated 27 Nov 2018507 tcpcrscrslast updated 27 Nov 2018507 udpcrscrslast updated 27 Nov 2018508 tcpxvttpxvttplast updated 27 Nov 2018508 udpxvttpxvttplast updated 27 Nov 2018509 tcpsnaresnarelast updated 27 Nov 2018509 udpsnaresnarelast updated 27 Nov 2018510 tcpFirstClass Protocolfcplast updated 27 Nov 2018510 udpFirstClass Protocolfcplast updated 27 Nov 2018511 tcpPassGopassgolast updated 27 Nov 2018511 udpPassGopassgolast updated 27 Nov 2018512 tcpremote process execution; authentication performed using passwords and UNIX login namesexeclast updated 27 Nov 2018512 udp-comsatlast updated 27 Nov 2018512 udp (biff)used by mail system to notify users of new mail received; currently receives messages only from processes on the same machinebifflast updated 27 Nov 2018513 tcpremote login a la telnet; automatic authentication performed based on priviledged port numbers and distributed data bases which identify "authentication domains"loginlast updated 27 Nov 2018513 udpmaintains data bases showing who's logged in to machines on a local net and the load average of the machinewholast updated 27 Nov 2018514 tcpcmd like exec, but automatic authentication is performed as for login servershelllast updated 27 Nov 2018514 udp-sysloglast updated 27 Nov 2018515 tcpspoolerprinterlast updated 27 Nov 2018515 udpspoolerprinterlast updated 27 Nov 2018516 tcpvideotexvideotexlast updated 27 Nov 2018516 udpvideotexvideotexlast updated 27 Nov 2018517 tcplike tenex link, but across machine - unfortunately, doesn't use link protocol (this is actually just a rendezvous port from which a tcp connection is established)talklast updated 27 Nov 2018517 udplike tenex link, but across machine - unfortunately, doesn't use link protocol (this is actually just a rendezvous port from which a tcp connection is established)talklast updated 27 Nov 2018518 tcp-ntalklast updated 27 Nov 2018518 udp-ntalklast updated 27 Nov 2018519 tcpunixtimeutimelast updated 27 Nov 2018519 udpunixtimeutimelast updated 27 Nov 2018520 tcpextended file name serverefslast updated 27 Nov 2018520 udplocal routing process (on site); uses variant of Xerox NS routing information protocol - RIProuterlast updated 27 Nov 2018521 tcpripngripnglast updated 27 Nov 2018521 udpripngripnglast updated 27 Nov 2018522 tcpULPulplast updated 27 Nov 2018522 udpULPulplast updated 27 Nov 2018523 tcpIBM-DB2ibm-db2last updated 27 Nov 2018523 udpIBM-DB2ibm-db2last updated 27 Nov 2018524 tcpNCPncplast updated 27 Nov 2018524 udpNCPncplast updated 27 Nov 2018525 tcptimeservertimedlast updated 27 Nov 2018525 udptimeservertimedlast updated 27 Nov 2018526 tcpnewdatetempolast updated 27 Nov 2018526 udpnewdatetempolast updated 27 Nov 2018527 tcpStock IXChangestxlast updated 27 Nov 2018527 udpStock IXChangestxlast updated 27 Nov 2018528 tcpCustomer IXChangecustixlast updated 27 Nov 2018528 udpCustomer IXChangecustixlast updated 27 Nov 2018529 tcpIRC-SERVirc-servlast updated 27 Nov 2018529 udpIRC-SERVirc-servlast updated 27 Nov 2018530 tcprpccourierlast updated 27 Nov 2018530 udprpccourierlast updated 27 Nov 2018531 tcpchatconferencelast updated 27 Nov 2018531 udpchatconferencelast updated 27 Nov 2018532 tcpreadnewsnetnewslast updated 27 Nov 2018532 udpreadnewsnetnewslast updated 27 Nov 2018533 tcpfor emergency broadcastsnetwalllast updated 27 Nov 2018533 udpfor emergency broadcastsnetwalllast updated 27 Nov 2018534 tcpwindream Adminwindreamlast updated 27 Nov 2018534 udpwindream Adminwindreamlast updated 27 Nov 2018535 tcpiiopiioplast updated 27 Nov 2018535 udpiiopiioplast updated 27 Nov 2018536 tcpopalis-rdvopalis-rdvlast updated 27 Nov 2018536 udpopalis-rdvopalis-rdvlast updated 27 Nov 2018537 tcpNetworked Media Streaming Protocolnmsplast updated 27 Nov 2018537 udpNetworked Media Streaming Protocolnmsplast updated 27 Nov 2018538 tcpgdomapgdomaplast updated 27 Nov 2018538 udpgdomapgdomaplast updated 27 Nov 2018539 tcpApertus Technologies Load Determinationapertus-ldplast updated 27 Nov 2018539 udpApertus Technologies Load Determinationapertus-ldplast updated 27 Nov 2018540 tcpuucpduucplast updated 27 Nov 2018540 udpuucpduucplast updated 27 Nov 2018541 tcpuucp-rloginuucp-rloginlast updated 27 Nov 2018541 udpuucp-rloginuucp-rloginlast updated 27 Nov 2018542 tcpcommercecommercelast updated 27 Nov 2018542 udpcommercecommercelast updated 27 Nov 2018543 tcp-kloginlast updated 27 Nov 2018543 udp-kloginlast updated 27 Nov 2018544 tcpkrcmdkshelllast updated 27 Nov 2018544 udpkrcmdkshelllast updated 27 Nov 2018545 tcpappleqtcsrvrappleqtcsrvrlast updated 27 Nov 2018545 udpappleqtcsrvrappleqtcsrvrlast updated 27 Nov 2018546 tcpDHCPv6 Clientdhcpv6-clientlast updated 27 Nov 2018546 udpDHCPv6 Clientdhcpv6-clientlast updated 27 Nov 2018547 tcpDHCPv6 Serverdhcpv6-serverlast updated 27 Nov 2018547 udpDHCPv6 Serverdhcpv6-serverlast updated 27 Nov 2018548 tcpAFP over TCPafpovertcplast updated 27 Nov 2018548 udpAFP over TCPafpovertcplast updated 27 Nov 2018549 tcpIDFPidfplast updated 27 Nov 2018549 udpIDFPidfplast updated 27 Nov 2018550 tcpnew-whonew-rwholast updated 27 Nov 2018550 udpnew-whonew-rwholast updated 27 Nov 2018551 tcpcybercashcybercashlast updated 27 Nov 2018551 udpcybercashcybercashlast updated 27 Nov 2018552 tcpDeviceSharedevshr-ntslast updated 27 Nov 2018552 udpDeviceSharedevshr-ntslast updated 27 Nov 2018553 tcppirppirplast updated 27 Nov 2018553 udppirppirplast updated 27 Nov 2018554 tcpReal Time Streaming Protocol (RTSP)rtsplast updated 27 Nov 2018554 udpReal Time Streaming Protocol (RTSP)rtsplast updated 27 Nov 2018555 tcp-dsflast updated 27 Nov 2018555 udp-dsflast updated 27 Nov 2018556 tcprfs serverremotefslast updated 27 Nov 2018556 udprfs serverremotefslast updated 27 Nov 2018557 tcpopenvms-sysipcopenvms-sysipclast updated 27 Nov 2018557 udpopenvms-sysipcopenvms-sysipclast updated 27 Nov 2018558 tcpSDNSKMPsdnskmplast updated 27 Nov 2018558 udpSDNSKMPsdnskmplast updated 27 Nov 2018559 tcpTEEDTAPteedtaplast updated 27 Nov 2018559 udpTEEDTAPteedtaplast updated 27 Nov 2018560 tcprmonitordrmonitorlast updated 27 Nov 2018560 udprmonitordrmonitorlast updated 27 Nov 2018561 tcp-monitorlast updated 27 Nov 2018561 udp-monitorlast updated 27 Nov 2018562 tcpchcmdchshelllast updated 27 Nov 2018562 udpchcmdchshelllast updated 27 Nov 2018563 tcpnntp protocol over TLS/SSL (was snntp)nntpslast updated 27 Nov 2018563 udpnntp protocol over TLS/SSL (was snntp)nntpslast updated 27 Nov 2018564 tcpplan 9 file service9pfslast updated 27 Nov 2018564 udpplan 9 file service9pfslast updated 27 Nov 2018565 tcpwhoamiwhoamilast updated 27 Nov 2018565 udpwhoamiwhoamilast updated 27 Nov 2018566 tcpstreettalkstreettalklast updated 27 Nov 2018566 udpstreettalkstreettalklast updated 27 Nov 2018567 tcpbanyan-rpcbanyan-rpclast updated 27 Nov 2018567 udpbanyan-rpcbanyan-rpclast updated 27 Nov 2018568 tcpmicrosoft shuttlems-shuttlelast updated 27 Nov 2018568 udpmicrosoft shuttlems-shuttlelast updated 27 Nov 2018569 tcpmicrosoft romems-romelast updated 27 Nov 2018569 udpmicrosoft romems-romelast updated 27 Nov 2018570 tcpdemonmeterlast updated 27 Nov 2018570 udpdemonmeterlast updated 27 Nov 2018571 tcpudemonmeterlast updated 27 Nov 2018571 udpudemonmeterlast updated 27 Nov 2018572 tcpsonarsonarlast updated 27 Nov 2018572 udpsonarsonarlast updated 27 Nov 2018573 tcpbanyan-vipbanyan-viplast updated 27 Nov 2018573 udpbanyan-vipbanyan-viplast updated 27 Nov 2018574 tcpFTP Software Agent Systemftp-agentlast updated 27 Nov 2018574 udpFTP Software Agent Systemftp-agentlast updated 27 Nov 2018575 tcpVEMMIvemmilast updated 27 Nov 2018575 udpVEMMIvemmilast updated 27 Nov 2018576 tcpipcdipcdlast updated 27 Nov 2018576 udpipcdipcdlast updated 27 Nov 2018577 tcpvnasvnaslast updated 27 Nov 2018577 udpvnasvnaslast updated 27 Nov 2018578 tcpipddipddlast updated 27 Nov 2018578 udpipddipddlast updated 27 Nov 2018579 tcpdecbsrvdecbsrvlast updated 27 Nov 2018579 udpdecbsrvdecbsrvlast updated 27 Nov 2018580 tcpSNTP HEARTBEATsntp-heartbeatlast updated 27 Nov 2018580 udpSNTP HEARTBEATsntp-heartbeatlast updated 27 Nov 2018581 tcpBundle Discovery Protocolbdplast updated 27 Nov 2018581 udpBundle Discovery Protocolbdplast updated 27 Nov 2018582 tcpSCC Securityscc-securitylast updated 27 Nov 2018582 udpSCC Securityscc-securitylast updated 27 Nov 2018583 tcpPhilips Video-Conferencingphilips-vclast updated 27 Nov 2018583 udpPhilips Video-Conferencingphilips-vclast updated 27 Nov 2018584 tcpKey Serverkeyserverlast updated 27 Nov 2018584 udpKey Serverkeyserverlast updated 27 Nov 2018585 De-registeredN/Alast updated 27 Nov 2018586 tcpPassword Changepassword-chglast updated 27 Nov 2018586 udpPassword Changepassword-chglast updated 27 Nov 2018587 tcpMessage Submissionsubmissionlast updated 27 Nov 2018587 udpMessage Submissionsubmissionlast updated 27 Nov 2018588 tcpCALcallast updated 27 Nov 2018588 udpCALcallast updated 27 Nov 2018589 tcpEyeLinkeyelinklast updated 27 Nov 2018589 udpEyeLinkeyelinklast updated 27 Nov 2018590 tcpTNS CMLtns-cmllast updated 27 Nov 2018590 udpTNS CMLtns-cmllast updated 27 Nov 2018591 tcpFileMaker, Inc. - HTTP Alternate (see Port 80)http-altlast updated 27 Nov 2018591 udpFileMaker, Inc. - HTTP Alternate (see Port 80)http-altlast updated 27 Nov 2018592 tcpEudora Seteudora-setlast updated 27 Nov 2018592 udpEudora Seteudora-setlast updated 27 Nov 2018593 tcpHTTP RPC Ep Maphttp-rpc-epmaplast updated 27 Nov 2018593 udpHTTP RPC Ep Maphttp-rpc-epmaplast updated 27 Nov 2018594 tcpTPIPtpiplast updated 27 Nov 2018594 udpTPIPtpiplast updated 27 Nov 2018595 tcpCAB Protocolcab-protocollast updated 27 Nov 2018595 udpCAB Protocolcab-protocollast updated 27 Nov 2018596 tcpSMSDsmsdlast updated 27 Nov 2018596 udpSMSDsmsdlast updated 27 Nov 2018597 tcpPTC Name Serviceptcnameservicelast updated 27 Nov 2018597 udpPTC Name Serviceptcnameservicelast updated 27 Nov 2018598 tcpSCO Web Server Manager 3sco-websrvrmg3last updated 27 Nov 2018598 udpSCO Web Server Manager 3sco-websrvrmg3last updated 27 Nov 2018599 tcpAeolon Core Protocolacplast updated 27 Nov 2018599 udpAeolon Core Protocolacplast updated 27 Nov 2018600 tcpSun IPC serveripcserverlast updated 27 Nov 2018600 udpSun IPC serveripcserverlast updated 27 Nov 2018601 tcpReliable Syslog Servicesyslog-connlast updated 27 Nov 2018601 udpReliable Syslog Servicesyslog-connlast updated 27 Nov 2018602 tcpXML-RPC over BEEPxmlrpc-beeplast updated 27 Nov 2018602 udpXML-RPC over BEEPxmlrpc-beeplast updated 27 Nov 2018603 tcpIDXPidxplast updated 27 Nov 2018603 udpIDXPidxplast updated 27 Nov 2018604 tcpTUNNELtunnellast updated 27 Nov 2018604 udpTUNNELtunnellast updated 27 Nov 2018605 tcpSOAP over BEEPsoap-beeplast updated 27 Nov 2018605 udpSOAP over BEEPsoap-beeplast updated 27 Nov 2018606 tcpCray Unified Resource Managerurmlast updated 27 Nov 2018606 udpCray Unified Resource Managerurmlast updated 27 Nov 2018607 tcpnqsnqslast updated 27 Nov 2018607 udpnqsnqslast updated 27 Nov 2018608 tcpSender-Initiated/Unsolicited File Transfersift-uftlast updated 27 Nov 2018608 udpSender-Initiated/Unsolicited File Transfersift-uftlast updated 27 Nov 2018609 tcpnpmp-trapnpmp-traplast updated 27 Nov 2018609 udpnpmp-trapnpmp-traplast updated 27 Nov 2018610 tcpnpmp-localnpmp-locallast updated 27 Nov 2018610 udpnpmp-localnpmp-locallast updated 27 Nov 2018611 tcpnpmp-guinpmp-guilast updated 27 Nov 2018611 udpnpmp-guinpmp-guilast updated 27 Nov 2018612 tcpHMMP Indicationhmmp-indlast updated 27 Nov 2018612 udpHMMP Indicationhmmp-indlast updated 27 Nov 2018613 tcpHMMP Operationhmmp-oplast updated 27 Nov 2018613 udpHMMP Operationhmmp-oplast updated 27 Nov 2018614 tcpSSLshellsshelllast updated 27 Nov 2018614 udpSSLshellsshelllast updated 27 Nov 2018615 tcpInternet Configuration Managersco-inetmgrlast updated 27 Nov 2018615 udpInternet Configuration Managersco-inetmgrlast updated 27 Nov 2018616 tcpSCO System Administration Serversco-sysmgrlast updated 27 Nov 2018616 udpSCO System Administration Serversco-sysmgrlast updated 27 Nov 2018617 tcpSCO Desktop Administration Serversco-dtmgrlast updated 27 Nov 2018617 udpSCO Desktop Administration Serversco-dtmgrlast updated 27 Nov 2018618 tcpDEI-ICDAdei-icdalast updated 27 Nov 2018618 udpDEI-ICDAdei-icdalast updated 27 Nov 2018619 tcpCompaq EVMcompaq-evmlast updated 27 Nov 2018619 udpCompaq EVMcompaq-evmlast updated 27 Nov 2018620 tcpSCO WebServer Managersco-websrvrmgrlast updated 27 Nov 2018620 udpSCO WebServer Managersco-websrvrmgrlast updated 27 Nov 2018621 tcpESCPescp-iplast updated 27 Nov 2018621 udpESCPescp-iplast updated 27 Nov 2018622 tcpCollaboratorcollaboratorlast updated 27 Nov 2018622 udpCollaboratorcollaboratorlast updated 27 Nov 2018623 tcpDMTF out-of-band web services management protocoloob-ws-httplast updated 27 Nov 2018623 udpASF Remote Management and Control Protocolasf-rmcplast updated 27 Nov 2018624 tcpCrypto Admincryptoadminlast updated 27 Nov 2018624 udpCrypto Admincryptoadminlast updated 27 Nov 2018625 tcpDEC DLM IANA assigned this well-formed service name as a replacement for "dec_dlm".dec-dlmlast updated 27 Nov 2018625 tcp (dec_dlm)DEC DLMdec_dlmlast updated 27 Nov 2018625 udpDEC DLM IANA assigned this well-formed service name as a replacement for "dec_dlm".dec-dlmlast updated 27 Nov 2018625 udp (dec_dlm)DEC DLMdec_dlmlast updated 27 Nov 2018626 tcpASIAasialast updated 27 Nov 2018626 udpASIAasialast updated 27 Nov 2018627 tcpPassGo Tivolipassgo-tivolilast updated 27 Nov 2018627 udpPassGo Tivolipassgo-tivolilast updated 27 Nov 2018628 tcpQMQPqmqplast updated 27 Nov 2018628 udpQMQPqmqplast updated 27 Nov 2018629 tcp3Com AMP33com-amp3last updated 27 Nov 2018629 udp3Com AMP33com-amp3last updated 27 Nov 2018630 tcpRDArdalast updated 27 Nov 2018630 udpRDArdalast updated 27 Nov 2018631 tcpIPP (Internet Printing Protocol)ipplast updated 27 Nov 2018631 udpIPP (Internet Printing Protocol)ipplast updated 27 Nov 2018631 tcp (ipps)Internet Printing Protocol over HTTPSippslast updated 27 Nov 2018632 tcpbmppbmpplast updated 27 Nov 2018632 udpbmppbmpplast updated 27 Nov 2018633 tcpService Status update (Sterling Software)servstatlast updated 27 Nov 2018633 udpService Status update (Sterling Software)servstatlast updated 27 Nov 2018634 tcpginadginadlast updated 27 Nov 2018634 udpginadginadlast updated 27 Nov 2018635 tcpRLZ DBaserlzdbaselast updated 27 Nov 2018635 udpRLZ DBaserlzdbaselast updated 27 Nov 2018636 tcpldap protocol over TLS/SSL (was sldap)ldapslast updated 27 Nov 2018636 udpldap protocol over TLS/SSL (was sldap)ldapslast updated 27 Nov 2018637 tcplanserverlanserverlast updated 27 Nov 2018637 udplanserverlanserverlast updated 27 Nov 2018638 tcpmcns-secmcns-seclast updated 27 Nov 2018638 udpmcns-secmcns-seclast updated 27 Nov 2018639 tcpMSDPmsdplast updated 27 Nov 2018639 udpMSDPmsdplast updated 27 Nov 2018640 tcpentrust-spsentrust-spslast updated 27 Nov 2018640 udpentrust-spsentrust-spslast updated 27 Nov 2018641 tcprepcmdrepcmdlast updated 27 Nov 2018641 udprepcmdrepcmdlast updated 27 Nov 2018642 tcpESRO-EMSDP V1.3esro-emsdplast updated 27 Nov 2018642 udpESRO-EMSDP V1.3esro-emsdplast updated 27 Nov 2018643 tcpSANitysanitylast updated 27 Nov 2018643 udpSANitysanitylast updated 27 Nov 2018644 tcpdwrdwrlast updated 27 Nov 2018644 udpdwrdwrlast updated 27 Nov 2018645 tcpPSSCpssclast updated 27 Nov 2018645 udpPSSCpssclast updated 27 Nov 2018646 tcpLDPldplast updated 27 Nov 2018646 udpLDPldplast updated 27 Nov 2018647 tcpDHCP Failoverdhcp-failoverlast updated 27 Nov 2018647 udpDHCP Failoverdhcp-failoverlast updated 27 Nov 2018648 tcpRegistry Registrar Protocol (RRP)rrplast updated 27 Nov 2018648 udpRegistry Registrar Protocol (RRP)rrplast updated 27 Nov 2018649 tcpCadview-3d - streaming 3d models over the internetcadview-3dlast updated 27 Nov 2018649 udpCadview-3d - streaming 3d models over the internetcadview-3dlast updated 27 Nov 2018650 tcpOBEXobexlast updated 27 Nov 2018650 udpOBEXobexlast updated 27 Nov 2018651 tcpIEEE MMSieee-mmslast updated 27 Nov 2018651 udpIEEE MMSieee-mmslast updated 27 Nov 2018652 tcpHELLO_PORThello-portlast updated 27 Nov 2018652 udpHELLO_PORThello-portlast updated 27 Nov 2018653 tcpRepCmdrepscmdlast updated 27 Nov 2018653 udpRepCmdrepscmdlast updated 27 Nov 2018654 tcpAODVaodvlast updated 27 Nov 2018654 udpAODVaodvlast updated 27 Nov 2018655 tcpTINCtinclast updated 27 Nov 2018655 udpTINCtinclast updated 27 Nov 2018656 tcpSPMPspmplast updated 27 Nov 2018656 udpSPMPspmplast updated 27 Nov 2018657 tcpRMCrmclast updated 27 Nov 2018657 udpRMCrmclast updated 27 Nov 2018658 tcpTenFoldtenfoldlast updated 27 Nov 2018658 udpTenFoldtenfoldlast updated 27 Nov 2018659 RemovedN/Alast updated 27 Nov 2018660 tcpMacOS Server Adminmac-srvr-adminlast updated 27 Nov 2018660 udpMacOS Server Adminmac-srvr-adminlast updated 27 Nov 2018661 tcpHAPhaplast updated 27 Nov 2018661 udpHAPhaplast updated 27 Nov 2018662 tcpPFTPpftplast updated 27 Nov 2018662 udpPFTPpftplast updated 27 Nov 2018663 tcpPureNoisepurenoiselast updated 27 Nov 2018663 udpPureNoisepurenoiselast updated 27 Nov 2018664 tcpDMTF out-of-band secure web services management protocoloob-ws-httpslast updated 27 Nov 2018664 udpASF Secure Remote Management and Control Protocolasf-secure-rmcplast updated 27 Nov 2018665 tcpSun DRsun-drlast updated 27 Nov 2018665 udpSun DRsun-drlast updated 27 Nov 2018666 tcp-mdqslast updated 27 Nov 2018666 udp-mdqslast updated 27 Nov 2018666 tcp (doom)doom Id Softwaredoomlast updated 27 Nov 2018666 udp (doom)doom Id Softwaredoomlast updated 27 Nov 2018667 tcpcampaign contribution disclosures - SDR Technologiesdiscloselast updated 27 Nov 2018667 udpcampaign contribution disclosures - SDR Technologiesdiscloselast updated 27 Nov 2018668 tcpMeCommmecommlast updated 27 Nov 2018668 udpMeCommmecommlast updated 27 Nov 2018669 tcpMeRegistermeregisterlast updated 27 Nov 2018669 udpMeRegistermeregisterlast updated 27 Nov 2018670 tcpVACDSM-SWSvacdsm-swslast updated 27 Nov 2018670 udpVACDSM-SWSvacdsm-swslast updated 27 Nov 2018671 tcpVACDSM-APPvacdsm-applast updated 27 Nov 2018671 udpVACDSM-APPvacdsm-applast updated 27 Nov 2018672 tcpVPPS-QUAvpps-qualast updated 27 Nov 2018672 udpVPPS-QUAvpps-qualast updated 27 Nov 2018673 tcpCIMPLEXcimplexlast updated 27 Nov 2018673 udpCIMPLEXcimplexlast updated 27 Nov 2018674 tcpACAPacaplast updated 27 Nov 2018674 udpACAPacaplast updated 27 Nov 2018675 tcpDCTPdctplast updated 27 Nov 2018675 udpDCTPdctplast updated 27 Nov 2018676 tcpVPPS Viavpps-vialast updated 27 Nov 2018676 udpVPPS Viavpps-vialast updated 27 Nov 2018677 tcpVirtual Presence Protocolvpplast updated 27 Nov 2018677 udpVirtual Presence Protocolvpplast updated 27 Nov 2018678 tcpGNU Generation Foundation NCPggf-ncplast updated 27 Nov 2018678 udpGNU Generation Foundation NCPggf-ncplast updated 27 Nov 2018679 tcpMRMmrmlast updated 27 Nov 2018679 udpMRMmrmlast updated 27 Nov 2018680 tcpentrust-aaasentrust-aaaslast updated 27 Nov 2018680 udpentrust-aaasentrust-aaaslast updated 27 Nov 2018681 tcpentrust-aamsentrust-aamslast updated 27 Nov 2018681 udpentrust-aamsentrust-aamslast updated 27 Nov 2018682 tcpXFRxfrlast updated 27 Nov 2018682 udpXFRxfrlast updated 27 Nov 2018683 tcpCORBA IIOPcorba-iioplast updated 27 Nov 2018683 udpCORBA IIOPcorba-iioplast updated 27 Nov 2018684 tcpCORBA IIOP SSLcorba-iiop-ssllast updated 27 Nov 2018684 udpCORBA IIOP SSLcorba-iiop-ssllast updated 27 Nov 2018685 tcpMDC Port Mappermdc-portmapperlast updated 27 Nov 2018685 udpMDC Port Mappermdc-portmapperlast updated 27 Nov 2018686 tcpHardware Control Protocol Wismarhcp-wismarlast updated 27 Nov 2018686 udpHardware Control Protocol Wismarhcp-wismarlast updated 27 Nov 2018687 tcpasipregistryasipregistrylast updated 27 Nov 2018687 udpasipregistryasipregistrylast updated 27 Nov 2018688 tcpApplianceWare managment protocolrealm-rusdlast updated 27 Nov 2018688 udpApplianceWare managment protocolrealm-rusdlast updated 27 Nov 2018689 tcpNMAPnmaplast updated 27 Nov 2018689 udpNMAPnmaplast updated 27 Nov 2018690 tcpVelneo Application Transfer Protocolvatplast updated 27 Nov 2018690 udpVelneo Application Transfer Protocolvatplast updated 27 Nov 2018691 tcpMS Exchange Routingmsexch-routinglast updated 27 Nov 2018691 udpMS Exchange Routingmsexch-routinglast updated 27 Nov 2018692 tcpHyperwave-ISPhyperwave-isplast updated 27 Nov 2018692 udpHyperwave-ISPhyperwave-isplast updated 27 Nov 2018693 tcpalmanid Connection Endpointconnendplast updated 27 Nov 2018693 udpalmanid Connection Endpointconnendplast updated 27 Nov 2018694 tcpha-clusterha-clusterlast updated 27 Nov 2018694 udpha-clusterha-clusterlast updated 27 Nov 2018695 tcpIEEE-MMS-SSLieee-mms-ssllast updated 27 Nov 2018695 udpIEEE-MMS-SSLieee-mms-ssllast updated 27 Nov 2018696 tcpRUSHDrushdlast updated 27 Nov 2018696 udpRUSHDrushdlast updated 27 Nov 2018697 tcpUUIDGENuuidgenlast updated 27 Nov 2018697 udpUUIDGENuuidgenlast updated 27 Nov 2018698 tcpOLSRolsrlast updated 27 Nov 2018698 udpOLSRolsrlast updated 27 Nov 2018699 tcpAccess Networkaccessnetworklast updated 27 Nov 2018699 udpAccess Networkaccessnetworklast updated 27 Nov 2018700 tcpExtensible Provisioning Protocolepplast updated 27 Nov 2018700 udpExtensible Provisioning Protocolepplast updated 27 Nov 2018701 tcpLink Management Protocol (LMP)lmplast updated 27 Nov 2018701 udpLink Management Protocol (LMP)lmplast updated 27 Nov 2018702 tcpIRIS over BEEPiris-beeplast updated 27 Nov 2018702 udpIRIS over BEEPiris-beeplast updated 27 Nov 2018703 UnassignedN/Alast updated 27 Nov 2018704 tcperrlog copy/server daemonelcsdlast updated 27 Nov 2018704 udperrlog copy/server daemonelcsdlast updated 27 Nov 2018705 tcpAgentXagentxlast updated 27 Nov 2018705 udpAgentXagentxlast updated 27 Nov 2018706 tcpSILCsilclast updated 27 Nov 2018706 udpSILCsilclast updated 27 Nov 2018707 tcpBorland DSJborland-dsjlast updated 27 Nov 2018707 udpBorland DSJborland-dsjlast updated 27 Nov 2018708 UnassignedN/Alast updated 27 Nov 2018709 tcpEntrust Key Management Service Handlerentrust-kmshlast updated 27 Nov 2018709 udpEntrust Key Management Service Handlerentrust-kmshlast updated 27 Nov 2018710 tcpEntrust Administration Service Handlerentrust-ashlast updated 27 Nov 2018710 udpEntrust Administration Service Handlerentrust-ashlast updated 27 Nov 2018711 tcpCisco TDPcisco-tdplast updated 27 Nov 2018711 udpCisco TDPcisco-tdplast updated 27 Nov 2018712 tcpTBRPFtbrpflast updated 27 Nov 2018712 udpTBRPFtbrpflast updated 27 Nov 2018713 tcpIRIS over XPCiris-xpclast updated 27 Nov 2018713 udpIRIS over XPCiris-xpclast updated 27 Nov 2018714 tcpIRIS over XPCSiris-xpcslast updated 27 Nov 2018714 udpIRIS over XPCSiris-xpcslast updated 27 Nov 2018715 tcpIRIS-LWZiris-lwzlast updated 27 Nov 2018715 udpIRIS-LWZiris-lwzlast updated 27 Nov 2018716 udpPANA Messagespanalast updated 27 Nov 2018717-728 UnassignedN/Alast updated 27 Nov 2018729 tcpIBM NetView DM/6000 Server/Clientnetviewdm1last updated 27 Nov 2018729 udpIBM NetView DM/6000 Server/Clientnetviewdm1last updated 27 Nov 2018730 tcpIBM NetView DM/6000 send/tcpnetviewdm2last updated 27 Nov 2018730 udpIBM NetView DM/6000 send/tcpnetviewdm2last updated 27 Nov 2018731 tcpIBM NetView DM/6000 receive/tcpnetviewdm3last updated 27 Nov 2018731 udpIBM NetView DM/6000 receive/tcpnetviewdm3last updated 27 Nov 2018732-740 UnassignedN/Alast updated 27 Nov 2018741 tcpnetGWnetgwlast updated 27 Nov 2018741 udpnetGWnetgwlast updated 27 Nov 2018742 tcpNetwork based Rev. Cont. Sys.netrcslast updated 27 Nov 2018742 udpNetwork based Rev. Cont. Sys.netrcslast updated 27 Nov 2018743 UnassignedN/Alast updated 27 Nov 2018744 tcpFlexible License Managerflexlmlast updated 27 Nov 2018744 udpFlexible License Managerflexlmlast updated 27 Nov 2018745-746 UnassignedN/Alast updated 27 Nov 2018747 tcpFujitsu Device Controlfujitsu-devlast updated 27 Nov 2018747 udpFujitsu Device Controlfujitsu-devlast updated 27 Nov 2018748 tcpRussell Info Sci Calendar Managerris-cmlast updated 27 Nov 2018748 udpRussell Info Sci Calendar Managerris-cmlast updated 27 Nov 2018749 tcpkerberos administrationkerberos-admlast updated 27 Nov 2018749 udpkerberos administrationkerberos-admlast updated 27 Nov 2018750 tcp-rfilelast updated 27 Nov 2018750 udp-loadavlast updated 27 Nov 2018750 udp (kerberos-iv)kerberos version ivkerberos-ivlast updated 27 Nov 2018751 tcp-pumplast updated 27 Nov 2018751 udp-pumplast updated 27 Nov 2018752 tcp-qrhlast updated 27 Nov 2018752 udp-qrhlast updated 27 Nov 2018753 tcp-rrhlast updated 27 Nov 2018753 udp-rrhlast updated 27 Nov 2018754 tcpsendtelllast updated 27 Nov 2018754 udpsendtelllast updated 27 Nov 2018755-757 UnassignedN/Alast updated 27 Nov 2018758 tcp-nloginlast updated 27 Nov 2018758 udp-nloginlast updated 27 Nov 2018759 tcp-conlast updated 27 Nov 2018759 udp-conlast updated 27 Nov 2018760 tcp-nslast updated 27 Nov 2018760 udp-nslast updated 27 Nov 2018761 tcp-rxelast updated 27 Nov 2018761 udp-rxelast updated 27 Nov 2018762 tcp-quotadlast updated 27 Nov 2018762 udp-quotadlast updated 27 Nov 2018763 tcp-cycleservlast updated 27 Nov 2018763 udp-cycleservlast updated 27 Nov 2018764 tcp-omservlast updated 27 Nov 2018764 udp-omservlast updated 27 Nov 2018765 tcp-websterlast updated 27 Nov 2018765 udp-websterlast updated 27 Nov 2018766 UnassignedN/Alast updated 27 Nov 2018767 tcpphonephonebooklast updated 27 Nov 2018767 udpphonephonebooklast updated 27 Nov 2018768 UnassignedN/Alast updated 27 Nov 2018769 tcp-vidlast updated 27 Nov 2018769 udp-vidlast updated 27 Nov 2018770 tcp-cadlocklast updated 27 Nov 2018770 udp-cadlocklast updated 27 Nov 2018771 tcp-rtiplast updated 27 Nov 2018771 udp-rtiplast updated 27 Nov 2018772 tcp-cycleserv2last updated 27 Nov 2018772 udp-cycleserv2last updated 27 Nov 2018773 tcp-submitlast updated 27 Nov 2018773 udp-notifylast updated 27 Nov 2018774 tcp-rpasswdlast updated 27 Nov 2018774 udpIANA assigned this well-formed service name as a replacement for "acmaint_dbd".acmaint-dbdlast updated 27 Nov 2018774 udp (acmaint_dbd)-acmaint_dbdlast updated 27 Nov 2018775 tcp-entomblast updated 27 Nov 2018775 udpIANA assigned this well-formed service name as a replacement for "acmaint_transd".acmaint-transdlast updated 27 Nov 2018775 udp (acmaint_transd)-acmaint_transdlast updated 27 Nov 2018776 tcp-wpageslast updated 27 Nov 2018776 udp-wpageslast updated 27 Nov 2018777 tcpMultiling HTTPmultiling-httplast updated 27 Nov 2018777 udpMultiling HTTPmultiling-httplast updated 27 Nov 2018778-779 UnassignedN/Alast updated 27 Nov 2018780 tcp-wpgslast updated 27 Nov 2018780 udp-wpgslast updated 27 Nov 2018781-785 UnassignedN/Alast updated 27 Nov 2018786 UnassignedN/Alast updated 27 Nov 2018787 UnassignedN/Alast updated 27 Nov 2018788-799 UnassignedN/Alast updated 27 Nov 2018800 tcpIANA assigned this well-formed service name as a replacement for "mdbs_daemon".mdbs-daemonlast updated 27 Nov 2018800 tcp (mdbs_daemon)-mdbs_daemonlast updated 27 Nov 2018800 udpIANA assigned this well-formed service name as a replacement for "mdbs_daemon".mdbs-daemonlast updated 27 Nov 2018800 udp (mdbs_daemon)-mdbs_daemonlast updated 27 Nov 2018801 tcp-devicelast updated 27 Nov 2018801 udp-devicelast updated 27 Nov 2018802 tcpModbus Application Protocol Securembap-slast updated 27 Nov 2018802 udpModbus Application Protocol Securembap-slast updated 27 Nov 2018803-809 UnassignedN/Alast updated 27 Nov 2018810 tcpFCPfcp-udplast updated 27 Nov 2018810 udpFCP Datagramfcp-udplast updated 27 Nov 2018811-827 UnassignedN/Alast updated 27 Nov 2018828 tcpitm-mcell-sitm-mcell-slast updated 27 Nov 2018828 udpitm-mcell-sitm-mcell-slast updated 27 Nov 2018829 tcpPKIX-3 CA/RApkix-3-ca-ralast updated 27 Nov 2018829 udpPKIX-3 CA/RApkix-3-ca-ralast updated 27 Nov 2018830 tcpNETCONF over SSHnetconf-sshlast updated 27 Nov 2018830 udpNETCONF over SSHnetconf-sshlast updated 27 Nov 2018831 tcpNETCONF over BEEPnetconf-beeplast updated 27 Nov 2018831 udpNETCONF over BEEPnetconf-beeplast updated 27 Nov 2018832 tcpNETCONF for SOAP over HTTPSnetconfsoaphttplast updated 27 Nov 2018832 udpNETCONF for SOAP over HTTPSnetconfsoaphttplast updated 27 Nov 2018833 tcpNETCONF for SOAP over BEEPnetconfsoapbeeplast updated 27 Nov 2018833 udpNETCONF for SOAP over BEEPnetconfsoapbeeplast updated 27 Nov 2018834-846 UnassignedN/Alast updated 27 Nov 2018847 tcpdhcp-failover 2dhcp-failover2last updated 27 Nov 2018847 udpdhcp-failover 2dhcp-failover2last updated 27 Nov 2018848 tcpGDOIgdoilast updated 27 Nov 2018848 udpGDOIgdoilast updated 27 Nov 2018849-852 UnassignedN/Alast updated 27 Nov 2018853 tcpDNS query-response protocol run over TLS/DTLSdomain-slast updated 27 Nov 2018853 udpDNS query-response protocol run over TLS/DTLSdomain-slast updated 27 Nov 2018854 tcpDynamic Link Exchange Protocol (DLEP)dleplast updated 27 Nov 2018854 udpDynamic Link Exchange Protocol (DLEP)dleplast updated 27 Nov 2018855-859 UnassignedN/Alast updated 27 Nov 2018860 tcpiSCSIiscsilast updated 27 Nov 2018860 udpiSCSIiscsilast updated 27 Nov 2018861 tcpOWAMP-Controlowamp-controllast updated 27 Nov 2018861 udpOWAMP-Controlowamp-controllast updated 27 Nov 2018862 tcpTwo-way Active Measurement Protocol (TWAMP) Controltwamp-controllast updated 27 Nov 2018862 udpTwo-way Active Measurement Protocol (TWAMP) Controltwamp-controllast updated 27 Nov 2018863-872 UnassignedN/Alast updated 27 Nov 2018873 tcprsyncrsynclast updated 27 Nov 2018873 udprsyncrsynclast updated 27 Nov 2018874-885 UnassignedN/Alast updated 27 Nov 2018886 tcpICL coNETion locate servericlcnet-locatelast updated 27 Nov 2018886 udpICL coNETion locate servericlcnet-locatelast updated 27 Nov 2018887 tcpICL coNETion server info IANA assigned this well-formed service name as a replacement for "iclcnet_svinfo".iclcnet-svinfolast updated 27 Nov 2018887 tcp (iclcnet_svinfo)ICL coNETion server infoiclcnet_svinfolast updated 27 Nov 2018887 udpICL coNETion server info IANA assigned this well-formed service name as a replacement for "iclcnet_svinfo".iclcnet-svinfolast updated 27 Nov 2018887 udp (iclcnet_svinfo)ICL coNETion server infoiclcnet_svinfolast updated 27 Nov 2018888 tcpAccessBuilderaccessbuilderlast updated 27 Nov 2018888 udpAccessBuilderaccessbuilderlast updated 27 Nov 2018888 tcp (cddbp)CD Database Protocolcddbplast updated 27 Nov 2018889-899 UnassignedN/Alast updated 27 Nov 2018900 tcpOMG Initial Refsomginitialrefslast updated 27 Nov 2018900 udpOMG Initial Refsomginitialrefslast updated 27 Nov 2018901 tcpSMPNAMERESsmpnamereslast updated 27 Nov 2018901 udpSMPNAMERESsmpnamereslast updated 27 Nov 2018902 tcpself documenting Telnet Doorideafarm-doorlast updated 27 Nov 2018902 udpself documenting Door: send 0x00 for infoideafarm-doorlast updated 27 Nov 2018903 tcpself documenting Telnet Panic Doorideafarm-paniclast updated 27 Nov 2018903 udpself documenting Panic Door: send 0x00 for infoideafarm-paniclast updated 27 Nov 2018904-909 UnassignedN/Alast updated 27 Nov 2018910 tcpKerberized Internet Negotiation of Keys (KINK)kinklast updated 27 Nov 2018910 udpKerberized Internet Negotiation of Keys (KINK)kinklast updated 27 Nov 2018911 tcpxact-backupxact-backuplast updated 27 Nov 2018911 udpxact-backupxact-backuplast updated 27 Nov 2018912 tcpAPEX relay-relay serviceapex-meshlast updated 27 Nov 2018912 udpAPEX relay-relay serviceapex-meshlast updated 27 Nov 2018913 tcpAPEX endpoint-relay serviceapex-edgelast updated 27 Nov 2018913 udpAPEX endpoint-relay serviceapex-edgelast updated 27 Nov 2018914-952 UnassignedN/Alast updated 27 Nov 2018953 tcpBIND9 remote name daemon controllerrndclast updated 27 Nov 2018953 udpReservedN/Alast updated 27 Nov 2018954-988 UnassignedN/Alast updated 27 Nov 2018989 tcpftp protocol, data, over TLS/SSLftps-datalast updated 27 Nov 2018989 udpftp protocol, data, over TLS/SSLftps-datalast updated 27 Nov 2018990 tcpftp protocol, control, over TLS/SSLftpslast updated 27 Nov 2018990 udpftp protocol, control, over TLS/SSLftpslast updated 27 Nov 2018991 tcpNetnews Administration Systemnaslast updated 27 Nov 2018991 udpNetnews Administration Systemnaslast updated 27 Nov 2018992 tcptelnet protocol over TLS/SSLtelnetslast updated 27 Nov 2018992 udptelnet protocol over TLS/SSLtelnetslast updated 27 Nov 2018993 tcpIMAP over TLS protocolimapslast updated 27 Nov 2018993 udpimap4 protocol over TLS/SSLimapslast updated 27 Nov 2018994 tcpReservedN/Alast updated 27 Nov 2018994 udpReservedN/Alast updated 27 Nov 2018995 tcpPOP3 over TLS protocolpop3slast updated 27 Nov 2018995 udppop3 protocol over TLS/SSL (was spop3)pop3slast updated 27 Nov 2018996 tcpvsinetvsinetlast updated 27 Nov 2018996 udpvsinetvsinetlast updated 27 Nov 2018997 tcp-maitrdlast updated 27 Nov 2018997 udp-maitrdlast updated 27 Nov 2018998 tcp-busboylast updated 27 Nov 2018998 udp-puparplast updated 27 Nov 2018999 tcp-garconlast updated 27 Nov 2018999 udpApplix acapplixlast updated 27 Nov 2018999 tcp (puprouter)-puprouterlast updated 27 Nov 2018999 udp (puprouter)-puprouterlast updated 27 Nov 20181000 tcp-cadlock2last updated 27 Nov 20181000 udp-cadlock2last updated 27 Nov 20181001 tcpHTTP Web Pushwebpushlast updated 27 Nov 20181001 udpReservedN/Alast updated 27 Nov 20181002-1007 UnassignedN/Alast updated 27 Nov 20181008 udpPossibly used by Sun Solaris????N/Alast updated 27 Nov 20181009 UnassignedN/Alast updated 27 Nov 20181010 tcpsurfsurflast updated 27 Nov 20181010 udpsurfsurflast updated 27 Nov 20181011-1020 ReservedN/Alast updated 27 Nov 20181021 tcpRFC3692-style Experiment 1exp1last updated 27 Nov 20181021 udpRFC3692-style Experiment 1exp1last updated 27 Nov 20181021 sctpRFC3692-style Experiment 1exp1last updated 27 Nov 20181021 dccpRFC3692-style Experiment 1exp1last updated 27 Nov 20181022 tcpRFC3692-style Experiment 2exp2last updated 27 Nov 20181022 udpRFC3692-style Experiment 2exp2last updated 27 Nov 20181022 sctpRFC3692-style Experiment 2exp2last updated 27 Nov 20181022 dccpRFC3692-style Experiment 2exp2last updated 27 Nov 20181023 tcpReservedN/Alast updated 27 Nov 20181023 udpReservedN/Alast updated 27 Nov 20181024 tcpReservedN/Alast updated 27 Nov 20181024 udpReservedN/Alast updated 27 Nov 20181025 tcpnetwork blackjackblackjacklast updated 27 Nov 20181025 udpnetwork blackjackblackjacklast updated 27 Nov 20181026 tcpCalendar Access Protocolcaplast updated 27 Nov 20181026 udpCalendar Access Protocolcaplast updated 27 Nov 20181027 udpIPv6 Behind NAT44 CPEs6a44last updated 27 Nov 20181027 tcpReservedN/Alast updated 27 Nov 20181028 DeprecatedN/Alast updated 27 Nov 20181029 tcpSolid Mux Serversolid-muxlast updated 27 Nov 20181029 udpSolid Mux Serversolid-muxlast updated 27 Nov 20181030 ReservedN/Alast updated 27 Nov 20181031 ReservedN/Alast updated 27 Nov 20181032 ReservedN/Alast updated 27 Nov 20181033 tcplocal netinfo portnetinfo-locallast updated 27 Nov 20181033 udplocal netinfo portnetinfo-locallast updated 27 Nov 20181034 tcpActiveSync Notificationsactivesynclast updated 27 Nov 20181034 udpActiveSync Notificationsactivesynclast updated 27 Nov 20181035 tcpMX-XR RPCmxxrloginlast updated 27 Nov 20181035 udpMX-XR RPCmxxrloginlast updated 27 Nov 20181036 tcpNebula Secure Segment Transfer Protocolnsstplast updated 27 Nov 20181036 udpNebula Secure Segment Transfer Protocolnsstplast updated 27 Nov 20181037 tcpAMSamslast updated 27 Nov 20181037 udpAMSamslast updated 27 Nov 20181038 tcpMessage Tracking Query Protocolmtqplast updated 27 Nov 20181038 udpMessage Tracking Query Protocolmtqplast updated 27 Nov 20181039 tcpStreamlined Blackholesbllast updated 27 Nov 20181039 udpStreamlined Blackholesbllast updated 27 Nov 20181040 tcpNetarx Netcarenetarxlast updated 27 Nov 20181040 udpNetarx Netcarenetarxlast updated 27 Nov 20181041 tcpAK2 Productdanf-ak2last updated 27 Nov 20181041 udpAK2 Productdanf-ak2last updated 27 Nov 20181042 tcpSubnet Roamingafroglast updated 27 Nov 20181042 udpSubnet Roamingafroglast updated 27 Nov 20181043 tcpBOINC Client Controlboinc-clientlast updated 27 Nov 20181043 udpBOINC Client Controlboinc-clientlast updated 27 Nov 20181044 tcpDev Consortium Utilitydcutilitylast updated 27 Nov 20181044 udpDev Consortium Utilitydcutilitylast updated 27 Nov 20181045 tcpFingerprint Image Transfer Protocolfpitplast updated 27 Nov 20181045 udpFingerprint Image Transfer Protocolfpitplast updated 27 Nov 20181046 tcpWebFilter Remote Monitorwfremotertmlast updated 27 Nov 20181046 udpWebFilter Remote Monitorwfremotertmlast updated 27 Nov 20181047 tcpSun's NEO Object Request Brokerneod1last updated 27 Nov 20181047 udpSun's NEO Object Request Brokerneod1last updated 27 Nov 20181048 tcpSun's NEO Object Request Brokerneod2last updated 27 Nov 20181048 udpSun's NEO Object Request Brokerneod2last updated 27 Nov 20181049 tcpTobit David Postman VPMNtd-postmanlast updated 27 Nov 20181049 udpTobit David Postman VPMNtd-postmanlast updated 27 Nov 20181050 tcpCORBA Management Agentcmalast updated 27 Nov 20181050 udpCORBA Management Agentcmalast updated 27 Nov 20181051 tcpOptima VNEToptima-vnetlast updated 27 Nov 20181051 udpOptima VNEToptima-vnetlast updated 27 Nov 20181052 tcpDynamic DNS Toolsddtlast updated 27 Nov 20181052 udpDynamic DNS Toolsddtlast updated 27 Nov 20181053 tcpRemote Assistant (RA)remote-aslast updated 27 Nov 20181053 udpRemote Assistant (RA)remote-aslast updated 27 Nov 20181054 tcpBRVREADbrvreadlast updated 27 Nov 20181054 udpBRVREADbrvreadlast updated 27 Nov 20181055 tcpANSYS - License Manageransyslmdlast updated 27 Nov 20181055 udpANSYS - License Manageransyslmdlast updated 27 Nov 20181056 tcpVFOvfolast updated 27 Nov 20181056 udpVFOvfolast updated 27 Nov 20181057 tcpSTARTRONstartronlast updated 27 Nov 20181057 udpSTARTRONstartronlast updated 27 Nov 20181058 tcpnimnimlast updated 27 Nov 20181058 udpnimnimlast updated 27 Nov 20181059 tcpnimregnimreglast updated 27 Nov 20181059 udpnimregnimreglast updated 27 Nov 20181060 tcpPOLESTARpolestarlast updated 27 Nov 20181060 udpPOLESTARpolestarlast updated 27 Nov 20181061 tcpKIOSKkiosklast updated 27 Nov 20181061 udpKIOSKkiosklast updated 27 Nov 20181062 tcpVeracityveracitylast updated 27 Nov 20181062 udpVeracityveracitylast updated 27 Nov 20181063 tcpKyoceraNetDevkyoceranetdevlast updated 27 Nov 20181063 udpKyoceraNetDevkyoceranetdevlast updated 27 Nov 20181064 tcpJSTELjstellast updated 27 Nov 20181064 udpJSTELjstellast updated 27 Nov 20181065 tcpSYSCOMLANsyscomlanlast updated 27 Nov 20181065 udpSYSCOMLANsyscomlanlast updated 27 Nov 20181066 tcpFPO-FNSfpo-fnslast updated 27 Nov 20181066 udpFPO-FNSfpo-fnslast updated 27 Nov 20181067 tcpInstallation Bootstrap Proto. Serv. IANA assigned this well-formed service name as a replacement for "instl_boots".instl-bootslast updated 27 Nov 20181067 tcp (instl_boots)Installation Bootstrap Proto. Serv.instl_bootslast updated 27 Nov 20181067 udpInstallation Bootstrap Proto. Serv. IANA assigned this well-formed service name as a replacement for "instl_boots".instl-bootslast updated 27 Nov 20181067 udp (instl_boots)Installation Bootstrap Proto. Serv.instl_bootslast updated 27 Nov 20181068 tcpInstallation Bootstrap Proto. Cli. IANA assigned this well-formed service name as a replacement for "instl_bootc".instl-bootclast updated 27 Nov 20181068 tcp (instl_bootc)Installation Bootstrap Proto. Cli.instl_bootclast updated 27 Nov 20181068 udpInstallation Bootstrap Proto. Cli. IANA assigned this well-formed service name as a replacement for "instl_bootc".instl-bootclast updated 27 Nov 20181068 udp (instl_bootc)Installation Bootstrap Proto. Cli.instl_bootclast updated 27 Nov 20181069 tcpCOGNEX-INSIGHTcognex-insightlast updated 27 Nov 20181069 udpCOGNEX-INSIGHTcognex-insightlast updated 27 Nov 20181070 tcpGMRUpdateSERVgmrupdateservlast updated 27 Nov 20181070 udpGMRUpdateSERVgmrupdateservlast updated 27 Nov 20181071 tcpBSQUARE-VOIPbsquare-voiplast updated 27 Nov 20181071 udpBSQUARE-VOIPbsquare-voiplast updated 27 Nov 20181072 tcpCARDAXcardaxlast updated 27 Nov 20181072 udpCARDAXcardaxlast updated 27 Nov 20181073 tcpBridge Controlbridgecontrollast updated 27 Nov 20181073 udpBridge Controlbridgecontrollast updated 27 Nov 20181074 tcpWarmspot Management ProtocolwarmspotMgmtlast updated 27 Nov 20181074 udpWarmspot Management ProtocolwarmspotMgmtlast updated 27 Nov 20181075 tcpRDRMSHCrdrmshclast updated 27 Nov 20181075 udpRDRMSHCrdrmshclast updated 27 Nov 20181076 tcpDAB STI-Cdab-sti-clast updated 27 Nov 20181076 udpDAB STI-Cdab-sti-clast updated 27 Nov 20181077 tcpIMGamesimgameslast updated 27 Nov 20181077 udpIMGamesimgameslast updated 27 Nov 20181078 tcpAvocent Proxy Protocolavocent-proxylast updated 27 Nov 20181078 udpAvocent Proxy Protocolavocent-proxylast updated 27 Nov 20181079 tcpASPROVATalkasprovatalklast updated 27 Nov 20181079 udpASPROVATalkasprovatalklast updated 27 Nov 20181080 tcpSockssockslast updated 27 Nov 20181080 udpSockssockslast updated 27 Nov 20181081 tcpPVUNIWIENpvuniwienlast updated 27 Nov 20181081 udpPVUNIWIENpvuniwienlast updated 27 Nov 20181082 tcpAMT-ESD-PROTamt-esd-protlast updated 27 Nov 20181082 udpAMT-ESD-PROTamt-esd-protlast updated 27 Nov 20181083 tcpAnasoft License Manageransoft-lm-1last updated 27 Nov 20181083 udpAnasoft License Manageransoft-lm-1last updated 27 Nov 20181084 tcpAnasoft License Manageransoft-lm-2last updated 27 Nov 20181084 udpAnasoft License Manageransoft-lm-2last updated 27 Nov 20181085 tcpWeb Objectswebobjectslast updated 27 Nov 20181085 udpWeb Objectswebobjectslast updated 27 Nov 20181086 tcpCPL Scrambler Loggingcplscrambler-lglast updated 27 Nov 20181086 udpCPL Scrambler Loggingcplscrambler-lglast updated 27 Nov 20181087 tcpCPL Scrambler Internalcplscrambler-inlast updated 27 Nov 20181087 udpCPL Scrambler Internalcplscrambler-inlast updated 27 Nov 20181088 tcpCPL Scrambler Alarm Logcplscrambler-allast updated 27 Nov 20181088 udpCPL Scrambler Alarm Logcplscrambler-allast updated 27 Nov 20181089 tcpFF Annunciationff-annunclast updated 27 Nov 20181089 udpFF Annunciationff-annunclast updated 27 Nov 20181090 tcpFF Fieldbus Message Specificationff-fmslast updated 27 Nov 20181090 udpFF Fieldbus Message Specificationff-fmslast updated 27 Nov 20181091 tcpFF System Managementff-smlast updated 27 Nov 20181091 udpFF System Managementff-smlast updated 27 Nov 20181092 tcpOpen Business Reporting Protocolobrpdlast updated 27 Nov 20181092 udpOpen Business Reporting Protocolobrpdlast updated 27 Nov 20181093 tcpPROOFDproofdlast updated 27 Nov 20181093 udpPROOFDproofdlast updated 27 Nov 20181094 tcpROOTDrootdlast updated 27 Nov 20181094 udpROOTDrootdlast updated 27 Nov 20181095 tcpNICELinknicelinklast updated 27 Nov 20181095 udpNICELinknicelinklast updated 27 Nov 20181096 tcpCommon Name Resolution Protocolcnrprotocollast updated 27 Nov 20181096 udpCommon Name Resolution Protocolcnrprotocollast updated 27 Nov 20181097 tcpSun Cluster Managersunclustermgrlast updated 27 Nov 20181097 udpSun Cluster Managersunclustermgrlast updated 27 Nov 20181098 tcpRMI Activationrmiactivationlast updated 27 Nov 20181098 udpRMI Activationrmiactivationlast updated 27 Nov 20181099 tcpRMI Registryrmiregistrylast updated 27 Nov 20181099 udpRMI Registryrmiregistrylast updated 27 Nov 20181100 tcpMCTPmctplast updated 27 Nov 20181100 udpMCTPmctplast updated 27 Nov 20181101 tcpPT2-DISCOVERpt2-discoverlast updated 27 Nov 20181101 udpPT2-DISCOVERpt2-discoverlast updated 27 Nov 20181102 tcpADOBE SERVER 1adobeserver-1last updated 27 Nov 20181102 udpADOBE SERVER 1adobeserver-1last updated 27 Nov 20181103 tcpADOBE SERVER 2adobeserver-2last updated 27 Nov 20181103 udpADOBE SERVER 2adobeserver-2last updated 27 Nov 20181104 tcpXRLxrllast updated 27 Nov 20181104 udpXRLxrllast updated 27 Nov 20181105 tcpFTRANHCftranhclast updated 27 Nov 20181105 udpFTRANHCftranhclast updated 27 Nov 20181106 tcpISOIPSIGPORT-1isoipsigport-1last updated 27 Nov 20181106 udpISOIPSIGPORT-1isoipsigport-1last updated 27 Nov 20181107 tcpISOIPSIGPORT-2isoipsigport-2last updated 27 Nov 20181107 udpISOIPSIGPORT-2isoipsigport-2last updated 27 Nov 20181108 tcpratio-adpratio-adplast updated 27 Nov 20181108 udpratio-adpratio-adplast updated 27 Nov 20181109 Reserved - IANAN/Alast updated 27 Nov 20181110 tcpStart web admin serverwebadmstartlast updated 27 Nov 20181110 udpClient status infonfsd-keepalivelast updated 27 Nov 20181111 tcpLM Social Serverlmsocialserverlast updated 27 Nov 20181111 udpLM Social Serverlmsocialserverlast updated 27 Nov 20181112 tcpIntelligent Communication Protocolicplast updated 27 Nov 20181112 udpIntelligent Communication Protocolicplast updated 27 Nov 20181113 tcpLicklider Transmission Protocolltp-deepspacelast updated 27 Nov 20181113 udpLicklider Transmission Protocolltp-deepspacelast updated 27 Nov 20181113 dccpLicklider Transmission Protocolltp-deepspacelast updated 27 Nov 20181114 tcpMini SQLmini-sqllast updated 27 Nov 20181114 udpMini SQLmini-sqllast updated 27 Nov 20181115 tcpARDUS Transferardus-trnslast updated 27 Nov 20181115 udpARDUS Transferardus-trnslast updated 27 Nov 20181116 tcpARDUS Controlardus-cntllast updated 27 Nov 20181116 udpARDUS Controlardus-cntllast updated 27 Nov 20181117 tcpARDUS Multicast Transferardus-mtrnslast updated 27 Nov 20181117 udpARDUS Multicast Transferardus-mtrnslast updated 27 Nov 20181118 tcpSACREDsacredlast updated 27 Nov 20181118 udpSACREDsacredlast updated 27 Nov 20181119 tcpBattle.net Chat/Game Protocolbnetgamelast updated 27 Nov 20181119 udpBattle.net Chat/Game Protocolbnetgamelast updated 27 Nov 20181120 tcpBattle.net File Transfer Protocolbnetfilelast updated 27 Nov 20181120 udpBattle.net File Transfer Protocolbnetfilelast updated 27 Nov 20181121 tcpDatalode RMPPrmpplast updated 27 Nov 20181121 udpDatalode RMPPrmpplast updated 27 Nov 20181122 tcpavailant-mgravailant-mgrlast updated 27 Nov 20181122 udpavailant-mgravailant-mgrlast updated 27 Nov 20181123 tcpMurraymurraylast updated 27 Nov 20181123 udpMurraymurraylast updated 27 Nov 20181124 tcpHP VMM Controlhpvmmcontrollast updated 27 Nov 20181124 udpHP VMM Controlhpvmmcontrollast updated 27 Nov 20181125 tcpHP VMM Agenthpvmmagentlast updated 27 Nov 20181125 udpHP VMM Agenthpvmmagentlast updated 27 Nov 20181126 tcpHP VMM Agenthpvmmdatalast updated 27 Nov 20181126 udpHP VMM Agenthpvmmdatalast updated 27 Nov 20181127 tcpKWDB Remote Communicationkwdb-commnlast updated 27 Nov 20181127 udpKWDB Remote Communicationkwdb-commnlast updated 27 Nov 20181128 tcpSAPHostControl over SOAP/HTTPsaphostctrllast updated 27 Nov 20181128 udpSAPHostControl over SOAP/HTTPsaphostctrllast updated 27 Nov 20181129 tcpSAPHostControl over SOAP/HTTPSsaphostctrlslast updated 27 Nov 20181129 udpSAPHostControl over SOAP/HTTPSsaphostctrlslast updated 27 Nov 20181130 tcpCAC App Service Protocolcasplast updated 27 Nov 20181130 udpCAC App Service Protocolcasplast updated 27 Nov 20181131 tcpCAC App Service Protocol Encriptedcaspssllast updated 27 Nov 20181131 udpCAC App Service Protocol Encriptedcaspssllast updated 27 Nov 20181132 tcpKVM-via-IP Management Servicekvm-via-iplast updated 27 Nov 20181132 udpKVM-via-IP Management Servicekvm-via-iplast updated 27 Nov 20181133 tcpData Flow Networkdfnlast updated 27 Nov 20181133 udpData Flow Networkdfnlast updated 27 Nov 20181134 tcpMicroAPL APLXaplxlast updated 27 Nov 20181134 udpMicroAPL APLXaplxlast updated 27 Nov 20181135 tcpOmniVision Communication Serviceomnivisionlast updated 27 Nov 20181135 udpOmniVision Communication Serviceomnivisionlast updated 27 Nov 20181136 tcpHHB Gateway Controlhhb-gatewaylast updated 27 Nov 20181136 udpHHB Gateway Controlhhb-gatewaylast updated 27 Nov 20181137 tcpTRIM Workgroup Servicetrimlast updated 27 Nov 20181137 udpTRIM Workgroup Servicetrimlast updated 27 Nov 20181138 tcpencrypted admin requests IANA assigned this well-formed service name as a replacement for "encrypted_admin".encrypted-adminlast updated 27 Nov 20181138 tcp (encrypted_admin)encrypted admin requestsencrypted_adminlast updated 27 Nov 20181138 udpencrypted admin requests IANA assigned this well-formed service name as a replacement for "encrypted_admin".encrypted-adminlast updated 27 Nov 20181138 udp (encrypted_admin)encrypted admin requestsencrypted_adminlast updated 27 Nov 20181139 tcpEnterprise Virtual Managerevmlast updated 27 Nov 20181139 udpEnterprise Virtual Managerevmlast updated 27 Nov 20181140 tcpAutoNOC Network Operations Protocolautonoclast updated 27 Nov 20181140 udpAutoNOC Network Operations Protocolautonoclast updated 27 Nov 20181141 tcpUser Message Servicemxomsslast updated 27 Nov 20181141 udpUser Message Servicemxomsslast updated 27 Nov 20181142 tcpUser Discovery Serviceedtoolslast updated 27 Nov 20181142 udpUser Discovery Serviceedtoolslast updated 27 Nov 20181143 tcpInfomatryx Exchangeimyxlast updated 27 Nov 20181143 udpInfomatryx Exchangeimyxlast updated 27 Nov 20181144 tcpFusion Scriptfuscriptlast updated 27 Nov 20181144 udpFusion Scriptfuscriptlast updated 27 Nov 20181145 tcpX9 iCue Show Controlx9-icuelast updated 27 Nov 20181145 udpX9 iCue Show Controlx9-icuelast updated 27 Nov 20181146 tcpaudit transferaudit-transferlast updated 27 Nov 20181146 udpaudit transferaudit-transferlast updated 27 Nov 20181147 tcpCAPIoverLANcapioverlanlast updated 27 Nov 20181147 udpCAPIoverLANcapioverlanlast updated 27 Nov 20181148 tcpElfiq Replication Serviceelfiq-repllast updated 27 Nov 20181148 udpElfiq Replication Serviceelfiq-repllast updated 27 Nov 20181149 tcpBlueView Sonar Servicebvtsonarlast updated 27 Nov 20181149 udpBlueView Sonar Servicebvtsonarlast updated 27 Nov 20181150 tcpBlaze File Serverblazelast updated 27 Nov 20181150 udpBlaze File Serverblazelast updated 27 Nov 20181151 tcpUnizensus Login Serverunizensuslast updated 27 Nov 20181151 udpUnizensus Login Serverunizensuslast updated 27 Nov 20181152 tcpWinpopup LAN Messengerwinpoplanmesslast updated 27 Nov 20181152 udpWinpopup LAN Messengerwinpoplanmesslast updated 27 Nov 20181153 tcpANSI C12.22 Portc1222-acselast updated 27 Nov 20181153 udpANSI C12.22 Portc1222-acselast updated 27 Nov 20181154 tcpCommunity Serviceresacommunitylast updated 27 Nov 20181154 udpCommunity Serviceresacommunitylast updated 27 Nov 20181155 tcpNetwork File Accessnfalast updated 27 Nov 20181155 udpNetwork File Accessnfalast updated 27 Nov 20181156 tcpiasControl OMSiascontrol-omslast updated 27 Nov 20181156 udpiasControl OMSiascontrol-omslast updated 27 Nov 20181157 tcpOracle iASControliascontrollast updated 27 Nov 20181157 udpOracle iASControliascontrollast updated 27 Nov 20181158 tcpdbControl OMSdbcontrol-omslast updated 27 Nov 20181158 udpdbControl OMSdbcontrol-omslast updated 27 Nov 20181159 tcpOracle OMSoracle-omslast updated 27 Nov 20181159 udpOracle OMSoracle-omslast updated 27 Nov 20181160 tcpDB Lite Mult-User Serverolsvlast updated 27 Nov 20181160 udpDB Lite Mult-User Serverolsvlast updated 27 Nov 20181161 tcpHealth Pollinghealth-pollinglast updated 27 Nov 20181161 udpHealth Pollinghealth-pollinglast updated 27 Nov 20181162 tcpHealth Traphealth-traplast updated 27 Nov 20181162 udpHealth Traphealth-traplast updated 27 Nov 20181163 tcpSmartDialer Data Protocolsddplast updated 27 Nov 20181163 udpSmartDialer Data Protocolsddplast updated 27 Nov 20181164 tcpQSM Proxy Serviceqsm-proxylast updated 27 Nov 20181164 udpQSM Proxy Serviceqsm-proxylast updated 27 Nov 20181165 tcpQSM GUI Serviceqsm-guilast updated 27 Nov 20181165 udpQSM GUI Serviceqsm-guilast updated 27 Nov 20181166 tcpQSM RemoteExecqsm-remotelast updated 27 Nov 20181166 udpQSM RemoteExecqsm-remotelast updated 27 Nov 20181167 tcpCisco IP SLAs Control Protocolcisco-ipslalast updated 27 Nov 20181167 udpCisco IP SLAs Control Protocolcisco-ipslalast updated 27 Nov 20181167 sctpCisco IP SLAs Control Protocolcisco-ipslalast updated 27 Nov 20181168 tcpVChat Conference Servicevchatlast updated 27 Nov 20181168 udpVChat Conference Servicevchatlast updated 27 Nov 20181169 tcpTRIPWIREtripwirelast updated 27 Nov 20181169 udpTRIPWIREtripwirelast updated 27 Nov 20181170 tcpAT+C License Manageratc-lmlast updated 27 Nov 20181170 udpAT+C License Manageratc-lmlast updated 27 Nov 20181171 tcpAT+C FmiApplicationServeratc-appserverlast updated 27 Nov 20181171 udpAT+C FmiApplicationServeratc-appserverlast updated 27 Nov 20181172 tcpDNA Protocoldnaplast updated 27 Nov 20181172 udpDNA Protocoldnaplast updated 27 Nov 20181173 tcpD-Cinema Request-Responsed-cinema-rrplast updated 27 Nov 20181173 udpD-Cinema Request-Responsed-cinema-rrplast updated 27 Nov 20181174 tcpFlashNet Remote Adminfnet-remote-uilast updated 27 Nov 20181174 udpFlashNet Remote Adminfnet-remote-uilast updated 27 Nov 20181175 tcpDossier Serverdossierlast updated 27 Nov 20181175 udpDossier Serverdossierlast updated 27 Nov 20181176 tcpIndigo Home Serverindigo-serverlast updated 27 Nov 20181176 udpIndigo Home Serverindigo-serverlast updated 27 Nov 20181177 tcpDKMessenger Protocoldkmessengerlast updated 27 Nov 20181177 udpDKMessenger Protocoldkmessengerlast updated 27 Nov 20181178 tcpSGI Storage Managersgi-stormanlast updated 27 Nov 20181178 udpSGI Storage Managersgi-stormanlast updated 27 Nov 20181179 tcpBackup To Neighborb2nlast updated 27 Nov 20181179 udpBackup To Neighborb2nlast updated 27 Nov 20181180 tcpMillicent Client Proxymc-clientlast updated 27 Nov 20181180 udpMillicent Client Proxymc-clientlast updated 27 Nov 20181181 tcp3Com Net Management3comnetmanlast updated 27 Nov 20181181 udp3Com Net Management3comnetmanlast updated 27 Nov 20181182 tcpAcceleNet Controlaccelenetlast updated 27 Nov 20181182 udpAcceleNet Dataaccelenet-datalast updated 27 Nov 20181183 tcpLL Surfup HTTPllsurfup-httplast updated 27 Nov 20181183 udpLL Surfup HTTPllsurfup-httplast updated 27 Nov 20181184 tcpLL Surfup HTTPSllsurfup-httpslast updated 27 Nov 20181184 udpLL Surfup HTTPSllsurfup-httpslast updated 27 Nov 20181185 tcpCatchpole portcatchpolelast updated 27 Nov 20181185 udpCatchpole portcatchpolelast updated 27 Nov 20181186 tcpMySQL Cluster Managermysql-clusterlast updated 27 Nov 20181186 udpMySQL Cluster Managermysql-clusterlast updated 27 Nov 20181187 tcpAlias Servicealiaslast updated 27 Nov 20181187 udpAlias Servicealiaslast updated 27 Nov 20181188 tcpHP Web Adminhp-webadminlast updated 27 Nov 20181188 udpHP Web Adminhp-webadminlast updated 27 Nov 20181189 tcpUnet Connectionunetlast updated 27 Nov 20181189 udpUnet Connectionunetlast updated 27 Nov 20181190 tcpCommLinx GPS / AVL Systemcommlinx-avllast updated 27 Nov 20181190 udpCommLinx GPS / AVL Systemcommlinx-avllast updated 27 Nov 20181191 tcpGeneral Parallel File Systemgpfslast updated 27 Nov 20181191 udpGeneral Parallel File Systemgpfslast updated 27 Nov 20181192 tcpcaids sensors channelcaids-sensorlast updated 27 Nov 20181192 udpcaids sensors channelcaids-sensorlast updated 27 Nov 20181193 tcpFive Across Serverfiveacrosslast updated 27 Nov 20181193 udpFive Across Serverfiveacrosslast updated 27 Nov 20181194 tcpOpenVPNopenvpnlast updated 27 Nov 20181194 udpOpenVPNopenvpnlast updated 27 Nov 20181195 tcpRSF-1 clusteringrsf-1last updated 27 Nov 20181195 udpRSF-1 clusteringrsf-1last updated 27 Nov 20181196 tcpNetwork Magicnetmagiclast updated 27 Nov 20181196 udpNetwork Magicnetmagiclast updated 27 Nov 20181197 tcpCarrius Remote Accesscarrius-rshelllast updated 27 Nov 20181197 udpCarrius Remote Accesscarrius-rshelllast updated 27 Nov 20181198 tcpcajo reference discoverycajo-discoverylast updated 27 Nov 20181198 udpcajo reference discoverycajo-discoverylast updated 27 Nov 20181199 tcpDMIDIdmidilast updated 27 Nov 20181199 udpDMIDIdmidilast updated 27 Nov 20181200 tcpSCOLscollast updated 27 Nov 20181200 udpSCOLscollast updated 27 Nov 20181201 tcpNucleus Sand Database Servernucleus-sandlast updated 27 Nov 20181201 udpNucleus Sand Database Servernucleus-sandlast updated 27 Nov 20181202 tcpcaiccipccaiccipclast updated 27 Nov 20181202 udpcaiccipccaiccipclast updated 27 Nov 20181203 tcpLicense Validationssslic-mgrlast updated 27 Nov 20181203 udpLicense Validationssslic-mgrlast updated 27 Nov 20181204 tcpLog Request Listenerssslog-mgrlast updated 27 Nov 20181204 udpLog Request Listenerssslog-mgrlast updated 27 Nov 20181205 tcpAccord-MGCaccord-mgclast updated 27 Nov 20181205 udpAccord-MGCaccord-mgclast updated 27 Nov 20181206 tcpAnthony Dataanthony-datalast updated 27 Nov 20181206 udpAnthony Dataanthony-datalast updated 27 Nov 20181207 tcpMetaSagemetasagelast updated 27 Nov 20181207 udpMetaSagemetasagelast updated 27 Nov 20181208 tcpSEAGULL AISseagull-aislast updated 27 Nov 20181208 udpSEAGULL AISseagull-aislast updated 27 Nov 20181209 tcpIPCD3ipcd3last updated 27 Nov 20181209 udpIPCD3ipcd3last updated 27 Nov 20181210 tcpEOSSeosslast updated 27 Nov 20181210 udpEOSSeosslast updated 27 Nov 20181211 tcpGroove DPPgroove-dpplast updated 27 Nov 20181211 udpGroove DPPgroove-dpplast updated 27 Nov 20181212 tcplupalupalast updated 27 Nov 20181212 udplupalupalast updated 27 Nov 20181213 tcpMedtronic/Physio-Control LIFENETmpc-lifenetlast updated 27 Nov 20181213 udpMedtronic/Physio-Control LIFENETmpc-lifenetlast updated 27 Nov 20181214 tcpKAZAAkazaalast updated 27 Nov 20181214 udpKAZAAkazaalast updated 27 Nov 20181215 tcpscanSTAT 1.0scanstat-1last updated 27 Nov 20181215 udpscanSTAT 1.0scanstat-1last updated 27 Nov 20181216 tcpETEBAC 5etebac5last updated 27 Nov 20181216 udpETEBAC 5etebac5last updated 27 Nov 20181217 tcpHPSS NonDCE Gatewayhpss-ndapilast updated 27 Nov 20181217 udpHPSS NonDCE Gatewayhpss-ndapilast updated 27 Nov 20181218 tcpAeroFlight-ADsaeroflight-adslast updated 27 Nov 20181218 udpAeroFlight-ADsaeroflight-adslast updated 27 Nov 20181219 tcpAeroFlight-Retaeroflight-retlast updated 27 Nov 20181219 udpAeroFlight-Retaeroflight-retlast updated 27 Nov 20181220 tcpQT SERVER ADMINqt-serveradminlast updated 27 Nov 20181220 udpQT SERVER ADMINqt-serveradminlast updated 27 Nov 20181221 tcpSweetWARE Appssweetware-appslast updated 27 Nov 20181221 udpSweetWARE Appssweetware-appslast updated 27 Nov 20181222 tcpSNI R&D networknervlast updated 27 Nov 20181222 udpSNI R&D networknervlast updated 27 Nov 20181223 tcpTrulyGlobal Protocoltgplast updated 27 Nov 20181223 udpTrulyGlobal Protocoltgplast updated 27 Nov 20181224 tcpVPNzvpnzlast updated 27 Nov 20181224 udpVPNzvpnzlast updated 27 Nov 20181225 tcpSLINKYSEARCHslinkysearchlast updated 27 Nov 20181225 udpSLINKYSEARCHslinkysearchlast updated 27 Nov 20181226 tcpSTGXFWSstgxfwslast updated 27 Nov 20181226 udpSTGXFWSstgxfwslast updated 27 Nov 20181227 tcpDNS2Godns2golast updated 27 Nov 20181227 udpDNS2Godns2golast updated 27 Nov 20181228 tcpFLORENCEflorencelast updated 27 Nov 20181228 udpFLORENCEflorencelast updated 27 Nov 20181229 tcpZENworks Tiered Electronic Distributionzentedlast updated 27 Nov 20181229 udpZENworks Tiered Electronic Distributionzentedlast updated 27 Nov 20181230 tcpPeriscopeperiscopelast updated 27 Nov 20181230 udpPeriscopeperiscopelast updated 27 Nov 20181231 tcpmenandmice-lpmmenandmice-lpmlast updated 27 Nov 20181231 udpmenandmice-lpmmenandmice-lpmlast updated 27 Nov 20181232 tcpRemote systems monitoringfirst-defenselast updated 27 Nov 20181232 udpRemote systems monitoringfirst-defenselast updated 27 Nov 20181233 tcpUniversal App Serveruniv-appserverlast updated 27 Nov 20181233 udpUniversal App Serveruniv-appserverlast updated 27 Nov 20181234 tcpInfoseek Search Agentsearch-agentlast updated 27 Nov 20181234 udpInfoseek Search Agentsearch-agentlast updated 27 Nov 20181235 tcpmosaicsyssvc1mosaicsyssvc1last updated 27 Nov 20181235 udpmosaicsyssvc1mosaicsyssvc1last updated 27 Nov 20181236 tcpbvcontrolbvcontrollast updated 27 Nov 20181236 udpbvcontrolbvcontrollast updated 27 Nov 20181237 tcptsdos390tsdos390last updated 27 Nov 20181237 udptsdos390tsdos390last updated 27 Nov 20181238 tcphacl-qshacl-qslast updated 27 Nov 20181238 udphacl-qshacl-qslast updated 27 Nov 20181239 tcpNMSDnmsdlast updated 27 Nov 20181239 udpNMSDnmsdlast updated 27 Nov 20181240 tcpInstantiainstantialast updated 27 Nov 20181240 udpInstantiainstantialast updated 27 Nov 20181241 tcpnessusnessuslast updated 27 Nov 20181241 udpnessusnessuslast updated 27 Nov 20181242 tcpNMAS over IPnmasoveriplast updated 27 Nov 20181242 udpNMAS over IPnmasoveriplast updated 27 Nov 20181243 tcpSerialGatewayserialgatewaylast updated 27 Nov 20181243 udpSerialGatewayserialgatewaylast updated 27 Nov 20181244 tcpisbconference1isbconference1last updated 27 Nov 20181244 udpisbconference1isbconference1last updated 27 Nov 20181245 tcpisbconference2isbconference2last updated 27 Nov 20181245 udpisbconference2isbconference2last updated 27 Nov 20181246 tcppayrouterpayrouterlast updated 27 Nov 20181246 udppayrouterpayrouterlast updated 27 Nov 20181247 tcpVisionPyramidvisionpyramidlast updated 27 Nov 20181247 udpVisionPyramidvisionpyramidlast updated 27 Nov 20181248 tcphermeshermeslast updated 27 Nov 20181248 udphermeshermeslast updated 27 Nov 20181249 tcpMesa Vista Comesavistacolast updated 27 Nov 20181249 udpMesa Vista Comesavistacolast updated 27 Nov 20181250 tcpswldy-siasswldy-siaslast updated 27 Nov 20181250 udpswldy-siasswldy-siaslast updated 27 Nov 20181251 tcpservergraphservergraphlast updated 27 Nov 20181251 udpservergraphservergraphlast updated 27 Nov 20181252 tcpbspne-pccbspne-pcclast updated 27 Nov 20181252 udpbspne-pccbspne-pcclast updated 27 Nov 20181253 tcpq55-pccq55-pcclast updated 27 Nov 20181253 udpq55-pccq55-pcclast updated 27 Nov 20181254 tcpde-nocde-noclast updated 27 Nov 20181254 udpde-nocde-noclast updated 27 Nov 20181255 tcpde-cache-queryde-cache-querylast updated 27 Nov 20181255 udpde-cache-queryde-cache-querylast updated 27 Nov 20181256 tcpde-serverde-serverlast updated 27 Nov 20181256 udpde-serverde-serverlast updated 27 Nov 20181257 tcpShockwave 2shockwave2last updated 27 Nov 20181257 udpShockwave 2shockwave2last updated 27 Nov 20181258 tcpOpen Network Libraryopennllast updated 27 Nov 20181258 udpOpen Network Libraryopennllast updated 27 Nov 20181259 tcpOpen Network Library Voiceopennl-voicelast updated 27 Nov 20181259 udpOpen Network Library Voiceopennl-voicelast updated 27 Nov 20181260 tcpibm-ssdibm-ssdlast updated 27 Nov 20181260 udpibm-ssdibm-ssdlast updated 27 Nov 20181261 tcpmpshrsvmpshrsvlast updated 27 Nov 20181261 udpmpshrsvmpshrsvlast updated 27 Nov 20181262 tcpQNTS-ORBqnts-orblast updated 27 Nov 20181262 udpQNTS-ORBqnts-orblast updated 27 Nov 20181263 tcpdkadkalast updated 27 Nov 20181263 udpdkadkalast updated 27 Nov 20181264 tcpPRATpratlast updated 27 Nov 20181264 udpPRATpratlast updated 27 Nov 20181265 tcpDSSIAPIdssiapilast updated 27 Nov 20181265 udpDSSIAPIdssiapilast updated 27 Nov 20181266 tcpDELLPWRAPPKSdellpwrappkslast updated 27 Nov 20181266 udpDELLPWRAPPKSdellpwrappkslast updated 27 Nov 20181267 tcpeTrust Policy Complianceepclast updated 27 Nov 20181267 udpeTrust Policy Complianceepclast updated 27 Nov 20181268 tcpPROPEL-MSGSYSpropel-msgsyslast updated 27 Nov 20181268 udpPROPEL-MSGSYSpropel-msgsyslast updated 27 Nov 20181269 tcpWATiLaPPwatilapplast updated 27 Nov 20181269 udpWATiLaPPwatilapplast updated 27 Nov 20181270 tcpMicrosoft Operations Manageropsmgrlast updated 27 Nov 20181270 udpMicrosoft Operations Manageropsmgrlast updated 27 Nov 20181271 tcpeXcWexcwlast updated 27 Nov 20181271 udpeXcWexcwlast updated 27 Nov 20181272 tcpCSPMLockMgrcspmlockmgrlast updated 27 Nov 20181272 udpCSPMLockMgrcspmlockmgrlast updated 27 Nov 20181273 tcpEMC-Gatewayemc-gatewaylast updated 27 Nov 20181273 udpEMC-Gatewayemc-gatewaylast updated 27 Nov 20181274 tcpt1distproct1distproclast updated 27 Nov 20181274 udpt1distproct1distproclast updated 27 Nov 20181275 tcpivcollectorivcollectorlast updated 27 Nov 20181275 udpivcollectorivcollectorlast updated 27 Nov 20181276 tcpReservedN/Alast updated 27 Nov 20181276 udpReservedN/Alast updated 27 Nov 20181277 tcpmqsmiva-mqslast updated 27 Nov 20181277 udpmqsmiva-mqslast updated 27 Nov 20181278 tcpDell Web Admin 1dellwebadmin-1last updated 27 Nov 20181278 udpDell Web Admin 1dellwebadmin-1last updated 27 Nov 20181279 tcpDell Web Admin 2dellwebadmin-2last updated 27 Nov 20181279 udpDell Web Admin 2dellwebadmin-2last updated 27 Nov 20181280 tcpPictrographypictrographylast updated 27 Nov 20181280 udpPictrographypictrographylast updated 27 Nov 20181281 tcphealthdhealthdlast updated 27 Nov 20181281 udphealthdhealthdlast updated 27 Nov 20181282 tcpEmperionemperionlast updated 27 Nov 20181282 udpEmperionemperionlast updated 27 Nov 20181283 tcpProduct Informationproductinfolast updated 27 Nov 20181283 udpProduct Informationproductinfolast updated 27 Nov 20181284 tcpIEE-QFXiee-qfxlast updated 27 Nov 20181284 udpIEE-QFXiee-qfxlast updated 27 Nov 20181285 tcpneoifaceneoifacelast updated 27 Nov 20181285 udpneoifaceneoifacelast updated 27 Nov 20181286 tcpnetuitivenetuitivelast updated 27 Nov 20181286 udpnetuitivenetuitivelast updated 27 Nov 20181287 tcpRouteMatch Comroutematchlast updated 27 Nov 20181287 udpRouteMatch Comroutematchlast updated 27 Nov 20181288 tcpNavBuddynavbuddylast updated 27 Nov 20181288 udpNavBuddynavbuddylast updated 27 Nov 20181289 tcpJWalkServerjwalkserverlast updated 27 Nov 20181289 udpJWalkServerjwalkserverlast updated 27 Nov 20181290 tcpWinJaServerwinjaserverlast updated 27 Nov 20181290 udpWinJaServerwinjaserverlast updated 27 Nov 20181291 tcpSEAGULLLMSseagulllmslast updated 27 Nov 20181291 udpSEAGULLLMSseagulllmslast updated 27 Nov 20181292 tcpdsdndsdnlast updated 27 Nov 20181292 udpdsdndsdnlast updated 27 Nov 20181293 tcpPKT-KRB-IPSecpkt-krb-ipseclast updated 27 Nov 20181293 udpPKT-KRB-IPSecpkt-krb-ipseclast updated 27 Nov 20181294 tcpCMMdrivercmmdriverlast updated 27 Nov 20181294 udpCMMdrivercmmdriverlast updated 27 Nov 20181295 tcpEnd-by-Hop Transmission Protocolehtplast updated 27 Nov 20181295 udpEnd-by-Hop Transmission Protocolehtplast updated 27 Nov 20181296 tcpdproxydproxylast updated 27 Nov 20181296 udpdproxydproxylast updated 27 Nov 20181297 tcpsdproxysdproxylast updated 27 Nov 20181297 udpsdproxysdproxylast updated 27 Nov 20181298 tcplpcplpcplast updated 27 Nov 20181298 udplpcplpcplast updated 27 Nov 20181299 tcphp-scihp-scilast updated 27 Nov 20181299 udphp-scihp-scilast updated 27 Nov 20181300 tcpH.323 Secure Call Control Signallingh323hostcallsclast updated 27 Nov 20181300 udpH.323 Secure Call Control Signallingh323hostcallsclast updated 27 Nov 20181301 tcpCI3-Software-1ci3-software-1last updated 27 Nov 20181301 udpCI3-Software-1ci3-software-1last updated 27 Nov 20181302 tcpCI3-Software-2ci3-software-2last updated 27 Nov 20181302 udpCI3-Software-2ci3-software-2last updated 27 Nov 20181303 tcpsftsrvsftsrvlast updated 27 Nov 20181303 udpsftsrvsftsrvlast updated 27 Nov 20181304 tcpBoomerangboomeranglast updated 27 Nov 20181304 udpBoomerangboomeranglast updated 27 Nov 20181305 tcppe-mikepe-mikelast updated 27 Nov 20181305 udppe-mikepe-mikelast updated 27 Nov 20181306 tcpRE-Conn-Protore-conn-protolast updated 27 Nov 20181306 udpRE-Conn-Protore-conn-protolast updated 27 Nov 20181307 tcpPacmandpacmandlast updated 27 Nov 20181307 udpPacmandpacmandlast updated 27 Nov 20181308 tcpOptical Domain Service Interconnect (ODSI)odsilast updated 27 Nov 20181308 udpOptical Domain Service Interconnect (ODSI)odsilast updated 27 Nov 20181309 tcpJTAG serverjtag-serverlast updated 27 Nov 20181309 udpJTAG serverjtag-serverlast updated 27 Nov 20181310 tcpHuskyhuskylast updated 27 Nov 20181310 udpHuskyhuskylast updated 27 Nov 20181311 tcpRxMonrxmonlast updated 27 Nov 20181311 udpRxMonrxmonlast updated 27 Nov 20181312 tcpSTI Envisionsti-envisionlast updated 27 Nov 20181312 udpSTI Envisionsti-envisionlast updated 27 Nov 20181313 tcpBMC_PATROLDB IANA assigned this well-formed service name as a replacement for "bmc_patroldb".bmc-patroldblast updated 27 Nov 20181313 tcp (bmc_patroldb)BMC_PATROLDBbmc_patroldblast updated 27 Nov 20181313 udpBMC_PATROLDB IANA assigned this well-formed service name as a replacement for "bmc_patroldb".bmc-patroldblast updated 27 Nov 20181313 udp (bmc_patroldb)BMC_PATROLDBbmc_patroldblast updated 27 Nov 20181314 tcpPhotoscript Distributed Printing Systempdpslast updated 27 Nov 20181314 udpPhotoscript Distributed Printing Systempdpslast updated 27 Nov 20181315 tcpE.L.S., Event Listener Serviceelslast updated 27 Nov 20181315 udpE.L.S., Event Listener Serviceelslast updated 27 Nov 20181316 tcpExbit-ESCPexbit-escplast updated 27 Nov 20181316 udpExbit-ESCPexbit-escplast updated 27 Nov 20181317 tcpvrts-ipcservervrts-ipcserverlast updated 27 Nov 20181317 udpvrts-ipcservervrts-ipcserverlast updated 27 Nov 20181318 tcpkrb5gatekeeperkrb5gatekeeperlast updated 27 Nov 20181318 udpkrb5gatekeeperkrb5gatekeeperlast updated 27 Nov 20181319 tcpAMX-ICSPamx-icsplast updated 27 Nov 20181319 udpAMX-ICSPamx-icsplast updated 27 Nov 20181320 tcpAMX-AXBNETamx-axbnetlast updated 27 Nov 20181320 udpAMX-AXBNETamx-axbnetlast updated 27 Nov 20181321 tcpPIPpiplast updated 27 Nov 20181321 udpPIPpiplast updated 27 Nov 20181322 tcpNovationnovationlast updated 27 Nov 20181322 udpNovationnovationlast updated 27 Nov 20181323 tcpbrcdbrcdlast updated 27 Nov 20181323 udpbrcdbrcdlast updated 27 Nov 20181324 tcpdelta-mcpdelta-mcplast updated 27 Nov 20181324 udpdelta-mcpdelta-mcplast updated 27 Nov 20181325 tcpDX-Instrumentdx-instrumentlast updated 27 Nov 20181325 udpDX-Instrumentdx-instrumentlast updated 27 Nov 20181326 tcpWIMSICwimsiclast updated 27 Nov 20181326 udpWIMSICwimsiclast updated 27 Nov 20181327 tcpUltrexultrexlast updated 27 Nov 20181327 udpUltrexultrexlast updated 27 Nov 20181328 tcpEWALLewalllast updated 27 Nov 20181328 udpEWALLewalllast updated 27 Nov 20181329 tcpnetdb-exportnetdb-exportlast updated 27 Nov 20181329 udpnetdb-exportnetdb-exportlast updated 27 Nov 20181330 tcpStreetPerfectstreetperfectlast updated 27 Nov 20181330 udpStreetPerfectstreetperfectlast updated 27 Nov 20181331 tcpintersanintersanlast updated 27 Nov 20181331 udpintersanintersanlast updated 27 Nov 20181332 tcpPCIA RXP-Bpcia-rxp-blast updated 27 Nov 20181332 udpPCIA RXP-Bpcia-rxp-blast updated 27 Nov 20181333 tcpPassword Policypasswrd-policylast updated 27 Nov 20181333 udpPassword Policypasswrd-policylast updated 27 Nov 20181334 tcpwritesrvwritesrvlast updated 27 Nov 20181334 udpwritesrvwritesrvlast updated 27 Nov 20181335 tcpDigital Notary Protocoldigital-notarylast updated 27 Nov 20181335 udpDigital Notary Protocoldigital-notarylast updated 27 Nov 20181336 tcpInstant Service Chatischatlast updated 27 Nov 20181336 udpInstant Service Chatischatlast updated 27 Nov 20181337 tcpmenandmice DNSmenandmice-dnslast updated 27 Nov 20181337 udpmenandmice DNSmenandmice-dnslast updated 27 Nov 20181338 tcpWMC-log-svrwmc-log-svclast updated 27 Nov 20181338 udpWMC-log-svrwmc-log-svclast updated 27 Nov 20181339 tcpkjtsiteserverkjtsiteserverlast updated 27 Nov 20181339 udpkjtsiteserverkjtsiteserverlast updated 27 Nov 20181340 tcpNAAPnaaplast updated 27 Nov 20181340 udpNAAPnaaplast updated 27 Nov 20181341 tcpQuBESqubeslast updated 27 Nov 20181341 udpQuBESqubeslast updated 27 Nov 20181342 tcpESBrokeresbrokerlast updated 27 Nov 20181342 udpESBrokeresbrokerlast updated 27 Nov 20181343 tcpre101re101last updated 27 Nov 20181343 udpre101re101last updated 27 Nov 20181344 tcpICAPicaplast updated 27 Nov 20181344 udpICAPicaplast updated 27 Nov 20181345 tcpVPJPvpjplast updated 27 Nov 20181345 udpVPJPvpjplast updated 27 Nov 20181346 tcpAlta Analytics License Manageralta-ana-lmlast updated 27 Nov 20181346 udpAlta Analytics License Manageralta-ana-lmlast updated 27 Nov 20181347 tcpmulti media conferencingbbn-mmclast updated 27 Nov 20181347 udpmulti media conferencingbbn-mmclast updated 27 Nov 20181348 tcpmulti media conferencingbbn-mmxlast updated 27 Nov 20181348 udpmulti media conferencingbbn-mmxlast updated 27 Nov 20181349 tcpRegistration Network Protocolsbooklast updated 27 Nov 20181349 udpRegistration Network Protocolsbooklast updated 27 Nov 20181350 tcpRegistration Network Protocoleditbenchlast updated 27 Nov 20181350 udpRegistration Network Protocoleditbenchlast updated 27 Nov 20181351 tcpDigital Tool Works (MIT)equationbuilderlast updated 27 Nov 20181351 udpDigital Tool Works (MIT)equationbuilderlast updated 27 Nov 20181352 tcpLotus Notelotusnotelast updated 27 Nov 20181352 udpLotus Notelotusnotelast updated 27 Nov 20181353 tcpRelief Consultingrelieflast updated 27 Nov 20181353 udpRelief Consultingrelieflast updated 27 Nov 20181354 tcpFive Across XSIP NetworkXSIP-networklast updated 27 Nov 20181354 udpFive Across XSIP NetworkXSIP-networklast updated 27 Nov 20181355 tcpIntuitive Edgeintuitive-edgelast updated 27 Nov 20181355 udpIntuitive Edgeintuitive-edgelast updated 27 Nov 20181356 tcpCuillaMartin Companycuillamartinlast updated 27 Nov 20181356 udpCuillaMartin Companycuillamartinlast updated 27 Nov 20181357 tcpElectronic PegBoardpegboardlast updated 27 Nov 20181357 udpElectronic PegBoardpegboardlast updated 27 Nov 20181358 tcpCONNLCLIconnlclilast updated 27 Nov 20181358 udpCONNLCLIconnlclilast updated 27 Nov 20181359 tcpFTSRVftsrvlast updated 27 Nov 20181359 udpFTSRVftsrvlast updated 27 Nov 20181360 tcpMIMERmimerlast updated 27 Nov 20181360 udpMIMERmimerlast updated 27 Nov 20181361 tcpLinXlinxlast updated 27 Nov 20181361 udpLinXlinxlast updated 27 Nov 20181362 tcpTimeFliestimeflieslast updated 27 Nov 20181362 udpTimeFliestimeflieslast updated 27 Nov 20181363 tcpNetwork DataMover Requesterndm-requesterlast updated 27 Nov 20181363 udpNetwork DataMover Requesterndm-requesterlast updated 27 Nov 20181364 tcpNetwork DataMover Serverndm-serverlast updated 27 Nov 20181364 udpNetwork DataMover Serverndm-serverlast updated 27 Nov 20181365 tcpNetwork Software Associatesadapt-snalast updated 27 Nov 20181365 udpNetwork Software Associatesadapt-snalast updated 27 Nov 20181366 tcpNovell NetWare Comm Service Platformnetware-csplast updated 27 Nov 20181366 udpNovell NetWare Comm Service Platformnetware-csplast updated 27 Nov 20181367 tcpDCSdcslast updated 27 Nov 20181367 udpDCSdcslast updated 27 Nov 20181368 tcpScreenCastscreencastlast updated 27 Nov 20181368 udpScreenCastscreencastlast updated 27 Nov 20181369 tcpGlobalView to Unix Shellgv-uslast updated 27 Nov 20181369 udpGlobalView to Unix Shellgv-uslast updated 27 Nov 20181370 tcpUnix Shell to GlobalViewus-gvlast updated 27 Nov 20181370 udpUnix Shell to GlobalViewus-gvlast updated 27 Nov 20181371 tcpFujitsu Config Protocolfc-clilast updated 27 Nov 20181371 udpFujitsu Config Protocolfc-clilast updated 27 Nov 20181372 tcpFujitsu Config Protocolfc-serlast updated 27 Nov 20181372 udpFujitsu Config Protocolfc-serlast updated 27 Nov 20181373 tcpChromagrafxchromagrafxlast updated 27 Nov 20181373 udpChromagrafxchromagrafxlast updated 27 Nov 20181374 tcpEPI Software Systemsmollylast updated 27 Nov 20181374 udpEPI Software Systemsmollylast updated 27 Nov 20181375 tcpBytexbytexlast updated 27 Nov 20181375 udpBytexbytexlast updated 27 Nov 20181376 tcpIBM Person to Person Softwareibm-ppslast updated 27 Nov 20181376 udpIBM Person to Person Softwareibm-ppslast updated 27 Nov 20181377 tcpCichlid License Managercichlidlast updated 27 Nov 20181377 udpCichlid License Managercichlidlast updated 27 Nov 20181378 tcpElan License Managerelanlast updated 27 Nov 20181378 udpElan License Managerelanlast updated 27 Nov 20181379 tcpIntegrity Solutionsdbreporterlast updated 27 Nov 20181379 udpIntegrity Solutionsdbreporterlast updated 27 Nov 20181380 tcpTelesis Network License Managertelesis-licmanlast updated 27 Nov 20181380 udpTelesis Network License Managertelesis-licmanlast updated 27 Nov 20181381 tcpApple Network License Managerapple-licmanlast updated 27 Nov 20181381 udpApple Network License Managerapple-licmanlast updated 27 Nov 20181382 tcpudt_os IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 27 Nov 20181382 tcp (udt_os)udt_osudt_oslast updated 27 Nov 20181382 udpudt_os IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 27 Nov 20181382 udp (udt_os)udt_osudt_oslast updated 27 Nov 20181383 tcpGW Hannaway Network License Managergwhalast updated 27 Nov 20181383 udpGW Hannaway Network License Managergwhalast updated 27 Nov 20181384 tcpObjective Solutions License Manageros-licmanlast updated 27 Nov 20181384 udpObjective Solutions License Manageros-licmanlast updated 27 Nov 20181385 tcpAtex Publishing License Manager IANA assigned this well-formed service name as a replacement for "atex_elmd".atex-elmdlast updated 27 Nov 20181385 tcp (atex_elmd)Atex Publishing License Manageratex_elmdlast updated 27 Nov 20181385 udpAtex Publishing License Manager IANA assigned this well-formed service name as a replacement for "atex_elmd".atex-elmdlast updated 27 Nov 20181385 udp (atex_elmd)Atex Publishing License Manageratex_elmdlast updated 27 Nov 20181386 tcpCheckSum License Managerchecksumlast updated 27 Nov 20181386 udpCheckSum License Managerchecksumlast updated 27 Nov 20181387 tcpComputer Aided Design Software Inc LMcadsi-lmlast updated 27 Nov 20181387 udpComputer Aided Design Software Inc LMcadsi-lmlast updated 27 Nov 20181388 tcpObjective Solutions DataBase Cacheobjective-dbclast updated 27 Nov 20181388 udpObjective Solutions DataBase Cacheobjective-dbclast updated 27 Nov 20181389 tcpDocument Managericlpv-dmlast updated 27 Nov 20181389 udpDocument Managericlpv-dmlast updated 27 Nov 20181390 tcpStorage Controllericlpv-sclast updated 27 Nov 20181390 udpStorage Controllericlpv-sclast updated 27 Nov 20181391 tcpStorage Access Servericlpv-saslast updated 27 Nov 20181391 udpStorage Access Servericlpv-saslast updated 27 Nov 20181392 tcpPrint Managericlpv-pmlast updated 27 Nov 20181392 udpPrint Managericlpv-pmlast updated 27 Nov 20181393 tcpNetwork Log Servericlpv-nlslast updated 27 Nov 20181393 udpNetwork Log Servericlpv-nlslast updated 27 Nov 20181394 tcpNetwork Log Clienticlpv-nlclast updated 27 Nov 20181394 udpNetwork Log Clienticlpv-nlclast updated 27 Nov 20181395 tcpPC Workstation Manager softwareiclpv-wsmlast updated 27 Nov 20181395 udpPC Workstation Manager softwareiclpv-wsmlast updated 27 Nov 20181396 tcpDVL Active Maildvl-activemaillast updated 27 Nov 20181396 udpDVL Active Maildvl-activemaillast updated 27 Nov 20181397 tcpAudio Active Mailaudio-activmaillast updated 27 Nov 20181397 udpAudio Active Mailaudio-activmaillast updated 27 Nov 20181398 tcpVideo Active Mailvideo-activmaillast updated 27 Nov 20181398 udpVideo Active Mailvideo-activmaillast updated 27 Nov 20181399 tcpCadkey License Managercadkey-licmanlast updated 27 Nov 20181399 udpCadkey License Managercadkey-licmanlast updated 27 Nov 20181400 tcpCadkey Tablet Daemoncadkey-tabletlast updated 27 Nov 20181400 udpCadkey Tablet Daemoncadkey-tabletlast updated 27 Nov 20181401 tcpGoldleaf License Managergoldleaf-licmanlast updated 27 Nov 20181401 udpGoldleaf License Managergoldleaf-licmanlast updated 27 Nov 20181402 tcpProspero Resource Managerprm-sm-nplast updated 27 Nov 20181402 udpProspero Resource Managerprm-sm-nplast updated 27 Nov 20181403 tcpProspero Resource Managerprm-nm-nplast updated 27 Nov 20181403 udpProspero Resource Managerprm-nm-nplast updated 27 Nov 20181404 tcpInfinite Graphics License Managerigi-lmlast updated 27 Nov 20181404 udpInfinite Graphics License Managerigi-lmlast updated 27 Nov 20181405 tcpIBM Remote Execution Starteribm-reslast updated 27 Nov 20181405 udpIBM Remote Execution Starteribm-reslast updated 27 Nov 20181406 tcpNetLabs License Managernetlabs-lmlast updated 27 Nov 20181406 udpNetLabs License Managernetlabs-lmlast updated 27 Nov 20181407 tcpTIBET Data Servertibet-serverlast updated 27 Nov 20181407 udpReservedN/Alast updated 27 Nov 20181408 tcpSophia License Managersophia-lmlast updated 27 Nov 20181408 udpSophia License Managersophia-lmlast updated 27 Nov 20181409 tcpHere License Managerhere-lmlast updated 27 Nov 20181409 udpHere License Managerhere-lmlast updated 27 Nov 20181410 tcpHiQ License Managerhiqlast updated 27 Nov 20181410 udpHiQ License Managerhiqlast updated 27 Nov 20181411 tcpAudioFileaflast updated 27 Nov 20181411 udpAudioFileaflast updated 27 Nov 20181412 tcpInnoSysinnosyslast updated 27 Nov 20181412 udpInnoSysinnosyslast updated 27 Nov 20181413 tcpInnosys-ACLinnosys-acllast updated 27 Nov 20181413 udpInnosys-ACLinnosys-acllast updated 27 Nov 20181414 tcpIBM MQSeriesibm-mqserieslast updated 27 Nov 20181414 udpIBM MQSeriesibm-mqserieslast updated 27 Nov 20181415 tcpDBStardbstarlast updated 27 Nov 20181415 udpDBStardbstarlast updated 27 Nov 20181416 tcpNovell LU6.2 IANA assigned this well-formed service name as a replacement for "novell-lu6.2".novell-lu6-2last updated 27 Nov 20181416 tcp (Novell LU6.2)Novell LU6.2novell-lu6.2last updated 27 Nov 20181416 udpNovell LU6.2 IANA assigned this well-formed service name as a replacement for "novell-lu6.2".novell-lu6-2last updated 27 Nov 20181416 udp (Novell LU6.2)Novell LU6.2novell-lu6.2last updated 27 Nov 20181417 tcpTimbuktu Service 1 Porttimbuktu-srv1last updated 27 Nov 20181417 udpTimbuktu Service 1 Porttimbuktu-srv1last updated 27 Nov 20181418 tcpTimbuktu Service 2 Porttimbuktu-srv2last updated 27 Nov 20181418 udpTimbuktu Service 2 Porttimbuktu-srv2last updated 27 Nov 20181419 tcpTimbuktu Service 3 Porttimbuktu-srv3last updated 27 Nov 20181419 udpTimbuktu Service 3 Porttimbuktu-srv3last updated 27 Nov 20181420 tcpTimbuktu Service 4 Porttimbuktu-srv4last updated 27 Nov 20181420 udpTimbuktu Service 4 Porttimbuktu-srv4last updated 27 Nov 20181421 tcpGandalf License Managergandalf-lmlast updated 27 Nov 20181421 udpGandalf License Managergandalf-lmlast updated 27 Nov 20181422 tcpAutodesk License Managerautodesk-lmlast updated 27 Nov 20181422 udpAutodesk License Managerautodesk-lmlast updated 27 Nov 20181423 tcpEssbase Arbor Softwareessbaselast updated 27 Nov 20181423 udpEssbase Arbor Softwareessbaselast updated 27 Nov 20181424 tcpHybrid Encryption Protocolhybridlast updated 27 Nov 20181424 udpHybrid Encryption Protocolhybridlast updated 27 Nov 20181425 tcpZion Software License Managerzion-lmlast updated 27 Nov 20181425 udpZion Software License Managerzion-lmlast updated 27 Nov 20181426 tcpSatellite-data Acquisition System 1saislast updated 27 Nov 20181426 udpSatellite-data Acquisition System 1saislast updated 27 Nov 20181427 tcpmloadd monitoring toolmloaddlast updated 27 Nov 20181427 udpmloadd monitoring toolmloaddlast updated 27 Nov 20181428 tcpInformatik License Managerinformatik-lmlast updated 27 Nov 20181428 udpInformatik License Managerinformatik-lmlast updated 27 Nov 20181429 tcpHypercom NMSnmslast updated 27 Nov 20181429 udpHypercom NMSnmslast updated 27 Nov 20181430 tcpHypercom TPDUtpdulast updated 27 Nov 20181430 udpHypercom TPDUtpdulast updated 27 Nov 20181431 tcpReverse Gossip Transportrgtplast updated 27 Nov 20181431 udpReverse Gossip Transportrgtplast updated 27 Nov 20181432 tcpBlueberry Software License Managerblueberry-lmlast updated 27 Nov 20181432 udpBlueberry Software License Managerblueberry-lmlast updated 27 Nov 20181433 tcpMicrosoft-SQL-Serverms-sql-slast updated 27 Nov 20181433 udpMicrosoft-SQL-Serverms-sql-slast updated 27 Nov 20181434 tcpMicrosoft-SQL-Monitorms-sql-mlast updated 27 Nov 20181434 udpMicrosoft-SQL-Monitorms-sql-mlast updated 27 Nov 20181435 tcpIBM CICSibm-cicslast updated 27 Nov 20181435 udpIBM CICSibm-cicslast updated 27 Nov 20181436 tcpSatellite-data Acquisition System 2saismlast updated 27 Nov 20181436 udpSatellite-data Acquisition System 2saismlast updated 27 Nov 20181437 tcpTabulatabulalast updated 27 Nov 20181437 udpTabulatabulalast updated 27 Nov 20181438 tcpEicon Security Agent/Servereicon-serverlast updated 27 Nov 20181438 udpEicon Security Agent/Servereicon-serverlast updated 27 Nov 20181439 tcpEicon X25/SNA Gatewayeicon-x25last updated 27 Nov 20181439 udpEicon X25/SNA Gatewayeicon-x25last updated 27 Nov 20181440 tcpEicon Service Location Protocoleicon-slplast updated 27 Nov 20181440 udpEicon Service Location Protocoleicon-slplast updated 27 Nov 20181441 tcpCadis License Managementcadis-1last updated 27 Nov 20181441 udpCadis License Managementcadis-1last updated 27 Nov 20181442 tcpCadis License Managementcadis-2last updated 27 Nov 20181442 udpCadis License Managementcadis-2last updated 27 Nov 20181443 tcpIntegrated Engineering Softwareies-lmlast updated 27 Nov 20181443 udpIntegrated Engineering Softwareies-lmlast updated 27 Nov 20181444 tcpMarcam License Managementmarcam-lmlast updated 27 Nov 20181444 udpMarcam License Managementmarcam-lmlast updated 27 Nov 20181445 tcpProxima License Managerproxima-lmlast updated 27 Nov 20181445 udpProxima License Managerproxima-lmlast updated 27 Nov 20181446 tcpOptical Research Associates License Managerora-lmlast updated 27 Nov 20181446 udpOptical Research Associates License Managerora-lmlast updated 27 Nov 20181447 tcpApplied Parallel Research LMapri-lmlast updated 27 Nov 20181447 udpApplied Parallel Research LMapri-lmlast updated 27 Nov 20181448 tcpOpenConnect License Manageroc-lmlast updated 27 Nov 20181448 udpOpenConnect License Manageroc-lmlast updated 27 Nov 20181449 tcpPEportpeportlast updated 27 Nov 20181449 udpPEportpeportlast updated 27 Nov 20181450 tcpTandem Distributed Workbench Facilitydwflast updated 27 Nov 20181450 udpTandem Distributed Workbench Facilitydwflast updated 27 Nov 20181451 tcpIBM Information Managementinfomanlast updated 27 Nov 20181451 udpIBM Information Managementinfomanlast updated 27 Nov 20181452 tcpGTE Government Systems License Mangtegsc-lmlast updated 27 Nov 20181452 udpGTE Government Systems License Mangtegsc-lmlast updated 27 Nov 20181453 tcpGenie License Managergenie-lmlast updated 27 Nov 20181453 udpGenie License Managergenie-lmlast updated 27 Nov 20181454 tcpinterHDL License Manager IANA assigned this well-formed service name as a replacement for "interhdl_elmd".interhdl-elmdlast updated 27 Nov 20181454 tcp (interhdl_elmd)interHDL License Managerinterhdl_elmdlast updated 27 Nov 20181454 udpinterHDL License Manager IANA assigned this well-formed service name as a replacement for "interhdl_elmd".interhdl-elmdlast updated 27 Nov 20181454 udp (interhdl_elmd)interHDL License Managerinterhdl_elmdlast updated 27 Nov 20181455 tcpESL License Manageresl-lmlast updated 27 Nov 20181455 udpESL License Manageresl-lmlast updated 27 Nov 20181456 tcpDCAdcalast updated 27 Nov 20181456 udpDCAdcalast updated 27 Nov 20181457 tcpValisys License Managervalisys-lmlast updated 27 Nov 20181457 udpValisys License Managervalisys-lmlast updated 27 Nov 20181458 tcpNichols Research Corp.nrcabq-lmlast updated 27 Nov 20181458 udpNichols Research Corp.nrcabq-lmlast updated 27 Nov 20181459 tcpProshare Notebook Applicationproshare1last updated 27 Nov 20181459 udpProshare Notebook Applicationproshare1last updated 27 Nov 20181460 tcpProshare Notebook Applicationproshare2last updated 27 Nov 20181460 udpProshare Notebook Applicationproshare2last updated 27 Nov 20181461 tcpIBM Wireless LAN IANA assigned this well-formed service name as a replacement for "ibm_wrless_lan".ibm-wrless-lanlast updated 27 Nov 20181461 tcp (ibm_wrless_lan)IBM Wireless LANibm_wrless_lanlast updated 27 Nov 20181461 udpIBM Wireless LAN IANA assigned this well-formed service name as a replacement for "ibm_wrless_lan".ibm-wrless-lanlast updated 27 Nov 20181461 udp (ibm_wrless_lan)IBM Wireless LANibm_wrless_lanlast updated 27 Nov 20181462 tcpWorld License Managerworld-lmlast updated 27 Nov 20181462 udpWorld License Managerworld-lmlast updated 27 Nov 20181463 tcpNucleusnucleuslast updated 27 Nov 20181463 udpNucleusnucleuslast updated 27 Nov 20181464 tcpMSL License Manager IANA assigned this well-formed service name as a replacement for "msl_lmd".msl-lmdlast updated 27 Nov 20181464 tcp (msl_lmd)MSL License Managermsl_lmdlast updated 27 Nov 20181464 udpMSL License Manager IANA assigned this well-formed service name as a replacement for "msl_lmd".msl-lmdlast updated 27 Nov 20181464 udp (msl_lmd)MSL License Managermsl_lmdlast updated 27 Nov 20181465 tcpPipes Platformpipeslast updated 27 Nov 20181465 udpPipes Platformpipeslast updated 27 Nov 20181466 tcpOcean Software License Manageroceansoft-lmlast updated 27 Nov 20181466 udpOcean Software License Manageroceansoft-lmlast updated 27 Nov 20181467 tcpCSDMBASEcsdmbaselast updated 27 Nov 20181467 udpCSDMBASEcsdmbaselast updated 27 Nov 20181468 tcpCSDMcsdmlast updated 27 Nov 20181468 udpCSDMcsdmlast updated 27 Nov 20181469 tcpActive Analysis Limited License Manageraal-lmlast updated 27 Nov 20181469 udpActive Analysis Limited License Manageraal-lmlast updated 27 Nov 20181470 tcpUniversal Analyticsuaiactlast updated 27 Nov 20181470 udpUniversal Analyticsuaiactlast updated 27 Nov 20181471 tcpcsdmbasecsdmbaselast updated 27 Nov 20181471 udpcsdmbasecsdmbaselast updated 27 Nov 20181472 tcpcsdmcsdmlast updated 27 Nov 20181472 udpcsdmcsdmlast updated 27 Nov 20181473 tcpOpenMathopenmathlast updated 27 Nov 20181473 udpOpenMathopenmathlast updated 27 Nov 20181474 tcpTelefindertelefinderlast updated 27 Nov 20181474 udpTelefindertelefinderlast updated 27 Nov 20181475 tcpTaligent License Managertaligent-lmlast updated 27 Nov 20181475 udpTaligent License Managertaligent-lmlast updated 27 Nov 20181476 tcpclvm-cfgclvm-cfglast updated 27 Nov 20181476 udpclvm-cfgclvm-cfglast updated 27 Nov 20181477 tcpms-sna-serverms-sna-serverlast updated 27 Nov 20181477 udpms-sna-serverms-sna-serverlast updated 27 Nov 20181478 tcpms-sna-basems-sna-baselast updated 27 Nov 20181478 udpms-sna-basems-sna-baselast updated 27 Nov 20181479 tcpdberegisterdberegisterlast updated 27 Nov 20181479 udpdberegisterdberegisterlast updated 27 Nov 20181480 tcpPacerForumpacerforumlast updated 27 Nov 20181480 udpPacerForumpacerforumlast updated 27 Nov 20181481 tcpAIRSairslast updated 27 Nov 20181481 udpAIRSairslast updated 27 Nov 20181482 tcpMiteksys License Managermiteksys-lmlast updated 27 Nov 20181482 udpMiteksys License Managermiteksys-lmlast updated 27 Nov 20181483 tcpAFS License Managerafslast updated 27 Nov 20181483 udpAFS License Managerafslast updated 27 Nov 20181484 tcpConfluent License Managerconfluentlast updated 27 Nov 20181484 udpConfluent License Managerconfluentlast updated 27 Nov 20181485 tcpLANSourcelansourcelast updated 27 Nov 20181485 udpLANSourcelansourcelast updated 27 Nov 20181486 tcpnms_topo_serv IANA assigned this well-formed service name as a replacement for "nms_topo_serv".nms-topo-servlast updated 27 Nov 20181486 tcp (nms_topo_serv)nms_topo_servnms_topo_servlast updated 27 Nov 20181486 udpnms_topo_serv IANA assigned this well-formed service name as a replacement for "nms_topo_serv".nms-topo-servlast updated 27 Nov 20181486 udp (nms_topo_serv)nms_topo_servnms_topo_servlast updated 27 Nov 20181487 tcpLocalInfoSrvrlocalinfosrvrlast updated 27 Nov 20181487 udpLocalInfoSrvrlocalinfosrvrlast updated 27 Nov 20181488 tcpDocStordocstorlast updated 27 Nov 20181488 udpDocStordocstorlast updated 27 Nov 20181489 tcpdmdocbrokerdmdocbrokerlast updated 27 Nov 20181489 udpdmdocbrokerdmdocbrokerlast updated 27 Nov 20181490 tcpinsitu-confinsitu-conflast updated 27 Nov 20181490 udpinsitu-confinsitu-conflast updated 27 Nov 20181491 UnassignedN/Alast updated 27 Nov 20181492 tcpstone-design-1stone-design-1last updated 27 Nov 20181492 udpstone-design-1stone-design-1last updated 27 Nov 20181493 tcpnetmap_lm IANA assigned this well-formed service name as a replacement for "netmap_lm".netmap-lmlast updated 27 Nov 20181493 tcp (netmap_lm)netmap_lmnetmap_lmlast updated 27 Nov 20181493 udpnetmap_lm IANA assigned this well-formed service name as a replacement for "netmap_lm".netmap-lmlast updated 27 Nov 20181493 udp (netmap_lm)netmap_lmnetmap_lmlast updated 27 Nov 20181494 tcpicaicalast updated 27 Nov 20181494 udpicaicalast updated 27 Nov 20181495 tcpcvccvclast updated 27 Nov 20181495 udpcvccvclast updated 27 Nov 20181496 tcpliberty-lmliberty-lmlast updated 27 Nov 20181496 udpliberty-lmliberty-lmlast updated 27 Nov 20181497 tcprfx-lmrfx-lmlast updated 27 Nov 20181497 udprfx-lmrfx-lmlast updated 27 Nov 20181498 tcpSybase SQL Anysybase-sqlanylast updated 27 Nov 20181498 udpSybase SQL Anysybase-sqlanylast updated 27 Nov 20181499 tcpFederico Heinz Consultorafhclast updated 27 Nov 20181499 udpFederico Heinz Consultorafhclast updated 27 Nov 20181500 tcpVLSI License Managervlsi-lmlast updated 27 Nov 20181500 udpVLSI License Managervlsi-lmlast updated 27 Nov 20181501 tcpSatellite-data Acquisition System 3saiscmlast updated 27 Nov 20181501 udpSatellite-data Acquisition System 3saiscmlast updated 27 Nov 20181502 tcpShivashivadiscoverylast updated 27 Nov 20181502 udpShivashivadiscoverylast updated 27 Nov 20181503 tcpDatabeamimtc-mcslast updated 27 Nov 20181503 udpDatabeamimtc-mcslast updated 27 Nov 20181504 tcpEVB Software Engineering License Managerevb-elmlast updated 27 Nov 20181504 udpEVB Software Engineering License Managerevb-elmlast updated 27 Nov 20181505 tcpFunk Software, Inc.funkproxylast updated 27 Nov 20181505 udpFunk Software, Inc.funkproxylast updated 27 Nov 20181506 tcpUniversal Time daemon (utcd)utcdlast updated 27 Nov 20181506 udpUniversal Time daemon (utcd)utcdlast updated 27 Nov 20181507 tcpsymplexsymplexlast updated 27 Nov 20181507 udpsymplexsymplexlast updated 27 Nov 20181508 tcpdiagmonddiagmondlast updated 27 Nov 20181508 udpdiagmonddiagmondlast updated 27 Nov 20181509 tcpRobcad, Ltd. License Managerrobcad-lmlast updated 27 Nov 20181509 udpRobcad, Ltd. License Managerrobcad-lmlast updated 27 Nov 20181510 tcpMidland Valley Exploration Ltd. Lic. Man.mvx-lmlast updated 27 Nov 20181510 udpMidland Valley Exploration Ltd. Lic. Man.mvx-lmlast updated 27 Nov 20181511 tcp3l-l13l-l1last updated 27 Nov 20181511 udp3l-l13l-l1last updated 27 Nov 20181512 tcpMicrosoft's Windows Internet Name Servicewinslast updated 27 Nov 20181512 udpMicrosoft's Windows Internet Name Servicewinslast updated 27 Nov 20181513 tcpFujitsu Systems Business of America, Incfujitsu-dtclast updated 27 Nov 20181513 udpFujitsu Systems Business of America, Incfujitsu-dtclast updated 27 Nov 20181514 tcpFujitsu Systems Business of America, Incfujitsu-dtcnslast updated 27 Nov 20181514 udpFujitsu Systems Business of America, Incfujitsu-dtcnslast updated 27 Nov 20181515 tcpifor-protocolifor-protocollast updated 27 Nov 20181515 udpifor-protocolifor-protocollast updated 27 Nov 20181516 tcpVirtual Places Audio datavpadlast updated 27 Nov 20181516 udpVirtual Places Audio datavpadlast updated 27 Nov 20181517 tcpVirtual Places Audio controlvpaclast updated 27 Nov 20181517 udpVirtual Places Audio controlvpaclast updated 27 Nov 20181518 tcpVirtual Places Video datavpvdlast updated 27 Nov 20181518 udpVirtual Places Video datavpvdlast updated 27 Nov 20181519 tcpVirtual Places Video controlvpvclast updated 27 Nov 20181519 udpVirtual Places Video controlvpvclast updated 27 Nov 20181520 tcpatm zip officeatm-zip-officelast updated 27 Nov 20181520 udpatm zip officeatm-zip-officelast updated 27 Nov 20181521 tcpnCube License Managerncube-lmlast updated 27 Nov 20181521 udpnCube License Managerncube-lmlast updated 27 Nov 20181522 tcpRicardo North America License Managerricardo-lmlast updated 27 Nov 20181522 udpRicardo North America License Managerricardo-lmlast updated 27 Nov 20181523 tcpcichildcichild-lmlast updated 27 Nov 20181523 udpcichildcichild-lmlast updated 27 Nov 20181524 tcpingresingreslocklast updated 27 Nov 20181524 udpingresingreslocklast updated 27 Nov 20181525 tcporacleorasrvlast updated 27 Nov 20181525 udporacleorasrvlast updated 27 Nov 20181525 tcp (prospero-np)Prospero Directory Service non-privprospero-nplast updated 27 Nov 20181525 udp (prospero-np)Prospero Directory Service non-privprospero-nplast updated 27 Nov 20181526 tcpProspero Data Access Prot non-privpdap-nplast updated 27 Nov 20181526 udpProspero Data Access Prot non-privpdap-nplast updated 27 Nov 20181527 tcporacletlisrvlast updated 27 Nov 20181527 udporacletlisrvlast updated 27 Nov 20181528 tcpReservedN/Alast updated 27 Nov 20181528 udpNGR transport protocol for mobile ad-hoc networksngr-tlast updated 27 Nov 20181529 tcporaclecoauthorlast updated 27 Nov 20181529 udporaclecoauthorlast updated 27 Nov 20181530 tcprap-servicerap-servicelast updated 27 Nov 20181530 udprap-servicerap-servicelast updated 27 Nov 20181531 tcprap-listenrap-listenlast updated 27 Nov 20181531 udprap-listenrap-listenlast updated 27 Nov 20181532 tcpmiroconnectmiroconnectlast updated 27 Nov 20181532 udpmiroconnectmiroconnectlast updated 27 Nov 20181533 tcpVirtual Places Softwarevirtual-placeslast updated 27 Nov 20181533 udpVirtual Places Softwarevirtual-placeslast updated 27 Nov 20181534 tcpmicromuse-lmmicromuse-lmlast updated 27 Nov 20181534 udpmicromuse-lmmicromuse-lmlast updated 27 Nov 20181535 tcpampr-infoampr-infolast updated 27 Nov 20181535 udpampr-infoampr-infolast updated 27 Nov 20181536 tcpampr-interampr-interlast updated 27 Nov 20181536 udpampr-interampr-interlast updated 27 Nov 20181537 tcpisi-lmsdsc-lmlast updated 27 Nov 20181537 udpisi-lmsdsc-lmlast updated 27 Nov 20181538 tcp3ds-lm3ds-lmlast updated 27 Nov 20181538 udp3ds-lm3ds-lmlast updated 27 Nov 20181539 tcpIntellistor License Managerintellistor-lmlast updated 27 Nov 20181539 udpIntellistor License Managerintellistor-lmlast updated 27 Nov 20181540 tcprdsrdslast updated 27 Nov 20181540 udprdsrdslast updated 27 Nov 20181541 tcprds2rds2last updated 27 Nov 20181541 udprds2rds2last updated 27 Nov 20181542 tcpgridgen-elmdgridgen-elmdlast updated 27 Nov 20181542 udpgridgen-elmdgridgen-elmdlast updated 27 Nov 20181543 tcpsimba-cssimba-cslast updated 27 Nov 20181543 udpsimba-cssimba-cslast updated 27 Nov 20181544 tcpaspeclmdaspeclmdlast updated 27 Nov 20181544 udpaspeclmdaspeclmdlast updated 27 Nov 20181545 tcpvistium-sharevistium-sharelast updated 27 Nov 20181545 udpvistium-sharevistium-sharelast updated 27 Nov 20181546 tcpabbaccurayabbaccuraylast updated 27 Nov 20181546 udpabbaccurayabbaccuraylast updated 27 Nov 20181547 tcplaplinklaplinklast updated 27 Nov 20181547 udplaplinklaplinklast updated 27 Nov 20181548 tcpAxon License Manageraxon-lmlast updated 27 Nov 20181548 udpAxon License Manageraxon-lmlast updated 27 Nov 20181549 tcpShiva Hoseshivahoselast updated 27 Nov 20181549 udpShiva Soundshivasoundlast updated 27 Nov 20181550 tcpImage Storage license manager 3M Company3m-image-lmlast updated 27 Nov 20181550 udpImage Storage license manager 3M Company3m-image-lmlast updated 27 Nov 20181551 tcpHECMTL-DBhecmtl-dblast updated 27 Nov 20181551 udpHECMTL-DBhecmtl-dblast updated 27 Nov 20181552 tcppciarraypciarraylast updated 27 Nov 20181552 udppciarraypciarraylast updated 27 Nov 20181553 tcpsna-cssna-cslast updated 27 Nov 20181553 udpsna-cssna-cslast updated 27 Nov 20181554 tcpCACI Products Company License Managercaci-lmlast updated 27 Nov 20181554 udpCACI Products Company License Managercaci-lmlast updated 27 Nov 20181555 tcplivelanlivelanlast updated 27 Nov 20181555 udplivelanlivelanlast updated 27 Nov 20181556 tcpVERITAS Private Branch Exchange IANA assigned this well-formed service name as a replacement for "veritas_pbx".veritas-pbxlast updated 27 Nov 20181556 tcp (veritas_pbx)VERITAS Private Branch Exchangeveritas_pbxlast updated 27 Nov 20181556 udpVERITAS Private Branch Exchange IANA assigned this well-formed service name as a replacement for "veritas_pbx".veritas-pbxlast updated 27 Nov 20181556 udp (veritas_pbx)VERITAS Private Branch Exchangeveritas_pbxlast updated 27 Nov 20181557 tcpArborText License Managerarbortext-lmlast updated 27 Nov 20181557 udpArborText License Managerarbortext-lmlast updated 27 Nov 20181558 tcpxingmpegxingmpeglast updated 27 Nov 20181558 udpxingmpegxingmpeglast updated 27 Nov 20181559 tcpweb2hostweb2hostlast updated 27 Nov 20181559 udpweb2hostweb2hostlast updated 27 Nov 20181560 tcpASCI-RemoteSHADOWasci-vallast updated 27 Nov 20181560 udpASCI-RemoteSHADOWasci-vallast updated 27 Nov 20181561 tcpfacilityviewfacilityviewlast updated 27 Nov 20181561 udpfacilityviewfacilityviewlast updated 27 Nov 20181562 tcppconnectmgrpconnectmgrlast updated 27 Nov 20181562 udppconnectmgrpconnectmgrlast updated 27 Nov 20181563 tcpCadabra License Managercadabra-lmlast updated 27 Nov 20181563 udpCadabra License Managercadabra-lmlast updated 27 Nov 20181564 tcpPay-Per-Viewpay-per-viewlast updated 27 Nov 20181564 udpPay-Per-Viewpay-per-viewlast updated 27 Nov 20181565 tcpWinDDwinddlblast updated 27 Nov 20181565 udpWinDDwinddlblast updated 27 Nov 20181566 tcpCORELVIDEOcorelvideolast updated 27 Nov 20181566 udpCORELVIDEOcorelvideolast updated 27 Nov 20181567 tcpjlicelmdjlicelmdlast updated 27 Nov 20181567 udpjlicelmdjlicelmdlast updated 27 Nov 20181568 tcptsspmaptsspmaplast updated 27 Nov 20181568 udptsspmaptsspmaplast updated 27 Nov 20181569 tcpetsetslast updated 27 Nov 20181569 udpetsetslast updated 27 Nov 20181570 tcporbixdorbixdlast updated 27 Nov 20181570 udporbixdorbixdlast updated 27 Nov 20181571 tcpOracle Remote Data Baserdb-dbs-displast updated 27 Nov 20181571 udpOracle Remote Data Baserdb-dbs-displast updated 27 Nov 20181572 tcpChipcom License Managerchip-lmlast updated 27 Nov 20181572 udpChipcom License Managerchip-lmlast updated 27 Nov 20181573 tcpitscomm-nsitscomm-nslast updated 27 Nov 20181573 udpitscomm-nsitscomm-nslast updated 27 Nov 20181574 tcpmvel-lmmvel-lmlast updated 27 Nov 20181574 udpmvel-lmmvel-lmlast updated 27 Nov 20181575 tcporaclenamesoraclenameslast updated 27 Nov 20181575 udporaclenamesoraclenameslast updated 27 Nov 20181576 tcpMoldflow License Managermoldflow-lmlast updated 27 Nov 20181576 udpMoldflow License Managermoldflow-lmlast updated 27 Nov 20181577 tcphypercube-lmhypercube-lmlast updated 27 Nov 20181577 udphypercube-lmhypercube-lmlast updated 27 Nov 20181578 tcpJacobus License Managerjacobus-lmlast updated 27 Nov 20181578 udpJacobus License Managerjacobus-lmlast updated 27 Nov 20181579 tcpioc-sea-lmioc-sea-lmlast updated 27 Nov 20181579 udpioc-sea-lmioc-sea-lmlast updated 27 Nov 20181580 tcptn-tl-r1tn-tl-r1last updated 27 Nov 20181580 udptn-tl-r2tn-tl-r2last updated 27 Nov 20181581 tcpMIL-2045-47001mil-2045-47001last updated 27 Nov 20181581 udpMIL-2045-47001mil-2045-47001last updated 27 Nov 20181582 tcpMSIMSmsimslast updated 27 Nov 20181582 udpMSIMSmsimslast updated 27 Nov 20181583 tcpsimbaexpresssimbaexpresslast updated 27 Nov 20181583 udpsimbaexpresssimbaexpresslast updated 27 Nov 20181584 tcptn-tl-fd2tn-tl-fd2last updated 27 Nov 20181584 udptn-tl-fd2tn-tl-fd2last updated 27 Nov 20181585 tcpintvintvlast updated 27 Nov 20181585 udpintvintvlast updated 27 Nov 20181586 tcpibm-abtactibm-abtactlast updated 27 Nov 20181586 udpibm-abtactibm-abtactlast updated 27 Nov 20181587 tcppra_elmd IANA assigned this well-formed service name as a replacement for "pra_elmd".pra-elmdlast updated 27 Nov 20181587 tcp (pra_elmd)pra_elmdpra_elmdlast updated 27 Nov 20181587 udppra_elmd IANA assigned this well-formed service name as a replacement for "pra_elmd".pra-elmdlast updated 27 Nov 20181587 udp (pra_elmd)pra_elmdpra_elmdlast updated 27 Nov 20181588 tcptriquest-lmtriquest-lmlast updated 27 Nov 20181588 udptriquest-lmtriquest-lmlast updated 27 Nov 20181589 tcpVQPvqplast updated 27 Nov 20181589 udpVQPvqplast updated 27 Nov 20181590 tcpgemini-lmgemini-lmlast updated 27 Nov 20181590 udpgemini-lmgemini-lmlast updated 27 Nov 20181591 tcpncpm-pmncpm-pmlast updated 27 Nov 20181591 udpncpm-pmncpm-pmlast updated 27 Nov 20181592 tcpcommonspacecommonspacelast updated 27 Nov 20181592 udpcommonspacecommonspacelast updated 27 Nov 20181593 tcpmainsoft-lmmainsoft-lmlast updated 27 Nov 20181593 udpmainsoft-lmmainsoft-lmlast updated 27 Nov 20181594 tcpsixtraksixtraklast updated 27 Nov 20181594 udpsixtraksixtraklast updated 27 Nov 20181595 tcpradioradiolast updated 27 Nov 20181595 udpradioradiolast updated 27 Nov 20181596 tcpradio-smradio-smlast updated 27 Nov 20181596 udpradio-bcradio-bclast updated 27 Nov 20181597 tcporbplus-iioporbplus-iioplast updated 27 Nov 20181597 udporbplus-iioporbplus-iioplast updated 27 Nov 20181598 tcppicknfspicknfslast updated 27 Nov 20181598 udppicknfspicknfslast updated 27 Nov 20181599 tcpsimbaservicessimbaserviceslast updated 27 Nov 20181599 udpsimbaservicessimbaserviceslast updated 27 Nov 20181600 tcpissdissdlast updated 27 Nov 20181600 udpissdissdlast updated 27 Nov 20181601 tcpaasaaslast updated 27 Nov 20181601 udpaasaaslast updated 27 Nov 20181602 tcpinspectinspectlast updated 27 Nov 20181602 udpinspectinspectlast updated 27 Nov 20181603 tcppickodbcpicodbclast updated 27 Nov 20181603 udppickodbcpicodbclast updated 27 Nov 20181604 tcpicabrowsericabrowserlast updated 27 Nov 20181604 udpicabrowsericabrowserlast updated 27 Nov 20181605 tcpSalutation Manager (Salutation Protocol)slplast updated 27 Nov 20181605 udpSalutation Manager (Salutation Protocol)slplast updated 27 Nov 20181606 tcpSalutation Manager (SLM-API)slm-apilast updated 27 Nov 20181606 udpSalutation Manager (SLM-API)slm-apilast updated 27 Nov 20181607 tcpsttsttlast updated 27 Nov 20181607 udpsttsttlast updated 27 Nov 20181608 tcpSmart Corp. License Managersmart-lmlast updated 27 Nov 20181608 udpSmart Corp. License Managersmart-lmlast updated 27 Nov 20181609 tcpisysg-lmisysg-lmlast updated 27 Nov 20181609 udpisysg-lmisysg-lmlast updated 27 Nov 20181610 tcptaurus-whtaurus-whlast updated 27 Nov 20181610 udptaurus-whtaurus-whlast updated 27 Nov 20181611 tcpInter Library Loanilllast updated 27 Nov 20181611 udpInter Library Loanilllast updated 27 Nov 20181612 tcpNetBill Transaction Servernetbill-translast updated 27 Nov 20181612 udpNetBill Transaction Servernetbill-translast updated 27 Nov 20181613 tcpNetBill Key Repositorynetbill-keyreplast updated 27 Nov 20181613 udpNetBill Key Repositorynetbill-keyreplast updated 27 Nov 20181614 tcpNetBill Credential Servernetbill-credlast updated 27 Nov 20181614 udpNetBill Credential Servernetbill-credlast updated 27 Nov 20181615 tcpNetBill Authorization Servernetbill-authlast updated 27 Nov 20181615 udpNetBill Authorization Servernetbill-authlast updated 27 Nov 20181616 tcpNetBill Product Servernetbill-prodlast updated 27 Nov 20181616 udpNetBill Product Servernetbill-prodlast updated 27 Nov 20181617 tcpNimrod Inter-Agent Communicationnimrod-agentlast updated 27 Nov 20181617 udpNimrod Inter-Agent Communicationnimrod-agentlast updated 27 Nov 20181618 tcpskytelnetskytelnetlast updated 27 Nov 20181618 udpskytelnetskytelnetlast updated 27 Nov 20181619 tcpxs-openstoragexs-openstoragelast updated 27 Nov 20181619 udpxs-openstoragexs-openstoragelast updated 27 Nov 20181620 tcpfaxportwinportfaxportwinportlast updated 27 Nov 20181620 udpfaxportwinportfaxportwinportlast updated 27 Nov 20181621 tcpsoftdataphonesoftdataphonelast updated 27 Nov 20181621 udpsoftdataphonesoftdataphonelast updated 27 Nov 20181622 tcpontimeontimelast updated 27 Nov 20181622 udpontimeontimelast updated 27 Nov 20181623 tcpjaleosndjaleosndlast updated 27 Nov 20181623 udpjaleosndjaleosndlast updated 27 Nov 20181624 tcpudp-sr-portudp-sr-portlast updated 27 Nov 20181624 udpudp-sr-portudp-sr-portlast updated 27 Nov 20181625 tcpsvs-omagentsvs-omagentlast updated 27 Nov 20181625 udpsvs-omagentsvs-omagentlast updated 27 Nov 20181626 tcpShockwaveshockwavelast updated 27 Nov 20181626 udpShockwaveshockwavelast updated 27 Nov 20181627 tcpT.128 Gatewayt128-gatewaylast updated 27 Nov 20181627 udpT.128 Gatewayt128-gatewaylast updated 27 Nov 20181628 tcpLonTalk normallontalk-normlast updated 27 Nov 20181628 udpLonTalk normallontalk-normlast updated 27 Nov 20181629 tcpLonTalk urgentlontalk-urgntlast updated 27 Nov 20181629 udpLonTalk urgentlontalk-urgntlast updated 27 Nov 20181630 tcpOracle Net8 Cmanoraclenet8cmanlast updated 27 Nov 20181630 udpOracle Net8 Cmanoraclenet8cmanlast updated 27 Nov 20181631 tcpVisit viewvisitviewlast updated 27 Nov 20181631 udpVisit viewvisitviewlast updated 27 Nov 20181632 tcpPAMMRATCpammratclast updated 27 Nov 20181632 udpPAMMRATCpammratclast updated 27 Nov 20181633 tcpPAMMRPCpammrpclast updated 27 Nov 20181633 udpPAMMRPCpammrpclast updated 27 Nov 20181634 tcpLog On America Probeloaprobelast updated 27 Nov 20181634 udpLog On America Probeloaprobelast updated 27 Nov 20181635 tcpEDB Server 1edb-server1last updated 27 Nov 20181635 udpEDB Server 1edb-server1last updated 27 Nov 20181636 tcpISP shared public data controlisdclast updated 27 Nov 20181636 udpISP shared public data controlisdclast updated 27 Nov 20181637 tcpISP shared local data controlislclast updated 27 Nov 20181637 udpISP shared local data controlislclast updated 27 Nov 20181638 tcpISP shared management controlismclast updated 27 Nov 20181638 udpISP shared management controlismclast updated 27 Nov 20181639 tcpcert-initiatorcert-initiatorlast updated 27 Nov 20181639 udpcert-initiatorcert-initiatorlast updated 27 Nov 20181640 tcpcert-respondercert-responderlast updated 27 Nov 20181640 udpcert-respondercert-responderlast updated 27 Nov 20181641 tcpInVisioninvisionlast updated 27 Nov 20181641 udpInVisioninvisionlast updated 27 Nov 20181642 tcpisis-amisis-amlast updated 27 Nov 20181642 udpisis-amisis-amlast updated 27 Nov 20181643 tcpisis-ambcisis-ambclast updated 27 Nov 20181643 udpisis-ambcisis-ambclast updated 27 Nov 20181644 tcpSatellite-data Acquisition System 4saisehlast updated 27 Nov 20181644 udpSatellite-data Acquisition System 4saisehlast updated 27 Nov 20181645 tcpSightLinesightlinelast updated 27 Nov 20181645 udpSightLinesightlinelast updated 27 Nov 20181646 tcpsa-msg-portsa-msg-portlast updated 27 Nov 20181646 udpsa-msg-portsa-msg-portlast updated 27 Nov 20181647 tcprsaprsaplast updated 27 Nov 20181647 udprsaprsaplast updated 27 Nov 20181648 tcpconcurrent-lmconcurrent-lmlast updated 27 Nov 20181648 udpconcurrent-lmconcurrent-lmlast updated 27 Nov 20181649 tcpkermitkermitlast updated 27 Nov 20181649 udpkermitkermitlast updated 27 Nov 20181650 tcpnkdnnkdlast updated 27 Nov 20181650 udpnkdnkdlast updated 27 Nov 20181651 tcpshiva_confsrvr IANA assigned this well-formed service name as a replacement for "shiva_confsrvr".shiva-confsrvrlast updated 27 Nov 20181651 tcp (shiva_confsrvr)shiva_confsrvrshiva_confsrvrlast updated 27 Nov 20181651 udpshiva_confsrvr IANA assigned this well-formed service name as a replacement for "shiva_confsrvr".shiva-confsrvrlast updated 27 Nov 20181651 udp (shiva_confsrvr)shiva_confsrvrshiva_confsrvrlast updated 27 Nov 20181652 tcpxnmpxnmplast updated 27 Nov 20181652 udpxnmpxnmplast updated 27 Nov 20181653 tcpalphatech-lmalphatech-lmlast updated 27 Nov 20181653 udpalphatech-lmalphatech-lmlast updated 27 Nov 20181654 tcpstargatealertsstargatealertslast updated 27 Nov 20181654 udpstargatealertsstargatealertslast updated 27 Nov 20181655 tcpdec-mbadmindec-mbadminlast updated 27 Nov 20181655 udpdec-mbadmindec-mbadminlast updated 27 Nov 20181656 tcpdec-mbadmin-hdec-mbadmin-hlast updated 27 Nov 20181656 udpdec-mbadmin-hdec-mbadmin-hlast updated 27 Nov 20181657 tcpfujitsu-mmpdcfujitsu-mmpdclast updated 27 Nov 20181657 udpfujitsu-mmpdcfujitsu-mmpdclast updated 27 Nov 20181658 tcpsixnetudrsixnetudrlast updated 27 Nov 20181658 udpsixnetudrsixnetudrlast updated 27 Nov 20181659 tcpSilicon Grail License Managersg-lmlast updated 27 Nov 20181659 udpSilicon Grail License Managersg-lmlast updated 27 Nov 20181660 tcpskip-mc-gikreqskip-mc-gikreqlast updated 27 Nov 20181660 udpskip-mc-gikreqskip-mc-gikreqlast updated 27 Nov 20181661 tcpnetview-aix-1netview-aix-1last updated 27 Nov 20181661 udpnetview-aix-1netview-aix-1last updated 27 Nov 20181662 tcpnetview-aix-2netview-aix-2last updated 27 Nov 20181662 udpnetview-aix-2netview-aix-2last updated 27 Nov 20181663 tcpnetview-aix-3netview-aix-3last updated 27 Nov 20181663 udpnetview-aix-3netview-aix-3last updated 27 Nov 20181664 tcpnetview-aix-4netview-aix-4last updated 27 Nov 20181664 udpnetview-aix-4netview-aix-4last updated 27 Nov 20181665 tcpnetview-aix-5netview-aix-5last updated 27 Nov 20181665 udpnetview-aix-5netview-aix-5last updated 27 Nov 20181666 tcpnetview-aix-6netview-aix-6last updated 27 Nov 20181666 udpnetview-aix-6netview-aix-6last updated 27 Nov 20181667 tcpnetview-aix-7netview-aix-7last updated 27 Nov 20181667 udpnetview-aix-7netview-aix-7last updated 27 Nov 20181668 tcpnetview-aix-8netview-aix-8last updated 27 Nov 20181668 udpnetview-aix-8netview-aix-8last updated 27 Nov 20181669 tcpnetview-aix-9netview-aix-9last updated 27 Nov 20181669 udpnetview-aix-9netview-aix-9last updated 27 Nov 20181670 tcpnetview-aix-10netview-aix-10last updated 27 Nov 20181670 udpnetview-aix-10netview-aix-10last updated 27 Nov 20181671 tcpnetview-aix-11netview-aix-11last updated 27 Nov 20181671 udpnetview-aix-11netview-aix-11last updated 27 Nov 20181672 tcpnetview-aix-12netview-aix-12last updated 27 Nov 20181672 udpnetview-aix-12netview-aix-12last updated 27 Nov 20181673 tcpIntel Proshare Multicastproshare-mc-1last updated 27 Nov 20181673 udpIntel Proshare Multicastproshare-mc-1last updated 27 Nov 20181674 tcpIntel Proshare Multicastproshare-mc-2last updated 27 Nov 20181674 udpIntel Proshare Multicastproshare-mc-2last updated 27 Nov 20181675 tcpPacific Data Productspdplast updated 27 Nov 20181675 udpPacific Data Productspdplast updated 27 Nov 20181676 tcpnetcomm1netcomm1last updated 27 Nov 20181676 udpnetcomm2netcomm2last updated 27 Nov 20181677 tcpgroupwisegroupwiselast updated 27 Nov 20181677 udpgroupwisegroupwiselast updated 27 Nov 20181678 tcpprolinkprolinklast updated 27 Nov 20181678 udpprolinkprolinklast updated 27 Nov 20181679 tcpdarcorp-lmdarcorp-lmlast updated 27 Nov 20181679 udpdarcorp-lmdarcorp-lmlast updated 27 Nov 20181680 tcpmicrocom-sbpmicrocom-sbplast updated 27 Nov 20181680 udpmicrocom-sbpmicrocom-sbplast updated 27 Nov 20181681 tcpsd-elmdsd-elmdlast updated 27 Nov 20181681 udpsd-elmdsd-elmdlast updated 27 Nov 20181682 tcplanyon-lanternlanyon-lanternlast updated 27 Nov 20181682 udplanyon-lanternlanyon-lanternlast updated 27 Nov 20181683 tcpncpm-hipncpm-hiplast updated 27 Nov 20181683 udpncpm-hipncpm-hiplast updated 27 Nov 20181684 tcpSnareSecuresnaresecurelast updated 27 Nov 20181684 udpSnareSecuresnaresecurelast updated 27 Nov 20181685 tcpn2nremoten2nremotelast updated 27 Nov 20181685 udpn2nremoten2nremotelast updated 27 Nov 20181686 tcpcvmoncvmonlast updated 27 Nov 20181686 udpcvmoncvmonlast updated 27 Nov 20181687 tcpnsjtp-ctrlnsjtp-ctrllast updated 27 Nov 20181687 udpnsjtp-ctrlnsjtp-ctrllast updated 27 Nov 20181688 tcpnsjtp-datansjtp-datalast updated 27 Nov 20181688 udpnsjtp-datansjtp-datalast updated 27 Nov 20181689 tcpfirefoxfirefoxlast updated 27 Nov 20181689 udpfirefoxfirefoxlast updated 27 Nov 20181690 tcpng-umdsng-umdslast updated 27 Nov 20181690 udpng-umdsng-umdslast updated 27 Nov 20181691 tcpempire-empumaempire-empumalast updated 27 Nov 20181691 udpempire-empumaempire-empumalast updated 27 Nov 20181692 tcpsstsys-lmsstsys-lmlast updated 27 Nov 20181692 udpsstsys-lmsstsys-lmlast updated 27 Nov 20181693 tcprrirtrrrirtrlast updated 27 Nov 20181693 udprrirtrrrirtrlast updated 27 Nov 20181694 tcprrimwmrrimwmlast updated 27 Nov 20181694 udprrimwmrrimwmlast updated 27 Nov 20181695 tcprrilwmrrilwmlast updated 27 Nov 20181695 udprrilwmrrilwmlast updated 27 Nov 20181696 tcprrifmmrrifmmlast updated 27 Nov 20181696 udprrifmmrrifmmlast updated 27 Nov 20181697 tcprrisatrrisatlast updated 27 Nov 20181697 udprrisatrrisatlast updated 27 Nov 20181698 tcpRSVP-ENCAPSULATION-1rsvp-encap-1last updated 27 Nov 20181698 udpRSVP-ENCAPSULATION-1rsvp-encap-1last updated 27 Nov 20181699 tcpRSVP-ENCAPSULATION-2rsvp-encap-2last updated 27 Nov 20181699 udpRSVP-ENCAPSULATION-2rsvp-encap-2last updated 27 Nov 20181700 tcpmps-raftmps-raftlast updated 27 Nov 20181700 udpmps-raftmps-raftlast updated 27 Nov 20181701 tcpl2fl2flast updated 27 Nov 20181701 udpl2fl2flast updated 27 Nov 20181701 tcp (l2tp)l2tpl2tplast updated 27 Nov 20181701 udp (l2tp)l2tpl2tplast updated 27 Nov 20181702 tcpdesksharedesksharelast updated 27 Nov 20181702 udpdesksharedesksharelast updated 27 Nov 20181703 tcphb-enginehb-enginelast updated 27 Nov 20181703 udphb-enginehb-enginelast updated 27 Nov 20181704 tcpbcs-brokerbcs-brokerlast updated 27 Nov 20181704 udpbcs-brokerbcs-brokerlast updated 27 Nov 20181705 tcpslingshotslingshotlast updated 27 Nov 20181705 udpslingshotslingshotlast updated 27 Nov 20181706 tcpjetformjetformlast updated 27 Nov 20181706 udpjetformjetformlast updated 27 Nov 20181707 tcpvdmplayvdmplaylast updated 27 Nov 20181707 udpvdmplayvdmplaylast updated 27 Nov 20181708 tcpgat-lmdgat-lmdlast updated 27 Nov 20181708 udpgat-lmdgat-lmdlast updated 27 Nov 20181709 tcpcentracentralast updated 27 Nov 20181709 udpcentracentralast updated 27 Nov 20181710 tcpimperaimperalast updated 27 Nov 20181710 udpimperaimperalast updated 27 Nov 20181711 tcppptconferencepptconferencelast updated 27 Nov 20181711 udppptconferencepptconferencelast updated 27 Nov 20181712 tcpresource monitoring serviceregistrarlast updated 27 Nov 20181712 udpresource monitoring serviceregistrarlast updated 27 Nov 20181713 tcpConferenceTalkconferencetalklast updated 27 Nov 20181713 udpConferenceTalkconferencetalklast updated 27 Nov 20181714 tcpsesi-lmsesi-lmlast updated 27 Nov 20181714 udpsesi-lmsesi-lmlast updated 27 Nov 20181715 tcphoudini-lmhoudini-lmlast updated 27 Nov 20181715 udphoudini-lmhoudini-lmlast updated 27 Nov 20181716 tcpxmsgxmsglast updated 27 Nov 20181716 udpxmsgxmsglast updated 27 Nov 20181717 tcpfj-hdnetfj-hdnetlast updated 27 Nov 20181717 udpfj-hdnetfj-hdnetlast updated 27 Nov 20181718 tcpH.323 Multicast Gatekeeper Discoverh323gatedisclast updated 27 Nov 20181718 udpH.323 Multicast Gatekeeper Discoverh323gatedisclast updated 27 Nov 20181719 tcpH.323 Unicast Gatekeeper Signalingh323gatestatlast updated 27 Nov 20181719 udpH.323 Unicast Gatekeeper Signalingh323gatestatlast updated 27 Nov 20181720 tcpH.323 Call Control Signallingh323hostcalllast updated 27 Nov 20181720 udpH.323 Call Control Signallingh323hostcalllast updated 27 Nov 20181720 sctpH.323 Call Controlh323hostcalllast updated 27 Nov 20181721 tcpcaiccicaiccilast updated 27 Nov 20181721 udpcaiccicaiccilast updated 27 Nov 20181722 tcpHKS License Managerhks-lmlast updated 27 Nov 20181722 udpHKS License Managerhks-lmlast updated 27 Nov 20181723 tcppptppptplast updated 27 Nov 20181723 udppptppptplast updated 27 Nov 20181724 tcpcsbphonemastercsbphonemasterlast updated 27 Nov 20181724 udpcsbphonemastercsbphonemasterlast updated 27 Nov 20181725 tcpiden-ralpiden-ralplast updated 27 Nov 20181725 udpiden-ralpiden-ralplast updated 27 Nov 20181726 tcpIBERIAGAMESiberiagameslast updated 27 Nov 20181726 udpIBERIAGAMESiberiagameslast updated 27 Nov 20181727 tcpwinddxwinddxlast updated 27 Nov 20181727 udpwinddxwinddxlast updated 27 Nov 20181728 tcpTELINDUStelinduslast updated 27 Nov 20181728 udpTELINDUStelinduslast updated 27 Nov 20181729 tcpCityNL License Managementcitynllast updated 27 Nov 20181729 udpCityNL License Managementcitynllast updated 27 Nov 20181730 tcproketzroketzlast updated 27 Nov 20181730 udproketzroketzlast updated 27 Nov 20181731 tcpMSICCPmsiccplast updated 27 Nov 20181731 udpMSICCPmsiccplast updated 27 Nov 20181732 tcpproximproximlast updated 27 Nov 20181732 udpproximproximlast updated 27 Nov 20181733 tcpSIMS - SIIPAT Protocol for Alarm Transmissionsiipatlast updated 27 Nov 20181733 udpSIMS - SIIPAT Protocol for Alarm Transmissionsiipatlast updated 27 Nov 20181734 tcpCamber Corporation License Managementcambertx-lmlast updated 27 Nov 20181734 udpCamber Corporation License Managementcambertx-lmlast updated 27 Nov 20181735 tcpPrivateChatprivatechatlast updated 27 Nov 20181735 udpPrivateChatprivatechatlast updated 27 Nov 20181736 tcpstreet-streamstreet-streamlast updated 27 Nov 20181736 udpstreet-streamstreet-streamlast updated 27 Nov 20181737 tcpultimadultimadlast updated 27 Nov 20181737 udpultimadultimadlast updated 27 Nov 20181738 tcpGameGen1gamegen1last updated 27 Nov 20181738 udpGameGen1gamegen1last updated 27 Nov 20181739 tcpwebaccesswebaccesslast updated 27 Nov 20181739 udpwebaccesswebaccesslast updated 27 Nov 20181740 tcpencoreencorelast updated 27 Nov 20181740 udpencoreencorelast updated 27 Nov 20181741 tcpcisco-net-mgmtcisco-net-mgmtlast updated 27 Nov 20181741 udpcisco-net-mgmtcisco-net-mgmtlast updated 27 Nov 20181742 tcp3Com-nsd3Com-nsdlast updated 27 Nov 20181742 udp3Com-nsd3Com-nsdlast updated 27 Nov 20181743 tcpCinema Graphics License Managercinegrfx-lmlast updated 27 Nov 20181743 udpCinema Graphics License Managercinegrfx-lmlast updated 27 Nov 20181744 tcpncpm-ftncpm-ftlast updated 27 Nov 20181744 udpncpm-ftncpm-ftlast updated 27 Nov 20181745 tcpremote-winsockremote-winsocklast updated 27 Nov 20181745 udpremote-winsockremote-winsocklast updated 27 Nov 20181746 tcpftrapid-1ftrapid-1last updated 27 Nov 20181746 udpftrapid-1ftrapid-1last updated 27 Nov 20181747 tcpftrapid-2ftrapid-2last updated 27 Nov 20181747 udpftrapid-2ftrapid-2last updated 27 Nov 20181748 tcporacle-em1oracle-em1last updated 27 Nov 20181748 udporacle-em1oracle-em1last updated 27 Nov 20181749 tcpaspen-servicesaspen-serviceslast updated 27 Nov 20181749 udpaspen-servicesaspen-serviceslast updated 27 Nov 20181750 tcpSimple Socket Library's PortMastersslplast updated 27 Nov 20181750 udpSimple Socket Library's PortMastersslplast updated 27 Nov 20181751 tcpSwiftNetswiftnetlast updated 27 Nov 20181751 udpSwiftNetswiftnetlast updated 27 Nov 20181752 tcpLeap of Faith Research License Managerlofr-lmlast updated 27 Nov 20181752 udpLeap of Faith Research License Managerlofr-lmlast updated 27 Nov 20181753 tcpPredatar Comms Servicepredatar-commslast updated 27 Nov 20181753 udpReservedN/Alast updated 27 Nov 20181754 tcporacle-em2oracle-em2last updated 27 Nov 20181754 udporacle-em2oracle-em2last updated 27 Nov 20181755 tcpms-streamingms-streaminglast updated 27 Nov 20181755 udpms-streamingms-streaminglast updated 27 Nov 20181756 tcpcapfast-lmdcapfast-lmdlast updated 27 Nov 20181756 udpcapfast-lmdcapfast-lmdlast updated 27 Nov 20181757 tcpcnhrpcnhrplast updated 27 Nov 20181757 udpcnhrpcnhrplast updated 27 Nov 20181758 tcptftp-mcasttftp-mcastlast updated 27 Nov 20181758 udptftp-mcasttftp-mcastlast updated 27 Nov 20181759 tcpSPSS License Managerspss-lmlast updated 27 Nov 20181759 udpSPSS License Managerspss-lmlast updated 27 Nov 20181760 tcpwww-ldap-gwwww-ldap-gwlast updated 27 Nov 20181760 udpwww-ldap-gwwww-ldap-gwlast updated 27 Nov 20181761 tcpcft-0cft-0last updated 27 Nov 20181761 udpcft-0cft-0last updated 27 Nov 20181762 tcpcft-1cft-1last updated 27 Nov 20181762 udpcft-1cft-1last updated 27 Nov 20181763 tcpcft-2cft-2last updated 27 Nov 20181763 udpcft-2cft-2last updated 27 Nov 20181764 tcpcft-3cft-3last updated 27 Nov 20181764 udpcft-3cft-3last updated 27 Nov 20181765 tcpcft-4cft-4last updated 27 Nov 20181765 udpcft-4cft-4last updated 27 Nov 20181766 tcpcft-5cft-5last updated 27 Nov 20181766 udpcft-5cft-5last updated 27 Nov 20181767 tcpcft-6cft-6last updated 27 Nov 20181767 udpcft-6cft-6last updated 27 Nov 20181768 tcpcft-7cft-7last updated 27 Nov 20181768 udpcft-7cft-7last updated 27 Nov 20181769 tcpbmc-net-admbmc-net-admlast updated 27 Nov 20181769 udpbmc-net-admbmc-net-admlast updated 27 Nov 20181770 tcpbmc-net-svcbmc-net-svclast updated 27 Nov 20181770 udpbmc-net-svcbmc-net-svclast updated 27 Nov 20181771 tcpvaultbasevaultbaselast updated 27 Nov 20181771 udpvaultbasevaultbaselast updated 27 Nov 20181772 tcpEssWeb Gatewayessweb-gwlast updated 27 Nov 20181772 udpEssWeb Gatewayessweb-gwlast updated 27 Nov 20181773 tcpKMSControlkmscontrollast updated 27 Nov 20181773 udpKMSControlkmscontrollast updated 27 Nov 20181774 tcpglobal-dtservglobal-dtservlast updated 27 Nov 20181774 udpglobal-dtservglobal-dtservlast updated 27 Nov 20181775 tcpdata interchange between visual processing containersvdablast updated 27 Nov 20181775 udpReservedN/Alast updated 27 Nov 20181776 tcpFederal Emergency Management Information Systemfemislast updated 27 Nov 20181776 udpFederal Emergency Management Information Systemfemislast updated 27 Nov 20181777 tcppowerguardianpowerguardianlast updated 27 Nov 20181777 udppowerguardianpowerguardianlast updated 27 Nov 20181778 tcpprodigy-internetprodigy-intrnetlast updated 27 Nov 20181778 udpprodigy-internetprodigy-intrnetlast updated 27 Nov 20181779 tcppharmasoftpharmasoftlast updated 27 Nov 20181779 udppharmasoftpharmasoftlast updated 27 Nov 20181780 tcpdpkeyservdpkeyservlast updated 27 Nov 20181780 udpdpkeyservdpkeyservlast updated 27 Nov 20181781 tcpanswersoft-lmanswersoft-lmlast updated 27 Nov 20181781 udpanswersoft-lmanswersoft-lmlast updated 27 Nov 20181782 tcphp-hciphp-hciplast updated 27 Nov 20181782 udphp-hciphp-hciplast updated 27 Nov 20181783 Decomissioned Port 04/14/00, msN/Alast updated 27 Nov 20181784 tcpFinle License Managerfinle-lmlast updated 27 Nov 20181784 udpFinle License Managerfinle-lmlast updated 27 Nov 20181785 tcpWind River Systems License Managerwindlmlast updated 27 Nov 20181785 udpWind River Systems License Managerwindlmlast updated 27 Nov 20181786 tcpfunk-loggerfunk-loggerlast updated 27 Nov 20181786 udpfunk-loggerfunk-loggerlast updated 27 Nov 20181787 tcpfunk-licensefunk-licenselast updated 27 Nov 20181787 udpfunk-licensefunk-licenselast updated 27 Nov 20181788 tcppsmondpsmondlast updated 27 Nov 20181788 udppsmondpsmondlast updated 27 Nov 20181789 tcphellohellolast updated 27 Nov 20181789 udphellohellolast updated 27 Nov 20181790 tcpNarrative Media Streaming Protocolnmsplast updated 27 Nov 20181790 udpNarrative Media Streaming Protocolnmsplast updated 27 Nov 20181791 tcpEA1ea1last updated 27 Nov 20181791 udpEA1ea1last updated 27 Nov 20181792 tcpibm-dt-2ibm-dt-2last updated 27 Nov 20181792 udpibm-dt-2ibm-dt-2last updated 27 Nov 20181793 tcprsc-robotrsc-robotlast updated 27 Nov 20181793 udprsc-robotrsc-robotlast updated 27 Nov 20181794 tcpcera-bcmcera-bcmlast updated 27 Nov 20181794 udpcera-bcmcera-bcmlast updated 27 Nov 20181795 tcpdpi-proxydpi-proxylast updated 27 Nov 20181795 udpdpi-proxydpi-proxylast updated 27 Nov 20181796 tcpVocaltec Server Administrationvocaltec-adminlast updated 27 Nov 20181796 udpVocaltec Server Administrationvocaltec-adminlast updated 27 Nov 20181797 tcpUMAumalast updated 27 Nov 20181797 udpUMAumalast updated 27 Nov 20181798 tcpEvent Transfer Protocoletplast updated 27 Nov 20181798 udpEvent Transfer Protocoletplast updated 27 Nov 20181799 tcpNETRISKnetrisklast updated 27 Nov 20181799 udpNETRISKnetrisklast updated 27 Nov 20181800 tcpANSYS-License manageransys-lmlast updated 27 Nov 20181800 udpANSYS-License manageransys-lmlast updated 27 Nov 20181801 tcpMicrosoft Message Quemsmqlast updated 27 Nov 20181801 udpMicrosoft Message Quemsmqlast updated 27 Nov 20181802 tcpConComp1concomp1last updated 27 Nov 20181802 udpConComp1concomp1last updated 27 Nov 20181803 tcpHP-HCIP-GWYhp-hcip-gwylast updated 27 Nov 20181803 udpHP-HCIP-GWYhp-hcip-gwylast updated 27 Nov 20181804 tcpENLenllast updated 27 Nov 20181804 udpENLenllast updated 27 Nov 20181805 tcpENL-Nameenl-namelast updated 27 Nov 20181805 udpENL-Nameenl-namelast updated 27 Nov 20181806 tcpMusiconlinemusiconlinelast updated 27 Nov 20181806 udpMusiconlinemusiconlinelast updated 27 Nov 20181807 tcpFujitsu Hot Standby Protocolfhsplast updated 27 Nov 20181807 udpFujitsu Hot Standby Protocolfhsplast updated 27 Nov 20181808 tcpOracle-VP2oracle-vp2last updated 27 Nov 20181808 udpOracle-VP2oracle-vp2last updated 27 Nov 20181809 tcpOracle-VP1oracle-vp1last updated 27 Nov 20181809 udpOracle-VP1oracle-vp1last updated 27 Nov 20181810 tcpJerand License Managerjerand-lmlast updated 27 Nov 20181810 udpJerand License Managerjerand-lmlast updated 27 Nov 20181811 tcpScientia-SDBscientia-sdblast updated 27 Nov 20181811 udpScientia-SDBscientia-sdblast updated 27 Nov 20181812 tcpRADIUSradiuslast updated 27 Nov 20181812 udpRADIUSradiuslast updated 27 Nov 20181813 tcpRADIUS Accountingradius-acctlast updated 27 Nov 20181813 udpRADIUS Accountingradius-acctlast updated 27 Nov 20181814 tcpTDP Suitetdp-suitelast updated 27 Nov 20181814 udpTDP Suitetdp-suitelast updated 27 Nov 20181815 tcpMMPFTmmpftlast updated 27 Nov 20181815 udpMMPFTmmpftlast updated 27 Nov 20181816 tcpHARPharplast updated 27 Nov 20181816 udpHARPharplast updated 27 Nov 20181817 tcpRKB-OSCSrkb-oscslast updated 27 Nov 20181817 udpRKB-OSCSrkb-oscslast updated 27 Nov 20181818 tcpEnhanced Trivial File Transfer Protocoletftplast updated 27 Nov 20181818 udpEnhanced Trivial File Transfer Protocoletftplast updated 27 Nov 20181819 tcpPlato License Managerplato-lmlast updated 27 Nov 20181819 udpPlato License Managerplato-lmlast updated 27 Nov 20181820 tcpmcagentmcagentlast updated 27 Nov 20181820 udpmcagentmcagentlast updated 27 Nov 20181821 tcpdonnyworlddonnyworldlast updated 27 Nov 20181821 udpdonnyworlddonnyworldlast updated 27 Nov 20181822 tcpes-elmdes-elmdlast updated 27 Nov 20181822 udpes-elmdes-elmdlast updated 27 Nov 20181823 tcpUnisys Natural Language License Managerunisys-lmlast updated 27 Nov 20181823 udpUnisys Natural Language License Managerunisys-lmlast updated 27 Nov 20181824 tcpmetrics-pasmetrics-paslast updated 27 Nov 20181824 udpmetrics-pasmetrics-paslast updated 27 Nov 20181825 tcpDirecPC Videodirecpc-videolast updated 27 Nov 20181825 udpDirecPC Videodirecpc-videolast updated 27 Nov 20181826 tcpARDTardtlast updated 27 Nov 20181826 udpARDTardtlast updated 27 Nov 20181827 tcpASIasilast updated 27 Nov 20181827 udpASIasilast updated 27 Nov 20181828 tcpitm-mcell-uitm-mcell-ulast updated 27 Nov 20181828 udpitm-mcell-uitm-mcell-ulast updated 27 Nov 20181829 tcpOptika eMediaoptika-emedialast updated 27 Nov 20181829 udpOptika eMediaoptika-emedialast updated 27 Nov 20181830 tcpOracle Net8 CMan Adminnet8-cmanlast updated 27 Nov 20181830 udpOracle Net8 CMan Adminnet8-cmanlast updated 27 Nov 20181831 tcpMyrtlemyrtlelast updated 27 Nov 20181831 udpMyrtlemyrtlelast updated 27 Nov 20181832 tcpThoughtTreasuretht-treasurelast updated 27 Nov 20181832 udpThoughtTreasuretht-treasurelast updated 27 Nov 20181833 tcpudpradioudpradiolast updated 27 Nov 20181833 udpudpradioudpradiolast updated 27 Nov 20181834 tcpARDUS Unicastardusunilast updated 27 Nov 20181834 udpARDUS Unicastardusunilast updated 27 Nov 20181835 tcpARDUS Multicastardusmullast updated 27 Nov 20181835 udpARDUS Multicastardusmullast updated 27 Nov 20181836 tcpste-smscste-smsclast updated 27 Nov 20181836 udpste-smscste-smsclast updated 27 Nov 20181837 tcpcsoft1csoft1last updated 27 Nov 20181837 udpcsoft1csoft1last updated 27 Nov 20181838 tcpTALNETtalnetlast updated 27 Nov 20181838 udpTALNETtalnetlast updated 27 Nov 20181839 tcpnetopia-vo1netopia-vo1last updated 27 Nov 20181839 udpnetopia-vo1netopia-vo1last updated 27 Nov 20181840 tcpnetopia-vo2netopia-vo2last updated 27 Nov 20181840 udpnetopia-vo2netopia-vo2last updated 27 Nov 20181841 tcpnetopia-vo3netopia-vo3last updated 27 Nov 20181841 udpnetopia-vo3netopia-vo3last updated 27 Nov 20181842 tcpnetopia-vo4netopia-vo4last updated 27 Nov 20181842 udpnetopia-vo4netopia-vo4last updated 27 Nov 20181843 tcpnetopia-vo5netopia-vo5last updated 27 Nov 20181843 udpnetopia-vo5netopia-vo5last updated 27 Nov 20181844 tcpDirecPC-DLLdirecpc-dlllast updated 27 Nov 20181844 udpDirecPC-DLLdirecpc-dlllast updated 27 Nov 20181845 tcpaltalinkaltalinklast updated 27 Nov 20181845 udpaltalinkaltalinklast updated 27 Nov 20181846 tcpTunstall PNCtunstall-pnclast updated 27 Nov 20181846 udpTunstall PNCtunstall-pnclast updated 27 Nov 20181847 tcpSLP Notificationslp-notifylast updated 27 Nov 20181847 udpSLP Notificationslp-notifylast updated 27 Nov 20181848 tcpfjdocdistfjdocdistlast updated 27 Nov 20181848 udpfjdocdistfjdocdistlast updated 27 Nov 20181849 tcpALPHA-SMSalpha-smslast updated 27 Nov 20181849 udpALPHA-SMSalpha-smslast updated 27 Nov 20181850 tcpGSIgsilast updated 27 Nov 20181850 udpGSIgsilast updated 27 Nov 20181851 tcpctcdctcdlast updated 27 Nov 20181851 udpctcdctcdlast updated 27 Nov 20181852 tcpVirtual Timevirtual-timelast updated 27 Nov 20181852 udpVirtual Timevirtual-timelast updated 27 Nov 20181853 tcpVIDS-AVTPvids-avtplast updated 27 Nov 20181853 udpVIDS-AVTPvids-avtplast updated 27 Nov 20181854 tcpBuddy Drawbuddy-drawlast updated 27 Nov 20181854 udpBuddy Drawbuddy-drawlast updated 27 Nov 20181855 tcpFiorano RtrSvcfiorano-rtrsvclast updated 27 Nov 20181855 udpFiorano RtrSvcfiorano-rtrsvclast updated 27 Nov 20181856 tcpFiorano MsgSvcfiorano-msgsvclast updated 27 Nov 20181856 udpFiorano MsgSvcfiorano-msgsvclast updated 27 Nov 20181857 tcpDataCaptordatacaptorlast updated 27 Nov 20181857 udpDataCaptordatacaptorlast updated 27 Nov 20181858 tcpPrivateArkprivatearklast updated 27 Nov 20181858 udpPrivateArkprivatearklast updated 27 Nov 20181859 tcpGamma Fetcher Servergammafetchsvrlast updated 27 Nov 20181859 udpGamma Fetcher Servergammafetchsvrlast updated 27 Nov 20181860 tcpSunSCALAR Servicessunscalar-svclast updated 27 Nov 20181860 udpSunSCALAR Servicessunscalar-svclast updated 27 Nov 20181861 tcpLeCroy VICPlecroy-vicplast updated 27 Nov 20181861 udpLeCroy VICPlecroy-vicplast updated 27 Nov 20181862 tcpMySQL Cluster Manager Agentmysql-cm-agentlast updated 27 Nov 20181862 udpMySQL Cluster Manager Agentmysql-cm-agentlast updated 27 Nov 20181863 tcpMSNPmsnplast updated 27 Nov 20181863 udpMSNPmsnplast updated 27 Nov 20181864 tcpParadym 31 Portparadym-31portlast updated 27 Nov 20181864 udpParadym 31 Portparadym-31portlast updated 27 Nov 20181865 tcpENTPentplast updated 27 Nov 20181865 udpENTPentplast updated 27 Nov 20181866 tcpswrmiswrmilast updated 27 Nov 20181866 udpswrmiswrmilast updated 27 Nov 20181867 tcpUDRIVEudrivelast updated 27 Nov 20181867 udpUDRIVEudrivelast updated 27 Nov 20181868 tcpVizibleBrowserviziblebrowserlast updated 27 Nov 20181868 udpVizibleBrowserviziblebrowserlast updated 27 Nov 20181869 tcpTransActtransactlast updated 27 Nov 20181869 udpTransActtransactlast updated 27 Nov 20181870 tcpSunSCALAR DNS Servicesunscalar-dnslast updated 27 Nov 20181870 udpSunSCALAR DNS Servicesunscalar-dnslast updated 27 Nov 20181871 tcpCano Central 0canocentral0last updated 27 Nov 20181871 udpCano Central 0canocentral0last updated 27 Nov 20181872 tcpCano Central 1canocentral1last updated 27 Nov 20181872 udpCano Central 1canocentral1last updated 27 Nov 20181873 tcpFjmpjpsfjmpjpslast updated 27 Nov 20181873 udpFjmpjpsfjmpjpslast updated 27 Nov 20181874 tcpFjswapsnpfjswapsnplast updated 27 Nov 20181874 udpFjswapsnpfjswapsnplast updated 27 Nov 20181875 tcpwestell statswestell-statslast updated 27 Nov 20181875 udpwestell statswestell-statslast updated 27 Nov 20181876 tcpewcappsrvewcappsrvlast updated 27 Nov 20181876 udpewcappsrvewcappsrvlast updated 27 Nov 20181877 tcphp-webqosdbhp-webqosdblast updated 27 Nov 20181877 udphp-webqosdbhp-webqosdblast updated 27 Nov 20181878 tcpdrmsmcdrmsmclast updated 27 Nov 20181878 udpdrmsmcdrmsmclast updated 27 Nov 20181879 tcpNettGain NMSnettgain-nmslast updated 27 Nov 20181879 udpNettGain NMSnettgain-nmslast updated 27 Nov 20181880 tcpGilat VSAT Controlvsat-controllast updated 27 Nov 20181880 udpGilat VSAT Controlvsat-controllast updated 27 Nov 20181881 tcpIBM WebSphere MQ Everyplaceibm-mqseries2last updated 27 Nov 20181881 udpIBM WebSphere MQ Everyplaceibm-mqseries2last updated 27 Nov 20181882 tcpCA eTrust Common Servicesecsqdmnlast updated 27 Nov 20181882 udpCA eTrust Common Servicesecsqdmnlast updated 27 Nov 20181883 tcpMessage Queuing Telemetry Transport Protocolmqttlast updated 27 Nov 20181883 udpMessage Queuing Telemetry Transport Protocolmqttlast updated 27 Nov 20181884 tcpInternet Distance Map Svcidmapslast updated 27 Nov 20181884 udpInternet Distance Map Svcidmapslast updated 27 Nov 20181885 tcpVeritas Trap Servervrtstrapserverlast updated 27 Nov 20181885 udpVeritas Trap Servervrtstrapserverlast updated 27 Nov 20181886 tcpLeonardo over IPleoiplast updated 27 Nov 20181886 udpLeonardo over IPleoiplast updated 27 Nov 20181887 tcpFileX Listening Portfilex-lportlast updated 27 Nov 20181887 udpFileX Listening Portfilex-lportlast updated 27 Nov 20181888 tcpNC Config Portncconfiglast updated 27 Nov 20181888 udpNC Config Portncconfiglast updated 27 Nov 20181889 tcpUnify Web Adapter Serviceunify-adapterlast updated 27 Nov 20181889 udpUnify Web Adapter Serviceunify-adapterlast updated 27 Nov 20181890 tcpwilkenListenerwilkenlistenerlast updated 27 Nov 20181890 udpwilkenListenerwilkenlistenerlast updated 27 Nov 20181891 tcpChildKey Notificationchildkey-notiflast updated 27 Nov 20181891 udpChildKey Notificationchildkey-notiflast updated 27 Nov 20181892 tcpChildKey Controlchildkey-ctrllast updated 27 Nov 20181892 udpChildKey Controlchildkey-ctrllast updated 27 Nov 20181893 tcpELAD Protocoleladlast updated 27 Nov 20181893 udpELAD Protocoleladlast updated 27 Nov 20181894 tcpO2Server Porto2server-portlast updated 27 Nov 20181894 udpO2Server Porto2server-portlast updated 27 Nov 20181895 tcpunassignedN/Alast updated 27 Nov 20181895 udpunassignedN/Alast updated 27 Nov 20181896 tcpb-novative license serverb-novative-lslast updated 27 Nov 20181896 udpb-novative license serverb-novative-lslast updated 27 Nov 20181897 tcpMetaAgentmetaagentlast updated 27 Nov 20181897 udpMetaAgentmetaagentlast updated 27 Nov 20181898 tcpCymtec secure managementcymtec-portlast updated 27 Nov 20181898 udpCymtec secure managementcymtec-portlast updated 27 Nov 20181899 tcpMC2Studiosmc2studioslast updated 27 Nov 20181899 udpMC2Studiosmc2studioslast updated 27 Nov 20181900 tcpSSDPssdplast updated 27 Nov 20181900 udpSSDPssdplast updated 27 Nov 20181901 tcpFujitsu ICL Terminal Emulator Program Afjicl-tep-alast updated 27 Nov 20181901 udpFujitsu ICL Terminal Emulator Program Afjicl-tep-alast updated 27 Nov 20181902 tcpFujitsu ICL Terminal Emulator Program Bfjicl-tep-blast updated 27 Nov 20181902 udpFujitsu ICL Terminal Emulator Program Bfjicl-tep-blast updated 27 Nov 20181903 tcpLocal Link Name Resolutionlinknamelast updated 27 Nov 20181903 udpLocal Link Name Resolutionlinknamelast updated 27 Nov 20181904 tcpFujitsu ICL Terminal Emulator Program Cfjicl-tep-clast updated 27 Nov 20181904 udpFujitsu ICL Terminal Emulator Program Cfjicl-tep-clast updated 27 Nov 20181905 tcpSecure UP.Link Gateway Protocolsugplast updated 27 Nov 20181905 udpSecure UP.Link Gateway Protocolsugplast updated 27 Nov 20181906 tcpTPortMapperReqtpmdlast updated 27 Nov 20181906 udpTPortMapperReqtpmdlast updated 27 Nov 20181907 tcpIntraSTARintrastarlast updated 27 Nov 20181907 udpIntraSTARintrastarlast updated 27 Nov 20181908 tcpDawndawnlast updated 27 Nov 20181908 udpDawndawnlast updated 27 Nov 20181909 tcpGlobal World Linkglobal-wlinklast updated 27 Nov 20181909 udpGlobal World Linkglobal-wlinklast updated 27 Nov 20181910 tcpUltraBac Software communications portultrabaclast updated 27 Nov 20181910 udpUltraBac Software communications portultrabaclast updated 27 Nov 20181911 tcpStarlight Networks Multimedia Transport Protocolmtplast updated 27 Nov 20181911 udpStarlight Networks Multimedia Transport Protocolmtplast updated 27 Nov 20181912 tcprhp-iibprhp-iibplast updated 27 Nov 20181912 udprhp-iibprhp-iibplast updated 27 Nov 20181913 tcparmadparmadplast updated 27 Nov 20181913 udparmadparmadplast updated 27 Nov 20181914 tcpElm-Momentumelm-momentumlast updated 27 Nov 20181914 udpElm-Momentumelm-momentumlast updated 27 Nov 20181915 tcpFACELINKfacelinklast updated 27 Nov 20181915 udpFACELINKfacelinklast updated 27 Nov 20181916 tcpPersoft Personapersonalast updated 27 Nov 20181916 udpPersoft Personapersonalast updated 27 Nov 20181917 tcpnOAgentnoagentlast updated 27 Nov 20181917 udpnOAgentnoagentlast updated 27 Nov 20181918 tcpIBM Tivole Directory Service - NDScan-ndslast updated 27 Nov 20181918 udpIBM Tivole Directory Service - NDScan-ndslast updated 27 Nov 20181919 tcpIBM Tivoli Directory Service - DCHcan-dchlast updated 27 Nov 20181919 udpIBM Tivoli Directory Service - DCHcan-dchlast updated 27 Nov 20181920 tcpIBM Tivoli Directory Service - FERRETcan-ferretlast updated 27 Nov 20181920 udpIBM Tivoli Directory Service - FERRETcan-ferretlast updated 27 Nov 20181921 tcpNoAdminnoadminlast updated 27 Nov 20181921 udpNoAdminnoadminlast updated 27 Nov 20181922 tcpTapestrytapestrylast updated 27 Nov 20181922 udpTapestrytapestrylast updated 27 Nov 20181923 tcpSPICEspicelast updated 27 Nov 20181923 udpSPICEspicelast updated 27 Nov 20181924 tcpXIIPxiiplast updated 27 Nov 20181924 udpXIIPxiiplast updated 27 Nov 20181925 tcpSurrogate Discovery Portdiscovery-portlast updated 27 Nov 20181925 udpSurrogate Discovery Portdiscovery-portlast updated 27 Nov 20181926 tcpEvolution Game Serveregslast updated 27 Nov 20181926 udpEvolution Game Serveregslast updated 27 Nov 20181927 tcpVidete CIPC Portvidete-cipclast updated 27 Nov 20181927 udpVidete CIPC Portvidete-cipclast updated 27 Nov 20181928 tcpExpnd Maui Srvr Dscovremsd-portlast updated 27 Nov 20181928 udpExpnd Maui Srvr Dscovremsd-portlast updated 27 Nov 20181929 tcpBandwiz System - Serverbandwiz-systemlast updated 27 Nov 20181929 udpBandwiz System - Serverbandwiz-systemlast updated 27 Nov 20181930 tcpDrive AppServerdriveappserverlast updated 27 Nov 20181930 udpDrive AppServerdriveappserverlast updated 27 Nov 20181931 tcpAMD SCHEDamdschedlast updated 27 Nov 20181931 udpAMD SCHEDamdschedlast updated 27 Nov 20181932 tcpCTT Brokerctt-brokerlast updated 27 Nov 20181932 udpCTT Brokerctt-brokerlast updated 27 Nov 20181933 tcpIBM LM MT Agentxmapilast updated 27 Nov 20181933 udpIBM LM MT Agentxmapilast updated 27 Nov 20181934 tcpIBM LM Appl Agentxaapilast updated 27 Nov 20181934 udpIBM LM Appl Agentxaapilast updated 27 Nov 20181935 tcpMacromedia Flash Communications Server MXmacromedia-fcslast updated 27 Nov 20181935 udpMacromedia Flash Communications server MXmacromedia-fcslast updated 27 Nov 20181936 tcpJetCmeServer Server Portjetcmeserverlast updated 27 Nov 20181936 udpJetCmeServer Server Portjetcmeserverlast updated 27 Nov 20181937 tcpJetVWay Server Portjwserverlast updated 27 Nov 20181937 udpJetVWay Server Portjwserverlast updated 27 Nov 20181938 tcpJetVWay Client Portjwclientlast updated 27 Nov 20181938 udpJetVWay Client Portjwclientlast updated 27 Nov 20181939 tcpJetVision Server Portjvserverlast updated 27 Nov 20181939 udpJetVision Server Portjvserverlast updated 27 Nov 20181940 tcpJetVision Client Portjvclientlast updated 27 Nov 20181940 udpJetVision Client Portjvclientlast updated 27 Nov 20181941 tcpDIC-Aidadic-aidalast updated 27 Nov 20181941 udpDIC-Aidadic-aidalast updated 27 Nov 20181942 tcpReal Enterprise Servicereslast updated 27 Nov 20181942 udpReal Enterprise Servicereslast updated 27 Nov 20181943 tcpBeeyond Mediabeeyond-medialast updated 27 Nov 20181943 udpBeeyond Mediabeeyond-medialast updated 27 Nov 20181944 tcpclose-combatclose-combatlast updated 27 Nov 20181944 udpclose-combatclose-combatlast updated 27 Nov 20181945 tcpdialogic-elmddialogic-elmdlast updated 27 Nov 20181945 udpdialogic-elmddialogic-elmdlast updated 27 Nov 20181946 tcptekplstekplslast updated 27 Nov 20181946 udptekplstekplslast updated 27 Nov 20181947 tcpSentinelSRMsentinelsrmlast updated 27 Nov 20181947 udpSentinelSRMsentinelsrmlast updated 27 Nov 20181948 tcpeye2eyeeye2eyelast updated 27 Nov 20181948 udpeye2eyeeye2eyelast updated 27 Nov 20181949 tcpISMA Easdaq Liveismaeasdaqlivelast updated 27 Nov 20181949 udpISMA Easdaq Liveismaeasdaqlivelast updated 27 Nov 20181950 tcpISMA Easdaq Testismaeasdaqtestlast updated 27 Nov 20181950 udpISMA Easdaq Testismaeasdaqtestlast updated 27 Nov 20181951 tcpbcs-lmserverbcs-lmserverlast updated 27 Nov 20181951 udpbcs-lmserverbcs-lmserverlast updated 27 Nov 20181952 tcpmpnjscmpnjsclast updated 27 Nov 20181952 udpmpnjscmpnjsclast updated 27 Nov 20181953 tcpRapid Baserapidbaselast updated 27 Nov 20181953 udpRapid Baserapidbaselast updated 27 Nov 20181954 tcpABR-API (diskbridge)abr-apilast updated 27 Nov 20181954 udpABR-API (diskbridge)abr-apilast updated 27 Nov 20181955 tcpABR-Secure Data (diskbridge)abr-securelast updated 27 Nov 20181955 udpABR-Secure Data (diskbridge)abr-securelast updated 27 Nov 20181956 tcpVertel VMF DSvrtl-vmf-dslast updated 27 Nov 20181956 udpVertel VMF DSvrtl-vmf-dslast updated 27 Nov 20181957 tcpunix-statusunix-statuslast updated 27 Nov 20181957 udpunix-statusunix-statuslast updated 27 Nov 20181958 tcpCA Administration Daemondxadmindlast updated 27 Nov 20181958 udpCA Administration Daemondxadmindlast updated 27 Nov 20181959 tcpSIMP Channelsimp-alllast updated 27 Nov 20181959 udpSIMP Channelsimp-alllast updated 27 Nov 20181960 tcpMerit DAC NASmanagernasmanagerlast updated 27 Nov 20181960 udpMerit DAC NASmanagernasmanagerlast updated 27 Nov 20181961 tcpBTS APPSERVERbts-appserverlast updated 27 Nov 20181961 udpBTS APPSERVERbts-appserverlast updated 27 Nov 20181962 tcpBIAP-MPbiap-mplast updated 27 Nov 20181962 udpBIAP-MPbiap-mplast updated 27 Nov 20181963 tcpWebMachinewebmachinelast updated 27 Nov 20181963 udpWebMachinewebmachinelast updated 27 Nov 20181964 tcpSOLID E ENGINEsolid-e-enginelast updated 27 Nov 20181964 udpSOLID E ENGINEsolid-e-enginelast updated 27 Nov 20181965 tcpTivoli NPMtivoli-npmlast updated 27 Nov 20181965 udpTivoli NPMtivoli-npmlast updated 27 Nov 20181966 tcpSlushslushlast updated 27 Nov 20181966 udpSlushslushlast updated 27 Nov 20181967 tcpSNS Quotesns-quotelast updated 27 Nov 20181967 udpSNS Quotesns-quotelast updated 27 Nov 20181968 tcpLIPSinclipsinclast updated 27 Nov 20181968 udpLIPSinclipsinclast updated 27 Nov 20181969 tcpLIPSinc 1lipsinc1last updated 27 Nov 20181969 udpLIPSinc 1lipsinc1last updated 27 Nov 20181970 tcpNetOp Remote Controlnetop-rclast updated 27 Nov 20181970 udpNetOp Remote Controlnetop-rclast updated 27 Nov 20181971 tcpNetOp Schoolnetop-schoollast updated 27 Nov 20181971 udpNetOp Schoolnetop-schoollast updated 27 Nov 20181972 tcpCacheintersys-cachelast updated 27 Nov 20181972 udpCacheintersys-cachelast updated 27 Nov 20181973 tcpData Link Switching Remote Access Protocoldlsraplast updated 27 Nov 20181973 udpData Link Switching Remote Access Protocoldlsraplast updated 27 Nov 20181974 tcpDRPdrplast updated 27 Nov 20181974 udpDRPdrplast updated 27 Nov 20181975 tcpTCO Flash Agenttcoflashagentlast updated 27 Nov 20181975 udpTCO Flash Agenttcoflashagentlast updated 27 Nov 20181976 tcpTCO Reg Agenttcoregagentlast updated 27 Nov 20181976 udpTCO Reg Agenttcoregagentlast updated 27 Nov 20181977 tcpTCO Address Booktcoaddressbooklast updated 27 Nov 20181977 udpTCO Address Booktcoaddressbooklast updated 27 Nov 20181978 tcpUniSQLunisqllast updated 27 Nov 20181978 udpUniSQLunisqllast updated 27 Nov 20181979 tcpUniSQL Javaunisql-javalast updated 27 Nov 20181979 udpUniSQL Javaunisql-javalast updated 27 Nov 20181980 tcpPearlDoc XACTpearldoc-xactlast updated 27 Nov 20181980 udpPearlDoc XACTpearldoc-xactlast updated 27 Nov 20181981 tcpp2pQp2pqlast updated 27 Nov 20181981 udpp2pQp2pqlast updated 27 Nov 20181982 tcpEvidentiary Timestampestamplast updated 27 Nov 20181982 udpEvidentiary Timestampestamplast updated 27 Nov 20181983 tcpLoophole Test Protocollhtplast updated 27 Nov 20181983 udpLoophole Test Protocollhtplast updated 27 Nov 20181984 tcpBBbblast updated 27 Nov 20181984 udpBBbblast updated 27 Nov 20181985 tcpHot Standby Router Protocolhsrplast updated 27 Nov 20181985 udpHot Standby Router Protocolhsrplast updated 27 Nov 20181986 tcpcisco license managementlicensedaemonlast updated 27 Nov 20181986 udpcisco license managementlicensedaemonlast updated 27 Nov 20181987 tcpcisco RSRB Priority 1 porttr-rsrb-p1last updated 27 Nov 20181987 udpcisco RSRB Priority 1 porttr-rsrb-p1last updated 27 Nov 20181988 tcpcisco RSRB Priority 2 porttr-rsrb-p2last updated 27 Nov 20181988 udpcisco RSRB Priority 2 porttr-rsrb-p2last updated 27 Nov 20181989 tcpcisco RSRB Priority 3 porttr-rsrb-p3last updated 27 Nov 20181989 udpcisco RSRB Priority 3 porttr-rsrb-p3last updated 27 Nov 20181989 tcp (mshnet)MHSnet systemmshnetlast updated 27 Nov 20181989 udp (mshnet)MHSnet systemmshnetlast updated 27 Nov 20181990 tcpcisco STUN Priority 1 portstun-p1last updated 27 Nov 20181990 udpcisco STUN Priority 1 portstun-p1last updated 27 Nov 20181991 tcpcisco STUN Priority 2 portstun-p2last updated 27 Nov 20181991 udpcisco STUN Priority 2 portstun-p2last updated 27 Nov 20181992 tcpcisco STUN Priority 3 portstun-p3last updated 27 Nov 20181992 udpcisco STUN Priority 3 portstun-p3last updated 27 Nov 20181992 tcp (ipsendmsg)IPsendmsgipsendmsglast updated 27 Nov 20181992 udp (ipsendmsg)IPsendmsgipsendmsglast updated 27 Nov 20181993 tcpcisco SNMP TCP portsnmp-tcp-portlast updated 27 Nov 20181993 udpcisco SNMP TCP portsnmp-tcp-portlast updated 27 Nov 20181994 tcpcisco serial tunnel portstun-portlast updated 27 Nov 20181994 udpcisco serial tunnel portstun-portlast updated 27 Nov 20181995 tcpcisco perf portperf-portlast updated 27 Nov 20181995 udpcisco perf portperf-portlast updated 27 Nov 20181996 tcpcisco Remote SRB porttr-rsrb-portlast updated 27 Nov 20181996 udpcisco Remote SRB porttr-rsrb-portlast updated 27 Nov 20181997 tcpcisco Gateway Discovery Protocolgdp-portlast updated 27 Nov 20181997 udpcisco Gateway Discovery Protocolgdp-portlast updated 27 Nov 20181998 tcpcisco X.25 service (XOT)x25-svc-portlast updated 27 Nov 20181998 udpcisco X.25 service (XOT)x25-svc-portlast updated 27 Nov 20181999 tcpcisco identification porttcp-id-portlast updated 27 Nov 20181999 udpcisco identification porttcp-id-portlast updated 27 Nov 20182000 tcpCisco SCCPcisco-sccplast updated 27 Nov 20182000 udpCisco SCCpcisco-sccplast updated 27 Nov 20182001 tcp-dclast updated 27 Nov 20182001 udpcurrywizardlast updated 27 Nov 20182002 tcp-globelast updated 27 Nov 20182002 udp-globelast updated 27 Nov 20182003 tcpBrutus Serverbrutuslast updated 27 Nov 20182003 udpBrutus Serverbrutuslast updated 27 Nov 20182004 tcp-mailboxlast updated 27 Nov 20182004 udpCCWS mm confemcelast updated 27 Nov 20182005 tcp-berknetlast updated 27 Nov 20182005 udp-oraclelast updated 27 Nov 20182006 tcp-invokatorlast updated 27 Nov 20182006 udpraidraid-cdlast updated 27 Nov 20182007 tcp-dectalklast updated 27 Nov 20182007 udp-raid-amlast updated 27 Nov 20182008 tcp-conflast updated 27 Nov 20182008 udp-terminaldblast updated 27 Nov 20182009 tcp-newslast updated 27 Nov 20182009 udp-whosockamilast updated 27 Nov 20182010 tcp-searchlast updated 27 Nov 20182010 udpIANA assigned this well-formed service name as a replacement for "pipe_server".pipe-serverlast updated 27 Nov 20182010 udp (pipe_server)-pipe_serverlast updated 27 Nov 20182011 tcpraidraid-cclast updated 27 Nov 20182011 udp-servservlast updated 27 Nov 20182012 tcp-ttyinfolast updated 27 Nov 20182012 udp-raid-aclast updated 27 Nov 20182013 tcp-raid-amlast updated 27 Nov 20182013 udp-raid-cdlast updated 27 Nov 20182014 tcp-trofflast updated 27 Nov 20182014 udp-raid-sflast updated 27 Nov 20182015 tcp-cypresslast updated 27 Nov 20182015 udp-raid-cslast updated 27 Nov 20182016 tcp-bootserverlast updated 27 Nov 20182016 udp-bootserverlast updated 27 Nov 20182017 tcp-cypress-statlast updated 27 Nov 20182017 udp-bootclientlast updated 27 Nov 20182018 tcp-terminaldblast updated 27 Nov 20182018 udp-rellpacklast updated 27 Nov 20182019 tcp-whosockamilast updated 27 Nov 20182019 udp-aboutlast updated 27 Nov 20182020 tcp-xinupageserverlast updated 27 Nov 20182020 udp-xinupageserverlast updated 27 Nov 20182021 tcp-servexeclast updated 27 Nov 20182021 udp-xinuexpansion1last updated 27 Nov 20182022 tcp-downlast updated 27 Nov 20182022 udp-xinuexpansion2last updated 27 Nov 20182023 tcp-xinuexpansion3last updated 27 Nov 20182023 udp-xinuexpansion3last updated 27 Nov 20182024 tcp-xinuexpansion4last updated 27 Nov 20182024 udp-xinuexpansion4last updated 27 Nov 20182025 tcp-ellpacklast updated 27 Nov 20182025 udp-xribslast updated 27 Nov 20182026 tcp-scrabblelast updated 27 Nov 20182026 udp-scrabblelast updated 27 Nov 20182027 tcp-shadowserverlast updated 27 Nov 20182027 udp-shadowserverlast updated 27 Nov 20182028 tcp-submitserverlast updated 27 Nov 20182028 udp-submitserverlast updated 27 Nov 20182029 tcpHot Standby Router Protocol IPv6hsrpv6last updated 27 Nov 20182029 udpHot Standby Router Protocol IPv6hsrpv6last updated 27 Nov 20182030 tcp-device2last updated 27 Nov 20182030 udp-device2last updated 27 Nov 20182031 tcpmobrien-chatmobrien-chatlast updated 27 Nov 20182031 udpmobrien-chatmobrien-chatlast updated 27 Nov 20182032 tcp-blackboardlast updated 27 Nov 20182032 udp-blackboardlast updated 27 Nov 20182033 tcp-gloggerlast updated 27 Nov 20182033 udp-gloggerlast updated 27 Nov 20182034 tcp-scoremgrlast updated 27 Nov 20182034 udp-scoremgrlast updated 27 Nov 20182035 tcp-imsldoclast updated 27 Nov 20182035 udp-imsldoclast updated 27 Nov 20182036 tcpEthernet WS DP networke-dpnetlast updated 27 Nov 20182036 udpEthernet WS DP networke-dpnetlast updated 27 Nov 20182037 tcpAPplus Application Serverappluslast updated 27 Nov 20182037 udpAPplus Application Serverappluslast updated 27 Nov 20182038 tcp-objectmanagerlast updated 27 Nov 20182038 udp-objectmanagerlast updated 27 Nov 20182039 tcpPrizma Monitoring Serviceprizmalast updated 27 Nov 20182039 udpPrizma Monitoring Serviceprizmalast updated 27 Nov 20182040 tcp-lamlast updated 27 Nov 20182040 udp-lamlast updated 27 Nov 20182041 tcp-interbaselast updated 27 Nov 20182041 udp-interbaselast updated 27 Nov 20182042 tcpisisisislast updated 27 Nov 20182042 udpisisisislast updated 27 Nov 20182043 tcpisis-bcastisis-bcastlast updated 27 Nov 20182043 udpisis-bcastisis-bcastlast updated 27 Nov 20182044 tcp-rimsllast updated 27 Nov 20182044 udp-rimsllast updated 27 Nov 20182045 tcp-cdfunclast updated 27 Nov 20182045 udp-cdfunclast updated 27 Nov 20182046 tcp-sdfunclast updated 27 Nov 20182046 udp-sdfunclast updated 27 Nov 20182047 tcp-dlslast updated 27 Nov 20182047 udp-dlslast updated 27 Nov 20182048 tcp-dls-monitorlast updated 27 Nov 20182048 udp-dls-monitorlast updated 27 Nov 20182049 tcp (shilp)-shilplast updated 27 Nov 20182049 udp (shilp)-shilplast updated 27 Nov 20182049 tcpNetwork File System - Sun Microsystemsnfslast updated 27 Nov 20182049 udpNetwork File System - Sun Microsystemsnfslast updated 27 Nov 20182049 sctpNetwork File Systemnfslast updated 27 Nov 20182050 tcpAvaya EMB Config Portav-emb-configlast updated 27 Nov 20182050 udpAvaya EMB Config Portav-emb-configlast updated 27 Nov 20182051 tcpEPNSDPepnsdplast updated 27 Nov 20182051 udpEPNSDPepnsdplast updated 27 Nov 20182052 tcpclearVisn Services Portclearvisnlast updated 27 Nov 20182052 udpclearVisn Services Portclearvisnlast updated 27 Nov 20182053 tcpLot105 DSuper Updateslot105-ds-updlast updated 27 Nov 20182053 udpLot105 DSuper Updateslot105-ds-updlast updated 27 Nov 20182054 tcpWeblogin Portwebloginlast updated 27 Nov 20182054 udpWeblogin Portwebloginlast updated 27 Nov 20182055 tcpIliad-Odyssey Protocolioplast updated 27 Nov 20182055 udpIliad-Odyssey Protocolioplast updated 27 Nov 20182056 tcpOmniSky Portomniskylast updated 27 Nov 20182056 udpOmniSky Portomniskylast updated 27 Nov 20182057 tcpRich Content Protocolrich-cplast updated 27 Nov 20182057 udpRich Content Protocolrich-cplast updated 27 Nov 20182058 tcpNewWaveSearchables RMInewwavesearchlast updated 27 Nov 20182058 udpNewWaveSearchables RMInewwavesearchlast updated 27 Nov 20182059 tcpBMC Messaging Servicebmc-messaginglast updated 27 Nov 20182059 udpBMC Messaging Servicebmc-messaginglast updated 27 Nov 20182060 tcpTelenium Daemon IFteleniumdaemonlast updated 27 Nov 20182060 udpTelenium Daemon IFteleniumdaemonlast updated 27 Nov 20182061 tcpNetMountnetmountlast updated 27 Nov 20182061 udpNetMountnetmountlast updated 27 Nov 20182062 tcpICG SWP Porticg-swplast updated 27 Nov 20182062 udpICG SWP Porticg-swplast updated 27 Nov 20182063 tcpICG Bridge Porticg-bridgelast updated 27 Nov 20182063 udpICG Bridge Porticg-bridgelast updated 27 Nov 20182064 tcpICG IP Relay Porticg-iprelaylast updated 27 Nov 20182064 udpICG IP Relay Porticg-iprelaylast updated 27 Nov 20182065 tcpData Link Switch Read Port Numberdlsrpnlast updated 27 Nov 20182065 udpData Link Switch Read Port Numberdlsrpnlast updated 27 Nov 20182066 tcpAVM USB Remote Architectureauralast updated 27 Nov 20182066 udpAVM USB Remote Architectureauralast updated 27 Nov 20182067 tcpData Link Switch Write Port Numberdlswpnlast updated 27 Nov 20182067 udpData Link Switch Write Port Numberdlswpnlast updated 27 Nov 20182068 tcpAvocent AuthSrv Protocolavauthsrvprtcllast updated 27 Nov 20182068 udpAvocent AuthSrv Protocolavauthsrvprtcllast updated 27 Nov 20182069 tcpHTTP Event Portevent-portlast updated 27 Nov 20182069 udpHTTP Event Portevent-portlast updated 27 Nov 20182070 tcpAH and ESP Encapsulated in UDP packetah-esp-encaplast updated 27 Nov 20182070 udpAH and ESP Encapsulated in UDP packetah-esp-encaplast updated 27 Nov 20182071 tcpAxon Control Protocolacp-portlast updated 27 Nov 20182071 udpAxon Control Protocolacp-portlast updated 27 Nov 20182072 tcpGlobeCast mSyncmsynclast updated 27 Nov 20182072 udpGlobeCast mSyncmsynclast updated 27 Nov 20182073 tcpDataReel Database Socketgxs-data-portlast updated 27 Nov 20182073 udpDataReel Database Socketgxs-data-portlast updated 27 Nov 20182074 tcpVertel VMF SAvrtl-vmf-salast updated 27 Nov 20182074 udpVertel VMF SAvrtl-vmf-salast updated 27 Nov 20182075 tcpNewlix ServerWare Enginenewlixenginelast updated 27 Nov 20182075 udpNewlix ServerWare Enginenewlixenginelast updated 27 Nov 20182076 tcpNewlix JSPConfignewlixconfiglast updated 27 Nov 20182076 udpNewlix JSPConfignewlixconfiglast updated 27 Nov 20182077 tcpOld Tivoli Storage Managertsrmagtlast updated 27 Nov 20182077 udpOld Tivoli Storage Managertsrmagtlast updated 27 Nov 20182078 tcpIBM Total Productivity Center Servertpcsrvrlast updated 27 Nov 20182078 udpIBM Total Productivity Center Servertpcsrvrlast updated 27 Nov 20182079 tcpIDWARE Router Portidware-routerlast updated 27 Nov 20182079 udpIDWARE Router Portidware-routerlast updated 27 Nov 20182080 tcpAutodesk NLM (FLEXlm)autodesk-nlmlast updated 27 Nov 20182080 udpAutodesk NLM (FLEXlm)autodesk-nlmlast updated 27 Nov 20182081 tcpKME PRINTER TRAP PORTkme-trap-portlast updated 27 Nov 20182081 udpKME PRINTER TRAP PORTkme-trap-portlast updated 27 Nov 20182082 tcpInfowave Mobility Serverinfowavelast updated 27 Nov 20182082 udpInfowave Mobility Serverinfowavelast updated 27 Nov 20182083 tcpSecure Radius Serviceradseclast updated 27 Nov 20182083 udpSecure Radius Serviceradseclast updated 27 Nov 20182084 tcpSunCluster Geographicsunclustergeolast updated 27 Nov 20182084 udpSunCluster Geographicsunclustergeolast updated 27 Nov 20182085 tcpADA Controlada-ciplast updated 27 Nov 20182085 udpADA Controlada-ciplast updated 27 Nov 20182086 tcpGNUnetgnunetlast updated 27 Nov 20182086 udpGNUnetgnunetlast updated 27 Nov 20182087 tcpELI - Event Logging Integrationelilast updated 27 Nov 20182087 udpELI - Event Logging Integrationelilast updated 27 Nov 20182088 tcpIP Busy Lamp Fieldip-blflast updated 27 Nov 20182088 udpIP Busy Lamp Fieldip-blflast updated 27 Nov 20182089 tcpSecurity Encapsulation Protocol - SEPseplast updated 27 Nov 20182089 udpSecurity Encapsulation Protocol - SEPseplast updated 27 Nov 20182090 tcpLoad Report Protocollrplast updated 27 Nov 20182090 udpLoad Report Protocollrplast updated 27 Nov 20182091 tcpPRPprplast updated 27 Nov 20182091 udpPRPprplast updated 27 Nov 20182092 tcpDescent 3descent3last updated 27 Nov 20182092 udpDescent 3descent3last updated 27 Nov 20182093 tcpNBX CCnbx-cclast updated 27 Nov 20182093 udpNBX CCnbx-cclast updated 27 Nov 20182094 tcpNBX AUnbx-aulast updated 27 Nov 20182094 udpNBX AUnbx-aulast updated 27 Nov 20182095 tcpNBX SERnbx-serlast updated 27 Nov 20182095 udpNBX SERnbx-serlast updated 27 Nov 20182096 tcpNBX DIRnbx-dirlast updated 27 Nov 20182096 udpNBX DIRnbx-dirlast updated 27 Nov 20182097 tcpJet Form Previewjetformpreviewlast updated 27 Nov 20182097 udpJet Form Previewjetformpreviewlast updated 27 Nov 20182098 tcpDialog Portdialog-portlast updated 27 Nov 20182098 udpDialog Portdialog-portlast updated 27 Nov 20182099 tcpH.225.0 Annex G Signallingh2250-annex-glast updated 27 Nov 20182099 udpH.225.0 Annex G Signallingh2250-annex-glast updated 27 Nov 20182100 tcpAmiga Network Filesystemamiganetfslast updated 27 Nov 20182100 udpAmiga Network Filesystemamiganetfslast updated 27 Nov 20182101 tcprtcm-sc104rtcm-sc104last updated 27 Nov 20182101 udprtcm-sc104rtcm-sc104last updated 27 Nov 20182102 tcpZephyr serverzephyr-srvlast updated 27 Nov 20182102 udpZephyr serverzephyr-srvlast updated 27 Nov 20182103 tcpZephyr serv-hm connectionzephyr-cltlast updated 27 Nov 20182103 udpZephyr serv-hm connectionzephyr-cltlast updated 27 Nov 20182104 tcpZephyr hostmanagerzephyr-hmlast updated 27 Nov 20182104 udpZephyr hostmanagerzephyr-hmlast updated 27 Nov 20182105 tcpMiniPayminipaylast updated 27 Nov 20182105 udpMiniPayminipaylast updated 27 Nov 20182106 tcpMZAPmzaplast updated 27 Nov 20182106 udpMZAPmzaplast updated 27 Nov 20182107 tcpBinTec Adminbintec-adminlast updated 27 Nov 20182107 udpBinTec Adminbintec-adminlast updated 27 Nov 20182108 tcpComcamcomcamlast updated 27 Nov 20182108 udpComcamcomcamlast updated 27 Nov 20182109 tcpErgolightergolightlast updated 27 Nov 20182109 udpErgolightergolightlast updated 27 Nov 20182110 tcpUMSPumsplast updated 27 Nov 20182110 udpUMSPumsplast updated 27 Nov 20182111 tcpOPNET Dynamic Sampling Agent Transaction Protocoldsatplast updated 27 Nov 20182111 udpOPNET Dynamic Sampling Agent Transaction Protocoldsatplast updated 27 Nov 20182112 tcpIdonix MetaNetidonix-metanetlast updated 27 Nov 20182112 udpIdonix MetaNetidonix-metanetlast updated 27 Nov 20182113 tcpHSL StoRMhsl-stormlast updated 27 Nov 20182113 udpHSL StoRMhsl-stormlast updated 27 Nov 20182114 tcpClassical Music Meta-Data Access and Enhancementariascribelast updated 27 Nov 20182114 udpClassical Music Meta-Data Access and Enhancementariascribelast updated 27 Nov 20182115 tcpKey Distribution Managerkdmlast updated 27 Nov 20182115 udpKey Distribution Managerkdmlast updated 27 Nov 20182116 tcpCCOWCMRccowcmrlast updated 27 Nov 20182116 udpCCOWCMRccowcmrlast updated 27 Nov 20182117 tcpMENTACLIENTmentaclientlast updated 27 Nov 20182117 udpMENTACLIENTmentaclientlast updated 27 Nov 20182118 tcpMENTASERVERmentaserverlast updated 27 Nov 20182118 udpMENTASERVERmentaserverlast updated 27 Nov 20182119 tcpGSIGATEKEEPERgsigatekeeperlast updated 27 Nov 20182119 udpGSIGATEKEEPERgsigatekeeperlast updated 27 Nov 20182120 tcpQuick Eagle Networks CPqencplast updated 27 Nov 20182120 udpQuick Eagle Networks CPqencplast updated 27 Nov 20182121 tcpSCIENTIA-SSDBscientia-ssdblast updated 27 Nov 20182121 udpSCIENTIA-SSDBscientia-ssdblast updated 27 Nov 20182122 tcpCauPC Remote Controlcaupc-remotelast updated 27 Nov 20182122 udpCauPC Remote Controlcaupc-remotelast updated 27 Nov 20182123 tcpGTP-Control Plane (3GPP)gtp-controllast updated 27 Nov 20182123 udpGTP-Control Plane (3GPP)gtp-controllast updated 27 Nov 20182124 tcpELATELINKelatelinklast updated 27 Nov 20182124 udpELATELINKelatelinklast updated 27 Nov 20182125 tcpLOCKSTEPlocksteplast updated 27 Nov 20182125 udpLOCKSTEPlocksteplast updated 27 Nov 20182126 tcpPktCable-COPSpktcable-copslast updated 27 Nov 20182126 udpPktCable-COPSpktcable-copslast updated 27 Nov 20182127 tcpINDEX-PC-WBindex-pc-wblast updated 27 Nov 20182127 udpINDEX-PC-WBindex-pc-wblast updated 27 Nov 20182128 tcpNet Steward Controlnet-stewardlast updated 27 Nov 20182128 udpNet Steward Controlnet-stewardlast updated 27 Nov 20182129 tcpcs-live.comcs-livelast updated 27 Nov 20182129 udpcs-live.comcs-livelast updated 27 Nov 20182130 tcpXDSxdslast updated 27 Nov 20182130 udpXDSxdslast updated 27 Nov 20182131 tcpAvantageb2bavantageb2blast updated 27 Nov 20182131 udpAvantageb2bavantageb2blast updated 27 Nov 20182132 tcpSoleraTec End Point Mapsolera-epmaplast updated 27 Nov 20182132 udpSoleraTec End Point Mapsolera-epmaplast updated 27 Nov 20182133 tcpZYMED-ZPPzymed-zpplast updated 27 Nov 20182133 udpZYMED-ZPPzymed-zpplast updated 27 Nov 20182134 tcpAVENUEavenuelast updated 27 Nov 20182134 udpAVENUEavenuelast updated 27 Nov 20182135 tcpGrid Resource Information Servergrislast updated 27 Nov 20182135 udpGrid Resource Information Servergrislast updated 27 Nov 20182136 tcpAPPWORXSRVappworxsrvlast updated 27 Nov 20182136 udpAPPWORXSRVappworxsrvlast updated 27 Nov 20182137 tcpCONNECTconnectlast updated 27 Nov 20182137 udpCONNECTconnectlast updated 27 Nov 20182138 tcpUNBIND-CLUSTERunbind-clusterlast updated 27 Nov 20182138 udpUNBIND-CLUSTERunbind-clusterlast updated 27 Nov 20182139 tcpIAS-AUTHias-authlast updated 27 Nov 20182139 udpIAS-AUTHias-authlast updated 27 Nov 20182140 tcpIAS-REGias-reglast updated 27 Nov 20182140 udpIAS-REGias-reglast updated 27 Nov 20182141 tcpIAS-ADMINDias-admindlast updated 27 Nov 20182141 udpIAS-ADMINDias-admindlast updated 27 Nov 20182142 tcpTDM OVER IPtdmoiplast updated 27 Nov 20182142 udpTDM OVER IPtdmoiplast updated 27 Nov 20182143 tcpLive Vault Job Controllv-jclast updated 27 Nov 20182143 udpLive Vault Job Controllv-jclast updated 27 Nov 20182144 tcpLive Vault Fast Object Transferlv-ffxlast updated 27 Nov 20182144 udpLive Vault Fast Object Transferlv-ffxlast updated 27 Nov 20182145 tcpLive Vault Remote Diagnostic Console Supportlv-picilast updated 27 Nov 20182145 udpLive Vault Remote Diagnostic Console Supportlv-picilast updated 27 Nov 20182146 tcpLive Vault Admin Event Notificationlv-notlast updated 27 Nov 20182146 udpLive Vault Admin Event Notificationlv-notlast updated 27 Nov 20182147 tcpLive Vault Authenticationlv-authlast updated 27 Nov 20182147 udpLive Vault Authenticationlv-authlast updated 27 Nov 20182148 tcpVERITAS UNIVERSAL COMMUNICATION LAYERveritas-ucllast updated 27 Nov 20182148 udpVERITAS UNIVERSAL COMMUNICATION LAYERveritas-ucllast updated 27 Nov 20182149 tcpACPTSYSacptsyslast updated 27 Nov 20182149 udpACPTSYSacptsyslast updated 27 Nov 20182150 tcpDYNAMIC3Ddynamic3dlast updated 27 Nov 20182150 udpDYNAMIC3Ddynamic3dlast updated 27 Nov 20182151 tcpDOCENTdocentlast updated 27 Nov 20182151 udpDOCENTdocentlast updated 27 Nov 20182152 tcpGTP-User Plane (3GPP)gtp-userlast updated 27 Nov 20182152 udpGTP-User Plane (3GPP)gtp-userlast updated 27 Nov 20182153 tcpControl Protocolctlptclast updated 27 Nov 20182153 udpControl Protocolctlptclast updated 27 Nov 20182154 tcpStandard Protocolstdptclast updated 27 Nov 20182154 udpStandard Protocolstdptclast updated 27 Nov 20182155 tcpBridge Protocolbrdptclast updated 27 Nov 20182155 udpBridge Protocolbrdptclast updated 27 Nov 20182156 tcpTalari Reliable Protocoltrplast updated 27 Nov 20182156 udpTalari Reliable Protocoltrplast updated 27 Nov 20182157 tcpXerox Network Document Scan Protocolxndslast updated 27 Nov 20182157 udpXerox Network Document Scan Protocolxndslast updated 27 Nov 20182158 tcpTouchNetPlus Servicetouchnetpluslast updated 27 Nov 20182158 udpTouchNetPlus Servicetouchnetpluslast updated 27 Nov 20182159 tcpGDB Remote Debug Portgdbremotelast updated 27 Nov 20182159 udpGDB Remote Debug Portgdbremotelast updated 27 Nov 20182160 tcpAPC 2160apc-2160last updated 27 Nov 20182160 udpAPC 2160apc-2160last updated 27 Nov 20182161 tcpAPC 2161apc-2161last updated 27 Nov 20182161 udpAPC 2161apc-2161last updated 27 Nov 20182162 tcpNavispherenavispherelast updated 27 Nov 20182162 udpNavispherenavispherelast updated 27 Nov 20182163 tcpNavisphere Securenavisphere-seclast updated 27 Nov 20182163 udpNavisphere Securenavisphere-seclast updated 27 Nov 20182164 tcpDynamic DNS Version 3ddns-v3last updated 27 Nov 20182164 udpDynamic DNS Version 3ddns-v3last updated 27 Nov 20182165 tcpX-Bone APIx-bone-apilast updated 27 Nov 20182165 udpX-Bone APIx-bone-apilast updated 27 Nov 20182166 tcpiwserveriwserverlast updated 27 Nov 20182166 udpiwserveriwserverlast updated 27 Nov 20182167 tcpRaw Async Serial Linkraw-seriallast updated 27 Nov 20182167 udpRaw Async Serial Linkraw-seriallast updated 27 Nov 20182168 tcpeasy-soft Multiplexereasy-soft-muxlast updated 27 Nov 20182168 udpeasy-soft Multiplexereasy-soft-muxlast updated 27 Nov 20182169 tcpBackbone for Academic Information Notification (BRAIN)brainlast updated 27 Nov 20182169 udpBackbone for Academic Information Notification (BRAIN)brainlast updated 27 Nov 20182170 tcpEyeTV Server Porteyetvlast updated 27 Nov 20182170 udpEyeTV Server Porteyetvlast updated 27 Nov 20182171 tcpMS Firewall Storagemsfw-storagelast updated 27 Nov 20182171 udpMS Firewall Storagemsfw-storagelast updated 27 Nov 20182172 tcpMS Firewall SecureStoragemsfw-s-storagelast updated 27 Nov 20182172 udpMS Firewall SecureStoragemsfw-s-storagelast updated 27 Nov 20182173 tcpMS Firewall Replicationmsfw-replicalast updated 27 Nov 20182173 udpMS Firewall Replicationmsfw-replicalast updated 27 Nov 20182174 tcpMS Firewall Intra Arraymsfw-arraylast updated 27 Nov 20182174 udpMS Firewall Intra Arraymsfw-arraylast updated 27 Nov 20182175 tcpMicrosoft Desktop AirSync Protocolairsynclast updated 27 Nov 20182175 udpMicrosoft Desktop AirSync Protocolairsynclast updated 27 Nov 20182176 tcpMicrosoft ActiveSync Remote APIrapilast updated 27 Nov 20182176 udpMicrosoft ActiveSync Remote APIrapilast updated 27 Nov 20182177 tcpqWAVE Bandwidth Estimateqwavelast updated 27 Nov 20182177 udpqWAVE Bandwidth Estimateqwavelast updated 27 Nov 20182178 tcpPeer Services for BITSbitspeerlast updated 27 Nov 20182178 udpPeer Services for BITSbitspeerlast updated 27 Nov 20182179 tcpMicrosoft RDP for virtual machinesvmrdplast updated 27 Nov 20182179 udpMicrosoft RDP for virtual machinesvmrdplast updated 27 Nov 20182180 tcpMillicent Vendor Gateway Servermc-gt-srvlast updated 27 Nov 20182180 udpMillicent Vendor Gateway Servermc-gt-srvlast updated 27 Nov 20182181 tcpeforwardeforwardlast updated 27 Nov 20182181 udpeforwardeforwardlast updated 27 Nov 20182182 tcpCGN statuscgn-statlast updated 27 Nov 20182182 udpCGN statuscgn-statlast updated 27 Nov 20182183 tcpCode Green configurationcgn-configlast updated 27 Nov 20182183 udpCode Green configurationcgn-configlast updated 27 Nov 20182184 tcpNVD Usernvdlast updated 27 Nov 20182184 udpNVD Usernvdlast updated 27 Nov 20182185 tcpOnBase Distributed Disk Servicesonbase-ddslast updated 27 Nov 20182185 udpOnBase Distributed Disk Servicesonbase-ddslast updated 27 Nov 20182186 tcpGuy-Tek Automated Update Applicationsgtaualast updated 27 Nov 20182186 udpGuy-Tek Automated Update Applicationsgtaualast updated 27 Nov 20182187 tcpSepehr System Management Controlssmclast updated 27 Nov 20182187 udpSepehr System Management Datassmdlast updated 27 Nov 20182188 tcpRadware Resource Pool Managerradware-rpmlast updated 27 Nov 20182188 udpReservedN/Alast updated 27 Nov 20182189 tcpSecure Radware Resource Pool Managerradware-rpm-slast updated 27 Nov 20182189 udpReservedN/Alast updated 27 Nov 20182190 tcpTiVoConnect Beacontivoconnectlast updated 27 Nov 20182190 udpTiVoConnect Beacontivoconnectlast updated 27 Nov 20182191 tcpTvBus Messagingtvbuslast updated 27 Nov 20182191 udpTvBus Messagingtvbuslast updated 27 Nov 20182192 tcpASDIS software managementasdislast updated 27 Nov 20182192 udpASDIS software managementasdislast updated 27 Nov 20182193 tcpDr.Web Enterprise Management Servicedrwcslast updated 27 Nov 20182193 udpDr.Web Enterprise Management Servicedrwcslast updated 27 Nov 20182194-2196 UnassignedN/Alast updated 27 Nov 20182197 tcpMNP data exchangemnp-exchangelast updated 27 Nov 20182197 udpMNP data exchangemnp-exchangelast updated 27 Nov 20182198 tcpOneHome Remote Accessonehome-remotelast updated 27 Nov 20182198 udpOneHome Remote Accessonehome-remotelast updated 27 Nov 20182199 tcpOneHome Service Portonehome-helplast updated 27 Nov 20182199 udpOneHome Service Portonehome-helplast updated 27 Nov 20182200 tcpICIicilast updated 27 Nov 20182200 udpICIicilast updated 27 Nov 20182201 tcpAdvanced Training System Programatslast updated 27 Nov 20182201 udpAdvanced Training System Programatslast updated 27 Nov 20182202 tcpInt. Multimedia Teleconferencing Cosortiumimtc-maplast updated 27 Nov 20182202 udpInt. Multimedia Teleconferencing Cosortiumimtc-maplast updated 27 Nov 20182203 tcpb2 Runtime Protocolb2-runtimelast updated 27 Nov 20182203 udpb2 Runtime Protocolb2-runtimelast updated 27 Nov 20182204 tcpb2 License Serverb2-licenselast updated 27 Nov 20182204 udpb2 License Serverb2-licenselast updated 27 Nov 20182205 tcpJava Presentation Serverjpslast updated 27 Nov 20182205 udpJava Presentation Serverjpslast updated 27 Nov 20182206 tcpHP OpenCall bushpocbuslast updated 27 Nov 20182206 udpHP OpenCall bushpocbuslast updated 27 Nov 20182207 tcpHP Status and Serviceshpssdlast updated 27 Nov 20182207 udpHP Status and Serviceshpssdlast updated 27 Nov 20182208 tcpHP I/O Backendhpiodlast updated 27 Nov 20182208 udpHP I/O Backendhpiodlast updated 27 Nov 20182209 tcpHP RIM for Files Portal Servicerimf-pslast updated 27 Nov 20182209 udpHP RIM for Files Portal Servicerimf-pslast updated 27 Nov 20182210 tcpNOAAPORT Broadcast Networknoaaportlast updated 27 Nov 20182210 udpNOAAPORT Broadcast Networknoaaportlast updated 27 Nov 20182211 tcpEMWINemwinlast updated 27 Nov 20182211 udpEMWINemwinlast updated 27 Nov 20182212 tcpLeeCO POS Server Serviceleecoposserverlast updated 27 Nov 20182212 udpLeeCO POS Server Serviceleecoposserverlast updated 27 Nov 20182213 tcpKalikalilast updated 27 Nov 20182213 udpKalikalilast updated 27 Nov 20182214 tcpRDQ Protocol Interfacerpilast updated 27 Nov 20182214 udpRDQ Protocol Interfacerpilast updated 27 Nov 20182215 tcpIPCore.co.za GPRSipcorelast updated 27 Nov 20182215 udpIPCore.co.za GPRSipcorelast updated 27 Nov 20182216 tcpVTU data servicevtu-commslast updated 27 Nov 20182216 udpVTU data servicevtu-commslast updated 27 Nov 20182217 tcpGoToDevice Device Managementgotodevicelast updated 27 Nov 20182217 udpGoToDevice Device Managementgotodevicelast updated 27 Nov 20182218 tcpBounzza IRC Proxybounzzalast updated 27 Nov 20182218 udpBounzza IRC Proxybounzzalast updated 27 Nov 20182219 tcpNetIQ NCAP Protocolnetiq-ncaplast updated 27 Nov 20182219 udpNetIQ NCAP Protocolnetiq-ncaplast updated 27 Nov 20182220 tcpNetIQ End2Endnetiqlast updated 27 Nov 20182220 udpNetIQ End2Endnetiqlast updated 27 Nov 20182221 tcpEtherNet/IP over TLSethernet-ip-slast updated 27 Nov 20182221 udpEtherNet/IP over DTLSethernet-ip-slast updated 27 Nov 20182222 tcpEtherNet/IP I/O IANA assigned this well-formed service name as a replacement for "EtherNet/IP-1".EtherNet-IP-1last updated 27 Nov 20182222 tcp (EtherNet/IP-1)EtherNet/IP I/OEtherNet/IP-1last updated 27 Nov 20182222 udpEtherNet/IP I/O IANA assigned this well-formed service name as a replacement for "EtherNet/IP-1".EtherNet-IP-1last updated 27 Nov 20182222 udp (EtherNet/IP-1)EtherNet/IP I/OEtherNet/IP-1last updated 27 Nov 20182223 tcpRockwell CSP2rockwell-csp2last updated 27 Nov 20182223 udpRockwell CSP2rockwell-csp2last updated 27 Nov 20182224 tcpEasy Flexible Internet/Multiplayer Gamesefi-mglast updated 27 Nov 20182224 udpEasy Flexible Internet/Multiplayer Gamesefi-mglast updated 27 Nov 20182225 tcpResource Connection Initiation Protocolrcip-itulast updated 27 Nov 20182225 udpReservedN/Alast updated 27 Nov 20182225 sctpResource Connection Initiation Protocolrcip-itulast updated 27 Nov 20182226 tcpDigital Instinct DRMdi-drmlast updated 27 Nov 20182226 udpDigital Instinct DRMdi-drmlast updated 27 Nov 20182227 tcpDI Messaging Servicedi-msglast updated 27 Nov 20182227 udpDI Messaging Servicedi-msglast updated 27 Nov 20182228 tcpeHome Message Serverehome-mslast updated 27 Nov 20182228 udpeHome Message Serverehome-mslast updated 27 Nov 20182229 tcpDataLens Servicedatalenslast updated 27 Nov 20182229 udpDataLens Servicedatalenslast updated 27 Nov 20182230 tcpMetaSoft Job Queue Administration Servicequeueadmlast updated 27 Nov 20182230 udpMetaSoft Job Queue Administration Servicequeueadmlast updated 27 Nov 20182231 tcpWiMAX ASN Control Plane Protocolwimaxasncplast updated 27 Nov 20182231 udpWiMAX ASN Control Plane Protocolwimaxasncplast updated 27 Nov 20182232 tcpIVS Video defaultivs-videolast updated 27 Nov 20182232 udpIVS Video defaultivs-videolast updated 27 Nov 20182233 tcpINFOCRYPTinfocryptlast updated 27 Nov 20182233 udpINFOCRYPTinfocryptlast updated 27 Nov 20182234 tcpDirectPlaydirectplaylast updated 27 Nov 20182234 udpDirectPlaydirectplaylast updated 27 Nov 20182235 tcpSercomm-WLinksercomm-wlinklast updated 27 Nov 20182235 udpSercomm-WLinksercomm-wlinklast updated 27 Nov 20182236 tcpNaninanilast updated 27 Nov 20182236 udpNaninanilast updated 27 Nov 20182237 tcpOptech Port1 License Manageroptech-port1-lmlast updated 27 Nov 20182237 udpOptech Port1 License Manageroptech-port1-lmlast updated 27 Nov 20182238 tcpAVIVA SNA SERVERaviva-snalast updated 27 Nov 20182238 udpAVIVA SNA SERVERaviva-snalast updated 27 Nov 20182239 tcpImage Queryimagequerylast updated 27 Nov 20182239 udpImage Queryimagequerylast updated 27 Nov 20182240 tcpRECIPerecipelast updated 27 Nov 20182240 udpRECIPerecipelast updated 27 Nov 20182241 tcpIVS Daemonivsdlast updated 27 Nov 20182241 udpIVS Daemonivsdlast updated 27 Nov 20182242 tcpFolio Remote Serverfoliocorplast updated 27 Nov 20182242 udpFolio Remote Serverfoliocorplast updated 27 Nov 20182243 tcpMagicom Protocolmagicomlast updated 27 Nov 20182243 udpMagicom Protocolmagicomlast updated 27 Nov 20182244 tcpNMS Servernmsserverlast updated 27 Nov 20182244 udpNMS Servernmsserverlast updated 27 Nov 20182245 tcpHaOhaolast updated 27 Nov 20182245 udpHaOhaolast updated 27 Nov 20182246 tcpPacketCable MTA Addr Mappc-mta-addrmaplast updated 27 Nov 20182246 udpPacketCable MTA Addr Mappc-mta-addrmaplast updated 27 Nov 20182247 tcpAntidote Deployment Manager Serviceantidotemgrsvrlast updated 27 Nov 20182247 udpAntidote Deployment Manager Serviceantidotemgrsvrlast updated 27 Nov 20182248 tcpUser Management Serviceumslast updated 27 Nov 20182248 udpUser Management Serviceumslast updated 27 Nov 20182249 tcpRISO File Manager Protocolrfmplast updated 27 Nov 20182249 udpRISO File Manager Protocolrfmplast updated 27 Nov 20182250 tcpremote-collabremote-collablast updated 27 Nov 20182250 udpremote-collabremote-collablast updated 27 Nov 20182251 tcpDistributed Framework Portdif-portlast updated 27 Nov 20182251 udpDistributed Framework Portdif-portlast updated 27 Nov 20182252 tcpNJENET using SSLnjenet-ssllast updated 27 Nov 20182252 udpNJENET using SSLnjenet-ssllast updated 27 Nov 20182253 tcpDTV Channel Requestdtv-chan-reqlast updated 27 Nov 20182253 udpDTV Channel Requestdtv-chan-reqlast updated 27 Nov 20182254 tcpSeismic P.O.C. Portseispoclast updated 27 Nov 20182254 udpSeismic P.O.C. Portseispoclast updated 27 Nov 20182255 tcpVRTP - ViRtue Transfer Protocolvrtplast updated 27 Nov 20182255 udpVRTP - ViRtue Transfer Protocolvrtplast updated 27 Nov 20182256 tcpPCC MFPpcc-mfplast updated 27 Nov 20182256 udpPCC MFPpcc-mfplast updated 27 Nov 20182257 tcpsimple text/file transfersimple-tx-rxlast updated 27 Nov 20182257 udpsimple text/file transfersimple-tx-rxlast updated 27 Nov 20182258 tcpRotorcraft Communications Test Systemrctslast updated 27 Nov 20182258 udpRotorcraft Communications Test Systemrctslast updated 27 Nov 20182259 UnassignedN/Alast updated 27 Nov 20182260 tcpAPC 2260apc-2260last updated 27 Nov 20182260 udpAPC 2260apc-2260last updated 27 Nov 20182261 tcpCoMotion Master Servercomotionmasterlast updated 27 Nov 20182261 udpCoMotion Master Servercomotionmasterlast updated 27 Nov 20182262 tcpCoMotion Backup Servercomotionbacklast updated 27 Nov 20182262 udpCoMotion Backup Servercomotionbacklast updated 27 Nov 20182263 tcpECweb Configuration Serviceecwcfglast updated 27 Nov 20182263 udpECweb Configuration Serviceecwcfglast updated 27 Nov 20182264 tcpAudio Precision Apx500 API Port 1apx500api-1last updated 27 Nov 20182264 udpAudio Precision Apx500 API Port 1apx500api-1last updated 27 Nov 20182265 tcpAudio Precision Apx500 API Port 2apx500api-2last updated 27 Nov 20182265 udpAudio Precision Apx500 API Port 2apx500api-2last updated 27 Nov 20182266 tcpM-Files Servermfserverlast updated 27 Nov 20182266 udpM-files Servermfserverlast updated 27 Nov 20182267 tcpOntoBrokerontobrokerlast updated 27 Nov 20182267 udpOntoBrokerontobrokerlast updated 27 Nov 20182268 tcpAMTamtlast updated 27 Nov 20182268 udpAMTamtlast updated 27 Nov 20182269 tcpMIKEYmikeylast updated 27 Nov 20182269 udpMIKEYmikeylast updated 27 Nov 20182270 tcpstarSchoolstarschoollast updated 27 Nov 20182270 udpstarSchoolstarschoollast updated 27 Nov 20182271 tcpSecure Meeting Maker Schedulingmmcalslast updated 27 Nov 20182271 udpSecure Meeting Maker Schedulingmmcalslast updated 27 Nov 20182272 tcpMeeting Maker Schedulingmmcallast updated 27 Nov 20182272 udpMeeting Maker Schedulingmmcallast updated 27 Nov 20182273 tcpMySQL Instance Managermysql-imlast updated 27 Nov 20182273 udpMySQL Instance Managermysql-imlast updated 27 Nov 20182274 tcpPCTTunnellerpcttunnelllast updated 27 Nov 20182274 udpPCTTunnellerpcttunnelllast updated 27 Nov 20182275 tcpiBridge Conferencingibridge-datalast updated 27 Nov 20182275 udpiBridge Conferencingibridge-datalast updated 27 Nov 20182276 tcpiBridge Managementibridge-mgmtlast updated 27 Nov 20182276 udpiBridge Managementibridge-mgmtlast updated 27 Nov 20182277 tcpBt device control proxybluectrlproxylast updated 27 Nov 20182277 udpBt device control proxybluectrlproxylast updated 27 Nov 20182278 tcpSimple Stacked Sequences Databases3dblast updated 27 Nov 20182278 udpSimple Stacked Sequences Databases3dblast updated 27 Nov 20182279 tcpxmqueryxmquerylast updated 27 Nov 20182279 udpxmqueryxmquerylast updated 27 Nov 20182280 tcpLNVPOLLERlnvpollerlast updated 27 Nov 20182280 udpLNVPOLLERlnvpollerlast updated 27 Nov 20182281 tcpLNVCONSOLElnvconsolelast updated 27 Nov 20182281 udpLNVCONSOLElnvconsolelast updated 27 Nov 20182282 tcpLNVALARMlnvalarmlast updated 27 Nov 20182282 udpLNVALARMlnvalarmlast updated 27 Nov 20182283 tcpLNVSTATUSlnvstatuslast updated 27 Nov 20182283 udpLNVSTATUSlnvstatuslast updated 27 Nov 20182284 tcpLNVMAPSlnvmapslast updated 27 Nov 20182284 udpLNVMAPSlnvmapslast updated 27 Nov 20182285 tcpLNVMAILMONlnvmailmonlast updated 27 Nov 20182285 udpLNVMAILMONlnvmailmonlast updated 27 Nov 20182286 tcpNAS-Meteringnas-meteringlast updated 27 Nov 20182286 udpNAS-Meteringnas-meteringlast updated 27 Nov 20182287 tcpDNAdnalast updated 27 Nov 20182287 udpDNAdnalast updated 27 Nov 20182288 tcpNETMLnetmllast updated 27 Nov 20182288 udpNETMLnetmllast updated 27 Nov 20182289 tcpLookup dict serverdict-lookuplast updated 27 Nov 20182289 udpLookup dict serverdict-lookuplast updated 27 Nov 20182290 tcpSonus Logging Servicessonus-logginglast updated 27 Nov 20182290 udpSonus Logging Servicessonus-logginglast updated 27 Nov 20182291 tcpEPSON Advanced Printer Share Protocoleapsplast updated 27 Nov 20182291 udpEPSON Advanced Printer Share Protocoleapsplast updated 27 Nov 20182292 tcpSonus Element Management Servicesmib-streaminglast updated 27 Nov 20182292 udpSonus Element Management Servicesmib-streaminglast updated 27 Nov 20182293 tcpNetwork Platform Debug Managernpdbgmngrlast updated 27 Nov 20182293 udpNetwork Platform Debug Managernpdbgmngrlast updated 27 Nov 20182294 tcpKonshus License Manager (FLEX)konshus-lmlast updated 27 Nov 20182294 udpKonshus License Manager (FLEX)konshus-lmlast updated 27 Nov 20182295 tcpAdvant License Manageradvant-lmlast updated 27 Nov 20182295 udpAdvant License Manageradvant-lmlast updated 27 Nov 20182296 tcpTheta License Manager (Rainbow)theta-lmlast updated 27 Nov 20182296 udpTheta License Manager (Rainbow)theta-lmlast updated 27 Nov 20182297 tcpD2K DataMover 1d2k-datamover1last updated 27 Nov 20182297 udpD2K DataMover 1d2k-datamover1last updated 27 Nov 20182298 tcpD2K DataMover 2d2k-datamover2last updated 27 Nov 20182298 udpD2K DataMover 2d2k-datamover2last updated 27 Nov 20182299 tcpPC Telecommutepc-telecommutelast updated 27 Nov 20182299 udpPC Telecommutepc-telecommutelast updated 27 Nov 20182300 tcpCVMMONcvmmonlast updated 27 Nov 20182300 udpCVMMONcvmmonlast updated 27 Nov 20182301 tcpCompaq HTTPcpq-wbemlast updated 27 Nov 20182301 udpCompaq HTTPcpq-wbemlast updated 27 Nov 20182302 tcpBindery Supportbinderysupportlast updated 27 Nov 20182302 udpBindery Supportbinderysupportlast updated 27 Nov 20182303 tcpProxy Gatewayproxy-gatewaylast updated 27 Nov 20182303 udpProxy Gatewayproxy-gatewaylast updated 27 Nov 20182304 tcpAttachmate UTSattachmate-utslast updated 27 Nov 20182304 udpAttachmate UTSattachmate-utslast updated 27 Nov 20182305 tcpMT ScaleServermt-scaleserverlast updated 27 Nov 20182305 udpMT ScaleServermt-scaleserverlast updated 27 Nov 20182306 tcpTAPPI BoxNettappi-boxnetlast updated 27 Nov 20182306 udpTAPPI BoxNettappi-boxnetlast updated 27 Nov 20182307 tcppehelppehelplast updated 27 Nov 20182307 udppehelppehelplast updated 27 Nov 20182308 tcpsdhelpsdhelplast updated 27 Nov 20182308 udpsdhelpsdhelplast updated 27 Nov 20182309 tcpSD Serversdserverlast updated 27 Nov 20182309 udpSD Serversdserverlast updated 27 Nov 20182310 tcpSD Clientsdclientlast updated 27 Nov 20182310 udpSD Clientsdclientlast updated 27 Nov 20182311 tcpMessage Servicemessageservicelast updated 27 Nov 20182311 udpMessage Servicemessageservicelast updated 27 Nov 20182312 tcpWANScaler Communication Servicewanscalerlast updated 27 Nov 20182312 udpWANScaler Communication Servicewanscalerlast updated 27 Nov 20182313 tcpIAPP (Inter Access Point Protocol)iapplast updated 27 Nov 20182313 udpIAPP (Inter Access Point Protocol)iapplast updated 27 Nov 20182314 tcpCR WebSystemscr-websystemslast updated 27 Nov 20182314 udpCR WebSystemscr-websystemslast updated 27 Nov 20182315 tcpPrecise Sft.precise-sftlast updated 27 Nov 20182315 udpPrecise Sft.precise-sftlast updated 27 Nov 20182316 tcpSENT License Managersent-lmlast updated 27 Nov 20182316 udpSENT License Managersent-lmlast updated 27 Nov 20182317 tcpAttachmate G32attachmate-g32last updated 27 Nov 20182317 udpAttachmate G32attachmate-g32last updated 27 Nov 20182318 tcpCadence Controlcadencecontrollast updated 27 Nov 20182318 udpCadence Controlcadencecontrollast updated 27 Nov 20182319 tcpInfoLibriainfolibrialast updated 27 Nov 20182319 udpInfoLibriainfolibrialast updated 27 Nov 20182320 tcpSiebel NSsiebel-nslast updated 27 Nov 20182320 udpSiebel NSsiebel-nslast updated 27 Nov 20182321 tcpRDLAPrdlaplast updated 27 Nov 20182321 udpRDLAPrdlaplast updated 27 Nov 20182322 tcpofsdofsdlast updated 27 Nov 20182322 udpofsdofsdlast updated 27 Nov 20182323 tcp3d-nfsd3d-nfsdlast updated 27 Nov 20182323 udp3d-nfsd3d-nfsdlast updated 27 Nov 20182324 tcpCosmocallcosmocalllast updated 27 Nov 20182324 udpCosmocallcosmocalllast updated 27 Nov 20182325 tcpANSYS Licensing Interconnectansyslilast updated 27 Nov 20182325 udpANSYS Licensing Interconnectansyslilast updated 27 Nov 20182326 tcpIDCPidcplast updated 27 Nov 20182326 udpIDCPidcplast updated 27 Nov 20182327 tcpxingcsmxingcsmlast updated 27 Nov 20182327 udpxingcsmxingcsmlast updated 27 Nov 20182328 tcpNetrix SFTMnetrix-sftmlast updated 27 Nov 20182328 udpNetrix SFTMnetrix-sftmlast updated 27 Nov 20182329 tcpNVDnvdlast updated 27 Nov 20182329 udpNVDnvdlast updated 27 Nov 20182330 tcpTSCCHATtscchatlast updated 27 Nov 20182330 udpTSCCHATtscchatlast updated 27 Nov 20182331 tcpAGENTVIEWagentviewlast updated 27 Nov 20182331 udpAGENTVIEWagentviewlast updated 27 Nov 20182332 tcpRCC Hostrcc-hostlast updated 27 Nov 20182332 udpRCC Hostrcc-hostlast updated 27 Nov 20182333 tcpSNAPPsnapplast updated 27 Nov 20182333 udpSNAPPsnapplast updated 27 Nov 20182334 tcpACE Client Authace-clientlast updated 27 Nov 20182334 udpACE Client Authace-clientlast updated 27 Nov 20182335 tcpACE Proxyace-proxylast updated 27 Nov 20182335 udpACE Proxyace-proxylast updated 27 Nov 20182336 tcpApple UG Controlappleugcontrollast updated 27 Nov 20182336 udpApple UG Controlappleugcontrollast updated 27 Nov 20182337 tcpideesrvideesrvlast updated 27 Nov 20182337 udpideesrvideesrvlast updated 27 Nov 20182338 tcpNorton Lambertnorton-lambertlast updated 27 Nov 20182338 udpNorton Lambertnorton-lambertlast updated 27 Nov 20182339 tcp3Com WebView3com-webviewlast updated 27 Nov 20182339 udp3Com WebView3com-webviewlast updated 27 Nov 20182340 tcpWRS Registry IANA assigned this well-formed service name as a replacement for "wrs_registry".wrs-registrylast updated 27 Nov 20182340 tcp (wrs_registry)WRS Registrywrs_registrylast updated 27 Nov 20182340 udpWRS Registry IANA assigned this well-formed service name as a replacement for "wrs_registry".wrs-registrylast updated 27 Nov 20182340 udp (wrs_registry)WRS Registrywrs_registrylast updated 27 Nov 20182341 tcpXIO Statusxiostatuslast updated 27 Nov 20182341 udpXIO Statusxiostatuslast updated 27 Nov 20182342 tcpSeagate Manage Execmanage-execlast updated 27 Nov 20182342 udpSeagate Manage Execmanage-execlast updated 27 Nov 20182343 tcpnati logosnati-logoslast updated 27 Nov 20182343 udpnati logosnati-logoslast updated 27 Nov 20182344 tcpfcmsysfcmsyslast updated 27 Nov 20182344 udpfcmsysfcmsyslast updated 27 Nov 20182345 tcpdbmdbmlast updated 27 Nov 20182345 udpdbmdbmlast updated 27 Nov 20182346 tcpGame Connection Port IANA assigned this well-formed service name as a replacement for "redstorm_join".redstorm-joinlast updated 27 Nov 20182346 tcp (redstorm_join)Game Connection Portredstorm_joinlast updated 27 Nov 20182346 udpGame Connection Port IANA assigned this well-formed service name as a replacement for "redstorm_join".redstorm-joinlast updated 27 Nov 20182346 udp (redstorm_join)Game Connection Portredstorm_joinlast updated 27 Nov 20182347 tcpGame Announcement and Location IANA assigned this well-formed service name as a replacement for "redstorm_find".redstorm-findlast updated 27 Nov 20182347 tcp (redstorm_find)Game Announcement and Locationredstorm_findlast updated 27 Nov 20182347 udpGame Announcement and Location IANA assigned this well-formed service name as a replacement for "redstorm_find".redstorm-findlast updated 27 Nov 20182347 udp (redstorm_find)Game Announcement and Locationredstorm_findlast updated 27 Nov 20182348 tcpInformation to query for game status IANA assigned this well-formed service name as a replacement for "redstorm_info".redstorm-infolast updated 27 Nov 20182348 tcp (redstorm_info)Information to query for game statusredstorm_infolast updated 27 Nov 20182348 udpInformation to query for game status IANA assigned this well-formed service name as a replacement for "redstorm_info".redstorm-infolast updated 27 Nov 20182348 udp (redstorm_info)Information to query for game statusredstorm_infolast updated 27 Nov 20182349 tcpDiagnostics Port IANA assigned this well-formed service name as a replacement for "redstorm_diag".redstorm-diaglast updated 27 Nov 20182349 tcp (redstorm_diag)Diagnostics Portredstorm_diaglast updated 27 Nov 20182349 udpDiagnostics Port IANA assigned this well-formed service name as a replacement for "redstorm_diag".redstorm-diaglast updated 27 Nov 20182349 udp (redstorm_diag)Diagnostics Portredstorm_diaglast updated 27 Nov 20182350 tcpPharos Booking Serverpsbserverlast updated 27 Nov 20182350 udpPharos Booking Serverpsbserverlast updated 27 Nov 20182351 tcppsrserverpsrserverlast updated 27 Nov 20182351 udppsrserverpsrserverlast updated 27 Nov 20182352 tcppslserverpslserverlast updated 27 Nov 20182352 udppslserverpslserverlast updated 27 Nov 20182353 tcppspserverpspserverlast updated 27 Nov 20182353 udppspserverpspserverlast updated 27 Nov 20182354 tcppsprserverpsprserverlast updated 27 Nov 20182354 udppsprserverpsprserverlast updated 27 Nov 20182355 tcppsdbserverpsdbserverlast updated 27 Nov 20182355 udppsdbserverpsdbserverlast updated 27 Nov 20182356 tcpGXT License Managemantgxtelmdlast updated 27 Nov 20182356 udpGXT License Managemantgxtelmdlast updated 27 Nov 20182357 tcpUniHub Serverunihub-serverlast updated 27 Nov 20182357 udpUniHub Serverunihub-serverlast updated 27 Nov 20182358 tcpFutrixfutrixlast updated 27 Nov 20182358 udpFutrixfutrixlast updated 27 Nov 20182359 tcpFlukeServerflukeserverlast updated 27 Nov 20182359 udpFlukeServerflukeserverlast updated 27 Nov 20182360 tcpNexstorIndLtdnexstorindltdlast updated 27 Nov 20182360 udpNexstorIndLtdnexstorindltdlast updated 27 Nov 20182361 tcpTL1tl1last updated 27 Nov 20182361 udpTL1tl1last updated 27 Nov 20182362 tcpdigimandigimanlast updated 27 Nov 20182362 udpdigimandigimanlast updated 27 Nov 20182363 tcpMedia Central NFSDmediacntrlnfsdlast updated 27 Nov 20182363 udpMedia Central NFSDmediacntrlnfsdlast updated 27 Nov 20182364 tcpOI-2000oi-2000last updated 27 Nov 20182364 udpOI-2000oi-2000last updated 27 Nov 20182365 tcpdbrefdbreflast updated 27 Nov 20182365 udpdbrefdbreflast updated 27 Nov 20182366 tcpqip-loginqip-loginlast updated 27 Nov 20182366 udpqip-loginqip-loginlast updated 27 Nov 20182367 tcpService Controlservice-ctrllast updated 27 Nov 20182367 udpService Controlservice-ctrllast updated 27 Nov 20182368 tcpOpenTableopentablelast updated 27 Nov 20182368 udpOpenTableopentablelast updated 27 Nov 20182369 UnassignedN/Alast updated 27 Nov 20182370 tcpL3-HBMonl3-hbmonlast updated 27 Nov 20182370 udpL3-HBMonl3-hbmonlast updated 27 Nov 20182371 tcpRemote Device Accessrdalast updated 27 Nov 20182371 udpReservedN/Alast updated 27 Nov 20182372 tcpLanMessengerlanmessengerlast updated 27 Nov 20182372 udpLanMessengerlanmessengerlast updated 27 Nov 20182373 tcpRemograph License Managerremographlmlast updated 27 Nov 20182373 udpReservedN/Alast updated 27 Nov 20182374 tcpHydra RPChydralast updated 27 Nov 20182374 udpReservedN/Alast updated 27 Nov 20182375 tcpDocker REST API (plain text)dockerlast updated 27 Nov 20182375 udpReservedN/Alast updated 27 Nov 20182376 tcpDocker REST API (ssl)docker-slast updated 27 Nov 20182377 tcpRPC interface for Docker Swarmswarmlast updated 27 Nov 20182377 udpReservedN/Alast updated 27 Nov 20182378 UnassignedN/Alast updated 27 Nov 20182379 tcpetcd client communicationetcd-clientlast updated 27 Nov 20182379 udpReservedN/Alast updated 27 Nov 20182380 tcpetcd server to server communicationetcd-serverlast updated 27 Nov 20182380 udpReservedN/Alast updated 27 Nov 20182381 tcpCompaq HTTPScompaq-httpslast updated 27 Nov 20182381 udpCompaq HTTPScompaq-httpslast updated 27 Nov 20182382 tcpMicrosoft OLAPms-olap3last updated 27 Nov 20182382 udpMicrosoft OLAPms-olap3last updated 27 Nov 20182383 tcpMicrosoft OLAPms-olap4last updated 27 Nov 20182383 udpMicrosoft OLAPms-olap4last updated 27 Nov 20182384 tcpSD-REQUESTsd-requestlast updated 27 Nov 20182384 udpSD-CAPACITYsd-capacitylast updated 27 Nov 20182385 tcpSD-DATAsd-datalast updated 27 Nov 20182385 udpSD-DATAsd-datalast updated 27 Nov 20182386 tcpVirtual Tapevirtualtapelast updated 27 Nov 20182386 udpVirtual Tapevirtualtapelast updated 27 Nov 20182387 tcpVSAM Redirectorvsamredirectorlast updated 27 Nov 20182387 udpVSAM Redirectorvsamredirectorlast updated 27 Nov 20182388 tcpMYNAH AutoStartmynahautostartlast updated 27 Nov 20182388 udpMYNAH AutoStartmynahautostartlast updated 27 Nov 20182389 tcpOpenView Session Mgrovsessionmgrlast updated 27 Nov 20182389 udpOpenView Session Mgrovsessionmgrlast updated 27 Nov 20182390 tcpRSMTPrsmtplast updated 27 Nov 20182390 udpRSMTPrsmtplast updated 27 Nov 20182391 tcp3COM Net Management3com-net-mgmtlast updated 27 Nov 20182391 udp3COM Net Management3com-net-mgmtlast updated 27 Nov 20182392 tcpTactical Authtacticalauthlast updated 27 Nov 20182392 udpTactical Authtacticalauthlast updated 27 Nov 20182393 tcpMS OLAP 1ms-olap1last updated 27 Nov 20182393 udpMS OLAP 1ms-olap1last updated 27 Nov 20182394 tcpMS OLAP 2ms-olap2last updated 27 Nov 20182394 udpMS OLAP 2ms-olap2last updated 27 Nov 20182395 tcpLAN900 Remote IANA assigned this well-formed service name as a replacement for "lan900_remote".lan900-remotelast updated 27 Nov 20182395 tcp (lan900_remote)LAN900 Remotelan900_remotelast updated 27 Nov 20182395 udpLAN900 Remote IANA assigned this well-formed service name as a replacement for "lan900_remote".lan900-remotelast updated 27 Nov 20182395 udp (lan900_remote)LAN900 Remotelan900_remotelast updated 27 Nov 20182396 tcpWusagewusagelast updated 27 Nov 20182396 udpWusagewusagelast updated 27 Nov 20182397 tcpNCLncllast updated 27 Nov 20182397 udpNCLncllast updated 27 Nov 20182398 tcpOrbiterorbiterlast updated 27 Nov 20182398 udpOrbiterorbiterlast updated 27 Nov 20182399 tcpFileMaker, Inc. - Data Access Layerfmpro-fdallast updated 27 Nov 20182399 udpFileMaker, Inc. - Data Access Layerfmpro-fdallast updated 27 Nov 20182400 tcpOpEquus Serveropequus-serverlast updated 27 Nov 20182400 udpOpEquus Serveropequus-serverlast updated 27 Nov 20182401 tcpcvspservercvspserverlast updated 27 Nov 20182401 udpcvspservercvspserverlast updated 27 Nov 20182402 tcpTaskMaster 2000 Servertaskmaster2000last updated 27 Nov 20182402 udpTaskMaster 2000 Servertaskmaster2000last updated 27 Nov 20182403 tcpTaskMaster 2000 Webtaskmaster2000last updated 27 Nov 20182403 udpTaskMaster 2000 Webtaskmaster2000last updated 27 Nov 20182404 tcpIEC 60870-5-104 process control over IPiec-104last updated 27 Nov 20182404 udpIEC 60870-5-104 process control over IPiec-104last updated 27 Nov 20182405 tcpTRC Netpolltrc-netpolllast updated 27 Nov 20182405 udpTRC Netpolltrc-netpolllast updated 27 Nov 20182406 tcpJediServerjediserverlast updated 27 Nov 20182406 udpJediServerjediserverlast updated 27 Nov 20182407 tcpOrionorionlast updated 27 Nov 20182407 udpOrionorionlast updated 27 Nov 20182408 tcpCloudFlare Railgun Web Acceleration Protocolrailgun-webaccllast updated 27 Nov 20182408 udpReservedN/Alast updated 27 Nov 20182409 tcpSNS Protocolsns-protocollast updated 27 Nov 20182409 udpSNS Protocolsns-protocollast updated 27 Nov 20182410 tcpVRTS Registryvrts-registrylast updated 27 Nov 20182410 udpVRTS Registryvrts-registrylast updated 27 Nov 20182411 tcpNetwave AP Managementnetwave-ap-mgmtlast updated 27 Nov 20182411 udpNetwave AP Managementnetwave-ap-mgmtlast updated 27 Nov 20182412 tcpCDNcdnlast updated 27 Nov 20182412 udpCDNcdnlast updated 27 Nov 20182413 tcporion-rmi-regorion-rmi-reglast updated 27 Nov 20182413 udporion-rmi-regorion-rmi-reglast updated 27 Nov 20182414 tcpBeeyondbeeyondlast updated 27 Nov 20182414 udpBeeyondbeeyondlast updated 27 Nov 20182415 tcpCodima Remote Transaction Protocolcodima-rtplast updated 27 Nov 20182415 udpCodima Remote Transaction Protocolcodima-rtplast updated 27 Nov 20182416 tcpRMT Serverrmtserverlast updated 27 Nov 20182416 udpRMT Serverrmtserverlast updated 27 Nov 20182417 tcpComposit Servercomposit-serverlast updated 27 Nov 20182417 udpComposit Servercomposit-serverlast updated 27 Nov 20182418 tcpcascaslast updated 27 Nov 20182418 udpcascaslast updated 27 Nov 20182419 tcpAttachmate S2Sattachmate-s2slast updated 27 Nov 20182419 udpAttachmate S2Sattachmate-s2slast updated 27 Nov 20182420 tcpDSL Remote Managementdslremote-mgmtlast updated 27 Nov 20182420 udpDSL Remote Managementdslremote-mgmtlast updated 27 Nov 20182421 tcpG-Talkg-talklast updated 27 Nov 20182421 udpG-Talkg-talklast updated 27 Nov 20182422 tcpCRMSBITScrmsbitslast updated 27 Nov 20182422 udpCRMSBITScrmsbitslast updated 27 Nov 20182423 tcpRNRPrnrplast updated 27 Nov 20182423 udpRNRPrnrplast updated 27 Nov 20182424 tcpKOFAX-SVRkofax-svrlast updated 27 Nov 20182424 udpKOFAX-SVRkofax-svrlast updated 27 Nov 20182425 tcpFujitsu App Managerfjitsuappmgrlast updated 27 Nov 20182425 udpFujitsu App Managerfjitsuappmgrlast updated 27 Nov 20182426 tcpVeloCloud MultiPath Protocolvcmplast updated 27 Nov 20182426 udpVeloCloud MultiPath Protocolvcmplast updated 27 Nov 20182427 tcpMedia Gateway Control Protocol Gatewaymgcp-gatewaylast updated 27 Nov 20182427 udpMedia Gateway Control Protocol Gatewaymgcp-gatewaylast updated 27 Nov 20182428 tcpOne Way Trip Timeottlast updated 27 Nov 20182428 udpOne Way Trip Timeottlast updated 27 Nov 20182429 tcpFT-ROLEft-rolelast updated 27 Nov 20182429 udpFT-ROLEft-rolelast updated 27 Nov 20182430 tcpvenusvenuslast updated 27 Nov 20182430 udpvenusvenuslast updated 27 Nov 20182431 tcpvenus-sevenus-selast updated 27 Nov 20182431 udpvenus-sevenus-selast updated 27 Nov 20182432 tcpcodasrvcodasrvlast updated 27 Nov 20182432 udpcodasrvcodasrvlast updated 27 Nov 20182433 tcpcodasrv-secodasrv-selast updated 27 Nov 20182433 udpcodasrv-secodasrv-selast updated 27 Nov 20182434 tcppxc-epmappxc-epmaplast updated 27 Nov 20182434 udppxc-epmappxc-epmaplast updated 27 Nov 20182435 tcpOptiLogicoptilogiclast updated 27 Nov 20182435 udpOptiLogicoptilogiclast updated 27 Nov 20182436 tcpTOP/Xtopxlast updated 27 Nov 20182436 udpTOP/Xtopxlast updated 27 Nov 20182437 tcpUniControlunicontrollast updated 27 Nov 20182437 udpUniControlunicontrollast updated 27 Nov 20182438 tcpMSPmsplast updated 27 Nov 20182438 udpMSPmsplast updated 27 Nov 20182439 tcpSybaseDBSynchsybasedbsynchlast updated 27 Nov 20182439 udpSybaseDBSynchsybasedbsynchlast updated 27 Nov 20182440 tcpSpearway Lockersspearwaylast updated 27 Nov 20182440 udpSpearway Lockersspearwaylast updated 27 Nov 20182441 tcpPervasive I*net Data Serverpvsw-inetlast updated 27 Nov 20182441 udpPervasive I*net Data Serverpvsw-inetlast updated 27 Nov 20182442 tcpNetangelnetangellast updated 27 Nov 20182442 udpNetangelnetangellast updated 27 Nov 20182443 tcpPowerClient Central Storage Facilitypowerclientcsflast updated 27 Nov 20182443 udpPowerClient Central Storage Facilitypowerclientcsflast updated 27 Nov 20182444 tcpBT PP2 Sectransbtpp2sectranslast updated 27 Nov 20182444 udpBT PP2 Sectransbtpp2sectranslast updated 27 Nov 20182445 tcpDTN1dtn1last updated 27 Nov 20182445 udpDTN1dtn1last updated 27 Nov 20182446 tcpbues_service IANA assigned this well-formed service name as a replacement for "bues_service".bues-servicelast updated 27 Nov 20182446 tcp (bues_service)bues_servicebues_servicelast updated 27 Nov 20182446 udpbues_service IANA assigned this well-formed service name as a replacement for "bues_service".bues-servicelast updated 27 Nov 20182446 udp (bues_service)bues_servicebues_servicelast updated 27 Nov 20182447 tcpOpenView NNM daemonovwdblast updated 27 Nov 20182447 udpOpenView NNM daemonovwdblast updated 27 Nov 20182448 tcphpppsvrhpppssvrlast updated 27 Nov 20182448 udphpppsvrhpppssvrlast updated 27 Nov 20182449 tcpRATLratllast updated 27 Nov 20182449 udpRATLratllast updated 27 Nov 20182450 tcpnetadminnetadminlast updated 27 Nov 20182450 udpnetadminnetadminlast updated 27 Nov 20182451 tcpnetchatnetchatlast updated 27 Nov 20182451 udpnetchatnetchatlast updated 27 Nov 20182452 tcpSnifferClientsnifferclientlast updated 27 Nov 20182452 udpSnifferClientsnifferclientlast updated 27 Nov 20182453 tcpmadge ltdmadge-ltdlast updated 27 Nov 20182453 udpmadge ltdmadge-ltdlast updated 27 Nov 20182454 tcpIndX-DDSindx-ddslast updated 27 Nov 20182454 udpIndX-DDSindx-ddslast updated 27 Nov 20182455 tcpWAGO-IO-SYSTEMwago-io-systemlast updated 27 Nov 20182455 udpWAGO-IO-SYSTEMwago-io-systemlast updated 27 Nov 20182456 tcpaltav-remmgtaltav-remmgtlast updated 27 Nov 20182456 udpaltav-remmgtaltav-remmgtlast updated 27 Nov 20182457 tcpRapido_IPrapido-iplast updated 27 Nov 20182457 udpRapido_IPrapido-iplast updated 27 Nov 20182458 tcpgriffingriffinlast updated 27 Nov 20182458 udpgriffingriffinlast updated 27 Nov 20182459 tcpCommunitycommunitylast updated 27 Nov 20182459 udpCommunitycommunitylast updated 27 Nov 20182460 tcpms-theaterms-theaterlast updated 27 Nov 20182460 udpms-theaterms-theaterlast updated 27 Nov 20182461 tcpqadmifoperqadmifoperlast updated 27 Nov 20182461 udpqadmifoperqadmifoperlast updated 27 Nov 20182462 tcpqadmifeventqadmifeventlast updated 27 Nov 20182462 udpqadmifeventqadmifeventlast updated 27 Nov 20182463 tcpLSI RAID Managementlsi-raid-mgmtlast updated 27 Nov 20182463 udpLSI RAID Managementlsi-raid-mgmtlast updated 27 Nov 20182464 tcpDirecPC SIdirecpc-silast updated 27 Nov 20182464 udpDirecPC SIdirecpc-silast updated 27 Nov 20182465 tcpLoad Balance Managementlbmlast updated 27 Nov 20182465 udpLoad Balance Managementlbmlast updated 27 Nov 20182466 tcpLoad Balance Forwardinglbflast updated 27 Nov 20182466 udpLoad Balance Forwardinglbflast updated 27 Nov 20182467 tcpHigh Criteriahigh-criterialast updated 27 Nov 20182467 udpHigh Criteriahigh-criterialast updated 27 Nov 20182468 tcpqip_msgdqip-msgdlast updated 27 Nov 20182468 udpqip_msgdqip-msgdlast updated 27 Nov 20182469 tcpMTI-TCS-COMMmti-tcs-commlast updated 27 Nov 20182469 udpMTI-TCS-COMMmti-tcs-commlast updated 27 Nov 20182470 tcptaskman porttaskman-portlast updated 27 Nov 20182470 udptaskman porttaskman-portlast updated 27 Nov 20182471 tcpSeaODBCseaodbclast updated 27 Nov 20182471 udpSeaODBCseaodbclast updated 27 Nov 20182472 tcpC3c3last updated 27 Nov 20182472 udpC3c3last updated 27 Nov 20182473 tcpAker-cdpaker-cdplast updated 27 Nov 20182473 udpAker-cdpaker-cdplast updated 27 Nov 20182474 tcpVital Analysisvitalanalysislast updated 27 Nov 20182474 udpVital Analysisvitalanalysislast updated 27 Nov 20182475 tcpACE Serverace-serverlast updated 27 Nov 20182475 udpACE Serverace-serverlast updated 27 Nov 20182476 tcpACE Server Propagationace-svr-proplast updated 27 Nov 20182476 udpACE Server Propagationace-svr-proplast updated 27 Nov 20182477 tcpSecurSight Certificate Valifation Servicessm-cvslast updated 27 Nov 20182477 udpSecurSight Certificate Valifation Servicessm-cvslast updated 27 Nov 20182478 tcpSecurSight Authentication Server (SSL)ssm-csspslast updated 27 Nov 20182478 udpSecurSight Authentication Server (SSL)ssm-csspslast updated 27 Nov 20182479 tcpSecurSight Event Logging Server (SSL)ssm-elslast updated 27 Nov 20182479 udpSecurSight Event Logging Server (SSL)ssm-elslast updated 27 Nov 20182480 tcpInformatica PowerExchange Listenerpowerexchangelast updated 27 Nov 20182480 udpInformatica PowerExchange Listenerpowerexchangelast updated 27 Nov 20182481 tcpOracle GIOPgioplast updated 27 Nov 20182481 udpOracle GIOPgioplast updated 27 Nov 20182482 tcpOracle GIOP SSLgiop-ssllast updated 27 Nov 20182482 udpOracle GIOP SSLgiop-ssllast updated 27 Nov 20182483 tcpOracle TTCttclast updated 27 Nov 20182483 udpOracle TTCttclast updated 27 Nov 20182484 tcpOracle TTC SSLttc-ssllast updated 27 Nov 20182484 udpOracle TTC SSLttc-ssllast updated 27 Nov 20182485 tcpNet Objects1netobjects1last updated 27 Nov 20182485 udpNet Objects1netobjects1last updated 27 Nov 20182486 tcpNet Objects2netobjects2last updated 27 Nov 20182486 udpNet Objects2netobjects2last updated 27 Nov 20182487 tcpPolicy Notice Servicepnslast updated 27 Nov 20182487 udpPolicy Notice Servicepnslast updated 27 Nov 20182488 tcpMoy Corporationmoy-corplast updated 27 Nov 20182488 udpMoy Corporationmoy-corplast updated 27 Nov 20182489 tcpTSILBtsilblast updated 27 Nov 20182489 udpTSILBtsilblast updated 27 Nov 20182490 tcpqip_qdhcpqip-qdhcplast updated 27 Nov 20182490 udpqip_qdhcpqip-qdhcplast updated 27 Nov 20182491 tcpConclave CPPconclave-cpplast updated 27 Nov 20182491 udpConclave CPPconclave-cpplast updated 27 Nov 20182492 tcpGROOVEgroovelast updated 27 Nov 20182492 udpGROOVEgroovelast updated 27 Nov 20182493 tcpTalarian MQStalarian-mqslast updated 27 Nov 20182493 udpTalarian MQStalarian-mqslast updated 27 Nov 20182494 tcpBMC ARbmc-arlast updated 27 Nov 20182494 udpBMC ARbmc-arlast updated 27 Nov 20182495 tcpFast Remote Servicesfast-rem-servlast updated 27 Nov 20182495 udpFast Remote Servicesfast-rem-servlast updated 27 Nov 20182496 tcpDIRGISdirgislast updated 27 Nov 20182496 udpDIRGISdirgislast updated 27 Nov 20182497 tcpQuad DBquaddblast updated 27 Nov 20182497 udpQuad DBquaddblast updated 27 Nov 20182498 tcpODN-CasTraqodn-castraqlast updated 27 Nov 20182498 udpODN-CasTraqodn-castraqlast updated 27 Nov 20182499 tcpUniControlunicontrollast updated 27 Nov 20182499 udpUniControlunicontrollast updated 27 Nov 20182500 tcpResource Tracking system serverrtsservlast updated 27 Nov 20182500 udpResource Tracking system serverrtsservlast updated 27 Nov 20182501 tcpResource Tracking system clientrtsclientlast updated 27 Nov 20182501 udpResource Tracking system clientrtsclientlast updated 27 Nov 20182502 tcpKentrox Protocolkentrox-protlast updated 27 Nov 20182502 udpKentrox Protocolkentrox-protlast updated 27 Nov 20182503 tcpNMS-DPNSSnms-dpnsslast updated 27 Nov 20182503 udpNMS-DPNSSnms-dpnsslast updated 27 Nov 20182504 tcpWLBSwlbslast updated 27 Nov 20182504 udpWLBSwlbslast updated 27 Nov 20182505 tcpPowerPlay Controlppcontrollast updated 27 Nov 20182505 udpPowerPlay Controlppcontrollast updated 27 Nov 20182506 tcpjbrokerjbrokerlast updated 27 Nov 20182506 udpjbrokerjbrokerlast updated 27 Nov 20182507 tcpspockspocklast updated 27 Nov 20182507 udpspockspocklast updated 27 Nov 20182508 tcpJDataStorejdatastorelast updated 27 Nov 20182508 udpJDataStorejdatastorelast updated 27 Nov 20182509 tcpfjmpssfjmpsslast updated 27 Nov 20182509 udpfjmpssfjmpsslast updated 27 Nov 20182510 tcpfjappmgrbulkfjappmgrbulklast updated 27 Nov 20182510 udpfjappmgrbulkfjappmgrbulklast updated 27 Nov 20182511 tcpMetastormmetastormlast updated 27 Nov 20182511 udpMetastormmetastormlast updated 27 Nov 20182512 tcpCitrix IMAcitriximalast updated 27 Nov 20182512 udpCitrix IMAcitriximalast updated 27 Nov 20182513 tcpCitrix ADMINcitrixadminlast updated 27 Nov 20182513 udpCitrix ADMINcitrixadminlast updated 27 Nov 20182514 tcpFacsys NTPfacsys-ntplast updated 27 Nov 20182514 udpFacsys NTPfacsys-ntplast updated 27 Nov 20182515 tcpFacsys Routerfacsys-routerlast updated 27 Nov 20182515 udpFacsys Routerfacsys-routerlast updated 27 Nov 20182516 tcpMain Controlmaincontrollast updated 27 Nov 20182516 udpMain Controlmaincontrollast updated 27 Nov 20182517 tcpH.323 Annex E Call Control Signalling Transportcall-sig-translast updated 27 Nov 20182517 udpH.323 Annex E Call Control Signalling Transportcall-sig-translast updated 27 Nov 20182518 tcpWillywillylast updated 27 Nov 20182518 udpWillywillylast updated 27 Nov 20182519 tcpglobmsgsvcglobmsgsvclast updated 27 Nov 20182519 udpglobmsgsvcglobmsgsvclast updated 27 Nov 20182520 tcpPervasive Listenerpvswlast updated 27 Nov 20182520 udpPervasive Listenerpvswlast updated 27 Nov 20182521 tcpAdaptec Manageradaptecmgrlast updated 27 Nov 20182521 udpAdaptec Manageradaptecmgrlast updated 27 Nov 20182522 tcpWinDbwindblast updated 27 Nov 20182522 udpWinDbwindblast updated 27 Nov 20182523 tcpQke LLC V.3qke-llc-v3last updated 27 Nov 20182523 udpQke LLC V.3qke-llc-v3last updated 27 Nov 20182524 tcpOptiwave License Managementoptiwave-lmlast updated 27 Nov 20182524 udpOptiwave License Managementoptiwave-lmlast updated 27 Nov 20182525 tcpMS V-Worldsms-v-worldslast updated 27 Nov 20182525 udpMS V-Worldsms-v-worldslast updated 27 Nov 20182526 tcpEMA License Managerema-sent-lmlast updated 27 Nov 20182526 udpEMA License Managerema-sent-lmlast updated 27 Nov 20182527 tcpIQ Serveriqserverlast updated 27 Nov 20182527 udpIQ Serveriqserverlast updated 27 Nov 20182528 tcpNCR CCL IANA assigned this well-formed service name as a replacement for "ncr_ccl".ncr-ccllast updated 27 Nov 20182528 tcp (ncr_ccl)NCR CCLncr_ccllast updated 27 Nov 20182528 udpNCR CCL IANA assigned this well-formed service name as a replacement for "ncr_ccl".ncr-ccllast updated 27 Nov 20182528 udp (ncr_ccl)NCR CCLncr_ccllast updated 27 Nov 20182529 tcpUTS FTPutsftplast updated 27 Nov 20182529 udpUTS FTPutsftplast updated 27 Nov 20182530 tcpVR Commercevrcommercelast updated 27 Nov 20182530 udpVR Commercevrcommercelast updated 27 Nov 20182531 tcpITO-E GUIito-e-guilast updated 27 Nov 20182531 udpITO-E GUIito-e-guilast updated 27 Nov 20182532 tcpOVTOPMDovtopmdlast updated 27 Nov 20182532 udpOVTOPMDovtopmdlast updated 27 Nov 20182533 tcpSnifferServersnifferserverlast updated 27 Nov 20182533 udpSnifferServersnifferserverlast updated 27 Nov 20182534 tcpCombox Web Accesscombox-web-acclast updated 27 Nov 20182534 udpCombox Web Accesscombox-web-acclast updated 27 Nov 20182535 tcpMADCAPmadcaplast updated 27 Nov 20182535 udpMADCAPmadcaplast updated 27 Nov 20182536 tcpbtpp2audctr1btpp2audctr1last updated 27 Nov 20182536 udpbtpp2audctr1btpp2audctr1last updated 27 Nov 20182537 tcpUpgrade Protocolupgradelast updated 27 Nov 20182537 udpUpgrade Protocolupgradelast updated 27 Nov 20182538 tcpvnwk-prapivnwk-prapilast updated 27 Nov 20182538 udpvnwk-prapivnwk-prapilast updated 27 Nov 20182539 tcpVSI Adminvsiadminlast updated 27 Nov 20182539 udpVSI Adminvsiadminlast updated 27 Nov 20182540 tcpLonWorkslonworkslast updated 27 Nov 20182540 udpLonWorkslonworkslast updated 27 Nov 20182541 tcpLonWorks2lonworks2last updated 27 Nov 20182541 udpLonWorks2lonworks2last updated 27 Nov 20182542 tcpuDraw(Graph)udrawgraphlast updated 27 Nov 20182542 udpuDraw(Graph)udrawgraphlast updated 27 Nov 20182543 tcpREFTEKrefteklast updated 27 Nov 20182543 udpREFTEKrefteklast updated 27 Nov 20182544 tcpManagement Daemon Refreshnovell-zenlast updated 27 Nov 20182544 udpManagement Daemon Refreshnovell-zenlast updated 27 Nov 20182545 tcpsis-emtsis-emtlast updated 27 Nov 20182545 udpsis-emtsis-emtlast updated 27 Nov 20182546 tcpvytalvaultbrtpvytalvaultbrtplast updated 27 Nov 20182546 udpvytalvaultbrtpvytalvaultbrtplast updated 27 Nov 20182547 tcpvytalvaultvsmpvytalvaultvsmplast updated 27 Nov 20182547 udpvytalvaultvsmpvytalvaultvsmplast updated 27 Nov 20182548 tcpvytalvaultpipevytalvaultpipelast updated 27 Nov 20182548 udpvytalvaultpipevytalvaultpipelast updated 27 Nov 20182549 tcpIPASSipasslast updated 27 Nov 20182549 udpIPASSipasslast updated 27 Nov 20182550 tcpADSadslast updated 27 Nov 20182550 udpADSadslast updated 27 Nov 20182551 tcpISG UDA Serverisg-uda-serverlast updated 27 Nov 20182551 udpISG UDA Serverisg-uda-serverlast updated 27 Nov 20182552 tcpCall Loggingcall-logginglast updated 27 Nov 20182552 udpCall Loggingcall-logginglast updated 27 Nov 20182553 tcpefidiningportefidiningportlast updated 27 Nov 20182553 udpefidiningportefidiningportlast updated 27 Nov 20182554 tcpVCnet-Link v10vcnet-link-v10last updated 27 Nov 20182554 udpVCnet-Link v10vcnet-link-v10last updated 27 Nov 20182555 tcpCompaq WCPcompaq-wcplast updated 27 Nov 20182555 udpCompaq WCPcompaq-wcplast updated 27 Nov 20182556 tcpnicetec-nmsvcnicetec-nmsvclast updated 27 Nov 20182556 udpnicetec-nmsvcnicetec-nmsvclast updated 27 Nov 20182557 tcpnicetec-mgmtnicetec-mgmtlast updated 27 Nov 20182557 udpnicetec-mgmtnicetec-mgmtlast updated 27 Nov 20182558 tcpPCLE Multi Mediapclemultimedialast updated 27 Nov 20182558 udpPCLE Multi Mediapclemultimedialast updated 27 Nov 20182559 tcpLSTPlstplast updated 27 Nov 20182559 udpLSTPlstplast updated 27 Nov 20182560 tcplabratlabratlast updated 27 Nov 20182560 udplabratlabratlast updated 27 Nov 20182561 tcpMosaixCCmosaixcclast updated 27 Nov 20182561 udpMosaixCCmosaixcclast updated 27 Nov 20182562 tcpDelibodelibolast updated 27 Nov 20182562 udpDelibodelibolast updated 27 Nov 20182563 tcpCTI Redwoodcti-redwoodlast updated 27 Nov 20182563 udpCTI Redwoodcti-redwoodlast updated 27 Nov 20182564 tcpHP 3000 NS/VT block mode telnethp-3000-telnetlast updated 27 Nov 20182564 udpHP 3000 NS/VT block mode telnethp-3000-telnetlast updated 27 Nov 20182565 tcpCoordinator Servercoord-svrlast updated 27 Nov 20182565 udpCoordinator Servercoord-svrlast updated 27 Nov 20182566 tcppcs-pcwpcs-pcwlast updated 27 Nov 20182566 udppcs-pcwpcs-pcwlast updated 27 Nov 20182567 tcpCisco Line Protocolclplast updated 27 Nov 20182567 udpCisco Line Protocolclplast updated 27 Nov 20182568 tcpSPAM TRAPspamtraplast updated 27 Nov 20182568 udpSPAM TRAPspamtraplast updated 27 Nov 20182569 tcpSonus Call Signalsonuscallsiglast updated 27 Nov 20182569 udpSonus Call Signalsonuscallsiglast updated 27 Nov 20182570 tcpHS Porths-portlast updated 27 Nov 20182570 udpHS Porths-portlast updated 27 Nov 20182571 tcpCECSVCcecsvclast updated 27 Nov 20182571 udpCECSVCcecsvclast updated 27 Nov 20182572 tcpIBPibplast updated 27 Nov 20182572 udpIBPibplast updated 27 Nov 20182573 tcpTrust Establishtrustestablishlast updated 27 Nov 20182573 udpTrust Establishtrustestablishlast updated 27 Nov 20182574 tcpBlockade BPSPblockade-bpsplast updated 27 Nov 20182574 udpBlockade BPSPblockade-bpsplast updated 27 Nov 20182575 tcpHL7hl7last updated 27 Nov 20182575 udpHL7hl7last updated 27 Nov 20182576 tcpTCL Pro Debuggertclprodebuggerlast updated 27 Nov 20182576 udpTCL Pro Debuggertclprodebuggerlast updated 27 Nov 20182577 tcpScriptics Lsrvrscipticslsrvrlast updated 27 Nov 20182577 udpScriptics Lsrvrscipticslsrvrlast updated 27 Nov 20182578 tcpRVS ISDN DCPrvs-isdn-dcplast updated 27 Nov 20182578 udpRVS ISDN DCPrvs-isdn-dcplast updated 27 Nov 20182579 tcpmpfonclmpfoncllast updated 27 Nov 20182579 udpmpfonclmpfoncllast updated 27 Nov 20182580 tcpTributarytributarylast updated 27 Nov 20182580 udpTributarytributarylast updated 27 Nov 20182581 tcpARGIS TEargis-telast updated 27 Nov 20182581 udpARGIS TEargis-telast updated 27 Nov 20182582 tcpARGIS DSargis-dslast updated 27 Nov 20182582 udpARGIS DSargis-dslast updated 27 Nov 20182583 tcpMONmonlast updated 27 Nov 20182583 udpMONmonlast updated 27 Nov 20182584 tcpcyaservcyaservlast updated 27 Nov 20182584 udpcyaservcyaservlast updated 27 Nov 20182585 tcpNETX Servernetx-serverlast updated 27 Nov 20182585 udpNETX Servernetx-serverlast updated 27 Nov 20182586 tcpNETX Agentnetx-agentlast updated 27 Nov 20182586 udpNETX Agentnetx-agentlast updated 27 Nov 20182587 tcpMASCmasclast updated 27 Nov 20182587 udpMASCmasclast updated 27 Nov 20182588 tcpPrivilegeprivilegelast updated 27 Nov 20182588 udpPrivilegeprivilegelast updated 27 Nov 20182589 tcpquartus tclquartus-tcllast updated 27 Nov 20182589 udpquartus tclquartus-tcllast updated 27 Nov 20182590 tcpidotdistidotdistlast updated 27 Nov 20182590 udpidotdistidotdistlast updated 27 Nov 20182591 tcpMaytag Shufflemaytagshufflelast updated 27 Nov 20182591 udpMaytag Shufflemaytagshufflelast updated 27 Nov 20182592 tcpnetreknetreklast updated 27 Nov 20182592 udpnetreknetreklast updated 27 Nov 20182593 tcpMNS Mail Notice Servicemns-maillast updated 27 Nov 20182593 udpMNS Mail Notice Servicemns-maillast updated 27 Nov 20182594 tcpData Base Serverdtslast updated 27 Nov 20182594 udpData Base Serverdtslast updated 27 Nov 20182595 tcpWorld Fusion 1worldfusion1last updated 27 Nov 20182595 udpWorld Fusion 1worldfusion1last updated 27 Nov 20182596 tcpWorld Fusion 2worldfusion2last updated 27 Nov 20182596 udpWorld Fusion 2worldfusion2last updated 27 Nov 20182597 tcpHomestead Gloryhomesteadglorylast updated 27 Nov 20182597 udpHomestead Gloryhomesteadglorylast updated 27 Nov 20182598 tcpCitrix MA Clientcitriximaclientlast updated 27 Nov 20182598 udpCitrix MA Clientcitriximaclientlast updated 27 Nov 20182599 tcpSnap Discoverysnapdlast updated 27 Nov 20182599 udpSnap Discoverysnapdlast updated 27 Nov 20182600 tcpHPSTGMGRhpstgmgrlast updated 27 Nov 20182600 udpHPSTGMGRhpstgmgrlast updated 27 Nov 20182601 tcpdiscp clientdiscp-clientlast updated 27 Nov 20182601 udpdiscp clientdiscp-clientlast updated 27 Nov 20182602 tcpdiscp serverdiscp-serverlast updated 27 Nov 20182602 udpdiscp serverdiscp-serverlast updated 27 Nov 20182603 tcpService Meterservicemeterlast updated 27 Nov 20182603 udpService Meterservicemeterlast updated 27 Nov 20182604 tcpNSC CCSnsc-ccslast updated 27 Nov 20182604 udpNSC CCSnsc-ccslast updated 27 Nov 20182605 tcpNSC POSAnsc-posalast updated 27 Nov 20182605 udpNSC POSAnsc-posalast updated 27 Nov 20182606 tcpDell Netmonnetmonlast updated 27 Nov 20182606 udpDell Netmonnetmonlast updated 27 Nov 20182607 tcpDell Connectionconnectionlast updated 27 Nov 20182607 udpDell Connectionconnectionlast updated 27 Nov 20182608 tcpWag Servicewag-servicelast updated 27 Nov 20182608 udpWag Servicewag-servicelast updated 27 Nov 20182609 tcpSystem Monitorsystem-monitorlast updated 27 Nov 20182609 udpSystem Monitorsystem-monitorlast updated 27 Nov 20182610 tcpVersaTekversa-teklast updated 27 Nov 20182610 udpVersaTekversa-teklast updated 27 Nov 20182611 tcpLIONHEADlionheadlast updated 27 Nov 20182611 udpLIONHEADlionheadlast updated 27 Nov 20182612 tcpQpasa Agentqpasa-agentlast updated 27 Nov 20182612 udpQpasa Agentqpasa-agentlast updated 27 Nov 20182613 tcpSMNTUBootstrapsmntubootstraplast updated 27 Nov 20182613 udpSMNTUBootstrapsmntubootstraplast updated 27 Nov 20182614 tcpNever Offlineneverofflinelast updated 27 Nov 20182614 udpNever Offlineneverofflinelast updated 27 Nov 20182615 tcpfirepowerfirepowerlast updated 27 Nov 20182615 udpfirepowerfirepowerlast updated 27 Nov 20182616 tcpappswitch-empappswitch-emplast updated 27 Nov 20182616 udpappswitch-empappswitch-emplast updated 27 Nov 20182617 tcpClinical Context Managerscmadminlast updated 27 Nov 20182617 udpClinical Context Managerscmadminlast updated 27 Nov 20182618 tcpPriority E-Compriority-e-comlast updated 27 Nov 20182618 udpPriority E-Compriority-e-comlast updated 27 Nov 20182619 tcpbrucebrucelast updated 27 Nov 20182619 udpbrucebrucelast updated 27 Nov 20182620 tcpLPSRecommenderlpsrecommenderlast updated 27 Nov 20182620 udpLPSRecommenderlpsrecommenderlast updated 27 Nov 20182621 tcpMiles Apart Jukebox Servermiles-apartlast updated 27 Nov 20182621 udpMiles Apart Jukebox Servermiles-apartlast updated 27 Nov 20182622 tcpMetricaDBCmetricadbclast updated 27 Nov 20182622 udpMetricaDBCmetricadbclast updated 27 Nov 20182623 tcpLMDPlmdplast updated 27 Nov 20182623 udpLMDPlmdplast updated 27 Nov 20182624 tcpAriaarialast updated 27 Nov 20182624 udpAriaarialast updated 27 Nov 20182625 tcpBlwnkl Portblwnkl-portlast updated 27 Nov 20182625 udpBlwnkl Portblwnkl-portlast updated 27 Nov 20182626 tcpgbjd816gbjd816last updated 27 Nov 20182626 udpgbjd816gbjd816last updated 27 Nov 20182627 tcpMoshe Beerimoshebeerilast updated 27 Nov 20182627 udpMoshe Beerimoshebeerilast updated 27 Nov 20182628 tcpDICTdictlast updated 27 Nov 20182628 udpDICTdictlast updated 27 Nov 20182629 tcpSitara Serversitaraserverlast updated 27 Nov 20182629 udpSitara Serversitaraserverlast updated 27 Nov 20182630 tcpSitara Managementsitaramgmtlast updated 27 Nov 20182630 udpSitara Managementsitaramgmtlast updated 27 Nov 20182631 tcpSitara Dirsitaradirlast updated 27 Nov 20182631 udpSitara Dirsitaradirlast updated 27 Nov 20182632 tcpIRdg Postirdg-postlast updated 27 Nov 20182632 udpIRdg Postirdg-postlast updated 27 Nov 20182633 tcpInterIntelliinterintellilast updated 27 Nov 20182633 udpInterIntelliinterintellilast updated 27 Nov 20182634 tcpPK Electronicspk-electronicslast updated 27 Nov 20182634 udpPK Electronicspk-electronicslast updated 27 Nov 20182635 tcpBack Burnerbackburnerlast updated 27 Nov 20182635 udpBack Burnerbackburnerlast updated 27 Nov 20182636 tcpSolvesolvelast updated 27 Nov 20182636 udpSolvesolvelast updated 27 Nov 20182637 tcpImport Document Serviceimdocsvclast updated 27 Nov 20182637 udpImport Document Serviceimdocsvclast updated 27 Nov 20182638 tcpSybase Anywheresybaseanywherelast updated 27 Nov 20182638 udpSybase Anywheresybaseanywherelast updated 27 Nov 20182639 tcpAMInetaminetlast updated 27 Nov 20182639 udpAMInetaminetlast updated 27 Nov 20182640 tcpAlcorn McBride Inc protocol used for device controlami-controllast updated 27 Nov 20182640 udpAlcorn McBride Inc protocol used for device controlami-controllast updated 27 Nov 20182641 tcpHDL Serverhdl-srvlast updated 27 Nov 20182641 udpHDL Serverhdl-srvlast updated 27 Nov 20182642 tcpTragictragiclast updated 27 Nov 20182642 udpTragictragiclast updated 27 Nov 20182643 tcpGTE-SAMPgte-samplast updated 27 Nov 20182643 udpGTE-SAMPgte-samplast updated 27 Nov 20182644 tcpTravsoft IPX Tunneltravsoft-ipx-tlast updated 27 Nov 20182644 udpTravsoft IPX Tunneltravsoft-ipx-tlast updated 27 Nov 20182645 tcpNovell IPX CMDnovell-ipx-cmdlast updated 27 Nov 20182645 udpNovell IPX CMDnovell-ipx-cmdlast updated 27 Nov 20182646 tcpAND License Managerand-lmlast updated 27 Nov 20182646 udpAND License Managerand-lmlast updated 27 Nov 20182647 tcpSyncServersyncserverlast updated 27 Nov 20182647 udpSyncServersyncserverlast updated 27 Nov 20182648 tcpUpsnotifyprotupsnotifyprotlast updated 27 Nov 20182648 udpUpsnotifyprotupsnotifyprotlast updated 27 Nov 20182649 tcpVPSIPPORTvpsipportlast updated 27 Nov 20182649 udpVPSIPPORTvpsipportlast updated 27 Nov 20182650 tcperistwogunseristwogunslast updated 27 Nov 20182650 udperistwogunseristwogunslast updated 27 Nov 20182651 tcpEBInSiteebinsitelast updated 27 Nov 20182651 udpEBInSiteebinsitelast updated 27 Nov 20182652 tcpInterPathPanelinterpathpanellast updated 27 Nov 20182652 udpInterPathPanelinterpathpanellast updated 27 Nov 20182653 tcpSonussonuslast updated 27 Nov 20182653 udpSonussonuslast updated 27 Nov 20182654 tcpCorel VNC Admin IANA assigned this well-formed service name as a replacement for "corel_vncadmin".corel-vncadminlast updated 27 Nov 20182654 tcp (corel_vncadmin)Corel VNC Admincorel_vncadminlast updated 27 Nov 20182654 udpCorel VNC Admin IANA assigned this well-formed service name as a replacement for "corel_vncadmin".corel-vncadminlast updated 27 Nov 20182654 udp (corel_vncadmin)Corel VNC Admincorel_vncadminlast updated 27 Nov 20182655 tcpUNIX Nt Glueungluelast updated 27 Nov 20182655 udpUNIX Nt Glueungluelast updated 27 Nov 20182656 tcpKanakanalast updated 27 Nov 20182656 udpKanakanalast updated 27 Nov 20182657 tcpSNS Dispatchersns-dispatcherlast updated 27 Nov 20182657 udpSNS Dispatchersns-dispatcherlast updated 27 Nov 20182658 tcpSNS Adminsns-adminlast updated 27 Nov 20182658 udpSNS Adminsns-adminlast updated 27 Nov 20182659 tcpSNS Querysns-querylast updated 27 Nov 20182659 udpSNS Querysns-querylast updated 27 Nov 20182660 tcpGC Monitorgcmonitorlast updated 27 Nov 20182660 udpGC Monitorgcmonitorlast updated 27 Nov 20182661 tcpOLHOSTolhostlast updated 27 Nov 20182661 udpOLHOSTolhostlast updated 27 Nov 20182662 tcpBinTec-CAPIbintec-capilast updated 27 Nov 20182662 udpBinTec-CAPIbintec-capilast updated 27 Nov 20182663 tcpBinTec-TAPIbintec-tapilast updated 27 Nov 20182663 udpBinTec-TAPIbintec-tapilast updated 27 Nov 20182664 tcpPatrol for MQ GMpatrol-mq-gmlast updated 27 Nov 20182664 udpPatrol for MQ GMpatrol-mq-gmlast updated 27 Nov 20182665 tcpPatrol for MQ NMpatrol-mq-nmlast updated 27 Nov 20182665 udpPatrol for MQ NMpatrol-mq-nmlast updated 27 Nov 20182666 tcpextensisextensislast updated 27 Nov 20182666 udpextensisextensislast updated 27 Nov 20182667 tcpAlarm Clock Serveralarm-clock-slast updated 27 Nov 20182667 udpAlarm Clock Serveralarm-clock-slast updated 27 Nov 20182668 tcpAlarm Clock Clientalarm-clock-clast updated 27 Nov 20182668 udpAlarm Clock Clientalarm-clock-clast updated 27 Nov 20182669 tcpTOADtoadlast updated 27 Nov 20182669 udpTOADtoadlast updated 27 Nov 20182670 tcpTVE Announcetve-announcelast updated 27 Nov 20182670 udpTVE Announcetve-announcelast updated 27 Nov 20182671 tcpnewlixregnewlixreglast updated 27 Nov 20182671 udpnewlixregnewlixreglast updated 27 Nov 20182672 tcpnhservernhserverlast updated 27 Nov 20182672 udpnhservernhserverlast updated 27 Nov 20182673 tcpFirst Call 42firstcall42last updated 27 Nov 20182673 udpFirst Call 42firstcall42last updated 27 Nov 20182674 tcpewnnewnnlast updated 27 Nov 20182674 udpewnnewnnlast updated 27 Nov 20182675 tcpTTC ETAPttc-etaplast updated 27 Nov 20182675 udpTTC ETAPttc-etaplast updated 27 Nov 20182676 tcpSIMSLinksimslinklast updated 27 Nov 20182676 udpSIMSLinksimslinklast updated 27 Nov 20182677 tcpGadget Gate 1 Waygadgetgate1waylast updated 27 Nov 20182677 udpGadget Gate 1 Waygadgetgate1waylast updated 27 Nov 20182678 tcpGadget Gate 2 Waygadgetgate2waylast updated 27 Nov 20182678 udpGadget Gate 2 Waygadgetgate2waylast updated 27 Nov 20182679 tcpSync Server SSLsyncserverssllast updated 27 Nov 20182679 udpSync Server SSLsyncserverssllast updated 27 Nov 20182680 tcppxc-sapxompxc-sapxomlast updated 27 Nov 20182680 udppxc-sapxompxc-sapxomlast updated 27 Nov 20182681 tcpmpnjsombmpnjsomblast updated 27 Nov 20182681 udpmpnjsombmpnjsomblast updated 27 Nov 20182682 RemovedN/Alast updated 27 Nov 20182683 tcpNCDLoadBalancencdloadbalancelast updated 27 Nov 20182683 udpNCDLoadBalancencdloadbalancelast updated 27 Nov 20182684 tcpmpnjsosvmpnjsosvlast updated 27 Nov 20182684 udpmpnjsosvmpnjsosvlast updated 27 Nov 20182685 tcpmpnjsoclmpnjsocllast updated 27 Nov 20182685 udpmpnjsoclmpnjsocllast updated 27 Nov 20182686 tcpmpnjsomgmpnjsomglast updated 27 Nov 20182686 udpmpnjsomgmpnjsomglast updated 27 Nov 20182687 tcppq-lic-mgmtpq-lic-mgmtlast updated 27 Nov 20182687 udppq-lic-mgmtpq-lic-mgmtlast updated 27 Nov 20182688 tcpmd-cf-httpmd-cg-httplast updated 27 Nov 20182688 udpmd-cf-httpmd-cg-httplast updated 27 Nov 20182689 tcpFastLynxfastlynxlast updated 27 Nov 20182689 udpFastLynxfastlynxlast updated 27 Nov 20182690 tcpHP NNM Embedded Databasehp-nnm-datalast updated 27 Nov 20182690 udpHP NNM Embedded Databasehp-nnm-datalast updated 27 Nov 20182691 tcpITInternet ISM Serveritinternetlast updated 27 Nov 20182691 udpITInternet ISM Serveritinternetlast updated 27 Nov 20182692 tcpAdmins LMSadmins-lmslast updated 27 Nov 20182692 udpAdmins LMSadmins-lmslast updated 27 Nov 20182693 tcpUnassignedN/Alast updated 27 Nov 20182693 udpUnassignedN/Alast updated 27 Nov 20182694 tcppwrseventpwrseventlast updated 27 Nov 20182694 udppwrseventpwrseventlast updated 27 Nov 20182695 tcpVSPREADvspreadlast updated 27 Nov 20182695 udpVSPREADvspreadlast updated 27 Nov 20182696 tcpUnify Adminunifyadminlast updated 27 Nov 20182696 udpUnify Adminunifyadminlast updated 27 Nov 20182697 tcpOce SNMP Trap Portoce-snmp-traplast updated 27 Nov 20182697 udpOce SNMP Trap Portoce-snmp-traplast updated 27 Nov 20182698 tcpMCK-IVPIPmck-ivpiplast updated 27 Nov 20182698 udpMCK-IVPIPmck-ivpiplast updated 27 Nov 20182699 tcpCsoft Plus Clientcsoft-plusclntlast updated 27 Nov 20182699 udpCsoft Plus Clientcsoft-plusclntlast updated 27 Nov 20182700 tcptqdatatqdatalast updated 27 Nov 20182700 udptqdatatqdatalast updated 27 Nov 20182701 tcpSMS RCINFOsms-rcinfolast updated 27 Nov 20182701 udpSMS RCINFOsms-rcinfolast updated 27 Nov 20182702 tcpSMS XFERsms-xferlast updated 27 Nov 20182702 udpSMS XFERsms-xferlast updated 27 Nov 20182703 tcpSMS CHATsms-chatlast updated 27 Nov 20182703 udpSMS CHATsms-chatlast updated 27 Nov 20182704 tcpSMS REMCTRLsms-remctrllast updated 27 Nov 20182704 udpSMS REMCTRLsms-remctrllast updated 27 Nov 20182705 tcpSDS Adminsds-adminlast updated 27 Nov 20182705 udpSDS Adminsds-adminlast updated 27 Nov 20182706 tcpNCD Mirroringncdmirroringlast updated 27 Nov 20182706 udpNCD Mirroringncdmirroringlast updated 27 Nov 20182707 tcpEMCSYMAPIPORTemcsymapiportlast updated 27 Nov 20182707 udpEMCSYMAPIPORTemcsymapiportlast updated 27 Nov 20182708 tcpBanyan-Netbanyan-netlast updated 27 Nov 20182708 udpBanyan-Netbanyan-netlast updated 27 Nov 20182709 tcpSupermonsupermonlast updated 27 Nov 20182709 udpSupermonsupermonlast updated 27 Nov 20182710 tcpSSO Servicesso-servicelast updated 27 Nov 20182710 udpSSO Servicesso-servicelast updated 27 Nov 20182711 tcpSSO Controlsso-controllast updated 27 Nov 20182711 udpSSO Controlsso-controllast updated 27 Nov 20182712 tcpAxapta Object Communication Protocolaocplast updated 27 Nov 20182712 udpAxapta Object Communication Protocolaocplast updated 27 Nov 20182713 tcpRaven Trinity Broker Serviceraventbslast updated 27 Nov 20182713 udpRaven Trinity Broker Serviceraventbslast updated 27 Nov 20182714 tcpRaven Trinity Data Moverraventdmlast updated 27 Nov 20182714 udpRaven Trinity Data Moverraventdmlast updated 27 Nov 20182715 tcpHPSTGMGR2hpstgmgr2last updated 27 Nov 20182715 udpHPSTGMGR2hpstgmgr2last updated 27 Nov 20182716 tcpInova IP Discoinova-ip-discolast updated 27 Nov 20182716 udpInova IP Discoinova-ip-discolast updated 27 Nov 20182717 tcpPN REQUESTERpn-requesterlast updated 27 Nov 20182717 udpPN REQUESTERpn-requesterlast updated 27 Nov 20182718 tcpPN REQUESTER 2pn-requester2last updated 27 Nov 20182718 udpPN REQUESTER 2pn-requester2last updated 27 Nov 20182719 tcpScan & Changescan-changelast updated 27 Nov 20182719 udpScan & Changescan-changelast updated 27 Nov 20182720 tcpwkarswkarslast updated 27 Nov 20182720 udpwkarswkarslast updated 27 Nov 20182721 tcpSmart Diagnosesmart-diagnoselast updated 27 Nov 20182721 udpSmart Diagnosesmart-diagnoselast updated 27 Nov 20182722 tcpProactive Serverproactivesrvrlast updated 27 Nov 20182722 udpProactive Serverproactivesrvrlast updated 27 Nov 20182723 tcpWatchDog NT Protocolwatchdog-ntlast updated 27 Nov 20182723 udpWatchDog NT Protocolwatchdog-ntlast updated 27 Nov 20182724 tcpqotpsqotpslast updated 27 Nov 20182724 udpqotpsqotpslast updated 27 Nov 20182725 tcpMSOLAP PTP2msolap-ptp2last updated 27 Nov 20182725 udpMSOLAP PTP2msolap-ptp2last updated 27 Nov 20182726 tcpTAMStamslast updated 27 Nov 20182726 udpTAMStamslast updated 27 Nov 20182727 tcpMedia Gateway Control Protocol Call Agentmgcp-callagentlast updated 27 Nov 20182727 udpMedia Gateway Control Protocol Call Agentmgcp-callagentlast updated 27 Nov 20182728 tcpSQDRsqdrlast updated 27 Nov 20182728 udpSQDRsqdrlast updated 27 Nov 20182729 tcpTCIM Controltcim-controllast updated 27 Nov 20182729 udpTCIM Controltcim-controllast updated 27 Nov 20182730 tcpNEC RaidPlusnec-raidpluslast updated 27 Nov 20182730 udpNEC RaidPlusnec-raidpluslast updated 27 Nov 20182731 tcpFyre Messangerfyre-messangerlast updated 27 Nov 20182731 udpFyre Messagnerfyre-messangerlast updated 27 Nov 20182732 tcpG5Mg5mlast updated 27 Nov 20182732 udpG5Mg5mlast updated 27 Nov 20182733 tcpSignet CTFsignet-ctflast updated 27 Nov 20182733 udpSignet CTFsignet-ctflast updated 27 Nov 20182734 tcpCCS Softwareccs-softwarelast updated 27 Nov 20182734 udpCCS Softwareccs-softwarelast updated 27 Nov 20182735 tcpNetIQ Monitor Consolenetiq-mclast updated 27 Nov 20182735 udpNetIQ Monitor Consolenetiq-mclast updated 27 Nov 20182736 tcpRADWIZ NMS SRVradwiz-nms-srvlast updated 27 Nov 20182736 udpRADWIZ NMS SRVradwiz-nms-srvlast updated 27 Nov 20182737 tcpSRP Feedbacksrp-feedbacklast updated 27 Nov 20182737 udpSRP Feedbacksrp-feedbacklast updated 27 Nov 20182738 tcpNDL TCP-OSI Gatewayndl-tcp-ois-gwlast updated 27 Nov 20182738 udpNDL TCP-OSI Gatewayndl-tcp-ois-gwlast updated 27 Nov 20182739 tcpTN Timingtn-timinglast updated 27 Nov 20182739 udpTN Timingtn-timinglast updated 27 Nov 20182740 tcpAlarmalarmlast updated 27 Nov 20182740 udpAlarmalarmlast updated 27 Nov 20182741 tcpTSBtsblast updated 27 Nov 20182741 udpTSBtsblast updated 27 Nov 20182742 tcpTSB2tsb2last updated 27 Nov 20182742 udpTSB2tsb2last updated 27 Nov 20182743 tcpmurxmurxlast updated 27 Nov 20182743 udpmurxmurxlast updated 27 Nov 20182744 tcphonyakuhonyakulast updated 27 Nov 20182744 udphonyakuhonyakulast updated 27 Nov 20182745 tcpURBISNETurbisnetlast updated 27 Nov 20182745 udpURBISNETurbisnetlast updated 27 Nov 20182746 tcpCPUDPENCAPcpudpencaplast updated 27 Nov 20182746 udpCPUDPENCAPcpudpencaplast updated 27 Nov 20182747 tcp-fjippol-swrlylast updated 27 Nov 20182747 udp-fjippol-swrlylast updated 27 Nov 20182748 tcp-fjippol-polsvrlast updated 27 Nov 20182748 udp-fjippol-polsvrlast updated 27 Nov 20182749 tcp-fjippol-cnsllast updated 27 Nov 20182749 udp-fjippol-cnsllast updated 27 Nov 20182750 tcp-fjippol-port1last updated 27 Nov 20182750 udp-fjippol-port1last updated 27 Nov 20182751 tcp-fjippol-port2last updated 27 Nov 20182751 udp-fjippol-port2last updated 27 Nov 20182752 tcpRSISYS ACCESSrsisysaccesslast updated 27 Nov 20182752 udpRSISYS ACCESSrsisysaccesslast updated 27 Nov 20182753 tcpde-spotde-spotlast updated 27 Nov 20182753 udpde-spotde-spotlast updated 27 Nov 20182754 tcpAPOLLO CCapollo-cclast updated 27 Nov 20182754 udpAPOLLO CCapollo-cclast updated 27 Nov 20182755 tcpExpress Payexpresspaylast updated 27 Nov 20182755 udpExpress Payexpresspaylast updated 27 Nov 20182756 tcpsimplement-tiesimplement-tielast updated 27 Nov 20182756 udpsimplement-tiesimplement-tielast updated 27 Nov 20182757 tcpCNRPcnrplast updated 27 Nov 20182757 udpCNRPcnrplast updated 27 Nov 20182758 tcpAPOLLO Statusapollo-statuslast updated 27 Nov 20182758 udpAPOLLO Statusapollo-statuslast updated 27 Nov 20182759 tcpAPOLLO GMSapollo-gmslast updated 27 Nov 20182759 udpAPOLLO GMSapollo-gmslast updated 27 Nov 20182760 tcpSaba MSsabamslast updated 27 Nov 20182760 udpSaba MSsabamslast updated 27 Nov 20182761 tcpDICOM ISCLdicom-iscllast updated 27 Nov 20182761 udpDICOM ISCLdicom-iscllast updated 27 Nov 20182762 tcpDICOM TLSdicom-tlslast updated 27 Nov 20182762 udpDICOM TLSdicom-tlslast updated 27 Nov 20182763 tcpDesktop DNAdesktop-dnalast updated 27 Nov 20182763 udpDesktop DNAdesktop-dnalast updated 27 Nov 20182764 tcpData Insurancedata-insurancelast updated 27 Nov 20182764 udpData Insurancedata-insurancelast updated 27 Nov 20182765 tcpqip-audupqip-auduplast updated 27 Nov 20182765 udpqip-audupqip-auduplast updated 27 Nov 20182766 tcpCompaq SCPcompaq-scplast updated 27 Nov 20182766 udpCompaq SCPcompaq-scplast updated 27 Nov 20182767 tcpUADTCuadtclast updated 27 Nov 20182767 udpUADTCuadtclast updated 27 Nov 20182768 tcpUACSuacslast updated 27 Nov 20182768 udpUACSuacslast updated 27 Nov 20182769 tcpeXcEexcelast updated 27 Nov 20182769 udpeXcEexcelast updated 27 Nov 20182770 tcpVeronicaveronicalast updated 27 Nov 20182770 udpVeronicaveronicalast updated 27 Nov 20182771 tcpVergence CMvergencecmlast updated 27 Nov 20182771 udpVergence CMvergencecmlast updated 27 Nov 20182772 tcpaurisaurislast updated 27 Nov 20182772 udpaurisaurislast updated 27 Nov 20182773 tcpRBackup Remote Backuprbakcup1last updated 27 Nov 20182773 udpRBackup Remote Backuprbakcup1last updated 27 Nov 20182774 tcpRBackup Remote Backuprbakcup2last updated 27 Nov 20182774 udpRBackup Remote Backuprbakcup2last updated 27 Nov 20182775 tcpSMPPsmpplast updated 27 Nov 20182775 udpSMPPsmpplast updated 27 Nov 20182776 tcpRidgeway Systems & Softwareridgeway1last updated 27 Nov 20182776 udpRidgeway Systems & Softwareridgeway1last updated 27 Nov 20182777 tcpRidgeway Systems & Softwareridgeway2last updated 27 Nov 20182777 udpRidgeway Systems & Softwareridgeway2last updated 27 Nov 20182778 tcpGwen-Sonyagwen-sonyalast updated 27 Nov 20182778 udpGwen-Sonyagwen-sonyalast updated 27 Nov 20182779 tcpLBC Synclbc-synclast updated 27 Nov 20182779 udpLBC Synclbc-synclast updated 27 Nov 20182780 tcpLBC Controllbc-controllast updated 27 Nov 20182780 udpLBC Controllbc-controllast updated 27 Nov 20182781 tcpwhosellswhosellslast updated 27 Nov 20182781 udpwhosellswhosellslast updated 27 Nov 20182782 tcpeverydayrceverydayrclast updated 27 Nov 20182782 udpeverydayrceverydayrclast updated 27 Nov 20182783 tcpAISESaiseslast updated 27 Nov 20182783 udpAISESaiseslast updated 27 Nov 20182784 tcpworld wide web - developmentwww-devlast updated 27 Nov 20182784 udpworld wide web - developmentwww-devlast updated 27 Nov 20182785 tcpaic-npaic-nplast updated 27 Nov 20182785 udpaic-npaic-nplast updated 27 Nov 20182786 tcpaic-oncrpc - Destiny MCD databaseaic-oncrpclast updated 27 Nov 20182786 udpaic-oncrpc - Destiny MCD databaseaic-oncrpclast updated 27 Nov 20182787 tcppiccolo - Cornerstone Softwarepiccololast updated 27 Nov 20182787 udppiccolo - Cornerstone Softwarepiccololast updated 27 Nov 20182788 tcpNetWare Loadable Module - Seagate Softwarefryeservlast updated 27 Nov 20182788 udpNetWare Loadable Module - Seagate Softwarefryeservlast updated 27 Nov 20182789 tcpMedia Agentmedia-agentlast updated 27 Nov 20182789 udpMedia Agentmedia-agentlast updated 27 Nov 20182790 tcpPLG Proxyplgproxylast updated 27 Nov 20182790 udpPLG Proxyplgproxylast updated 27 Nov 20182791 tcpMT Port Registratormtport-registlast updated 27 Nov 20182791 udpMT Port Registratormtport-registlast updated 27 Nov 20182792 tcpf5-globalsitef5-globalsitelast updated 27 Nov 20182792 udpf5-globalsitef5-globalsitelast updated 27 Nov 20182793 tcpinitlsmsadinitlsmsadlast updated 27 Nov 20182793 udpinitlsmsadinitlsmsadlast updated 27 Nov 20182794 UnassignedN/Alast updated 27 Nov 20182795 tcpLiveStatslivestatslast updated 27 Nov 20182795 udpLiveStatslivestatslast updated 27 Nov 20182796 tcpac-techac-techlast updated 27 Nov 20182796 udpac-techac-techlast updated 27 Nov 20182797 tcpesp-encapesp-encaplast updated 27 Nov 20182797 udpesp-encapesp-encaplast updated 27 Nov 20182798 tcpTMESIS-UPShottmesis-upshotlast updated 27 Nov 20182798 udpTMESIS-UPShottmesis-upshotlast updated 27 Nov 20182799 tcpICON Discovericon-discoverlast updated 27 Nov 20182799 udpICON Discovericon-discoverlast updated 27 Nov 20182800 tcpACC RAIDacc-raidlast updated 27 Nov 20182800 udpACC RAIDacc-raidlast updated 27 Nov 20182801 tcpIGCPigcplast updated 27 Nov 20182801 udpIGCPigcplast updated 27 Nov 20182802 tcpVeritas TCP1veritas-tcp1last updated 27 Nov 20182802 udpVeritas UDP1veritas-udp1last updated 27 Nov 20182803 tcpbtprjctrlbtprjctrllast updated 27 Nov 20182803 udpbtprjctrlbtprjctrllast updated 27 Nov 20182804 tcpMarch Networks Digital Video Recorders and Enterprise Service Manager productsdvr-esmlast updated 27 Nov 20182804 udpMarch Networks Digital Video Recorders and Enterprise Service Manager productsdvr-esmlast updated 27 Nov 20182805 tcpWTA WSP-Swta-wsp-slast updated 27 Nov 20182805 udpWTA WSP-Swta-wsp-slast updated 27 Nov 20182806 tcpcspunicspunilast updated 27 Nov 20182806 udpcspunicspunilast updated 27 Nov 20182807 tcpcspmulticspmultilast updated 27 Nov 20182807 udpcspmulticspmultilast updated 27 Nov 20182808 tcpJ-LAN-Pj-lan-plast updated 27 Nov 20182808 udpJ-LAN-Pj-lan-plast updated 27 Nov 20182809 tcpCORBA LOCcorbaloclast updated 27 Nov 20182809 udpCORBA LOCcorbaloclast updated 27 Nov 20182810 tcpActive Net Stewardnetstewardlast updated 27 Nov 20182810 udpActive Net Stewardnetstewardlast updated 27 Nov 20182811 tcpGSI FTPgsiftplast updated 27 Nov 20182811 udpGSI FTPgsiftplast updated 27 Nov 20182812 tcpatmtcpatmtcplast updated 27 Nov 20182812 udpatmtcpatmtcplast updated 27 Nov 20182813 tcpllm-passllm-passlast updated 27 Nov 20182813 udpllm-passllm-passlast updated 27 Nov 20182814 tcpllm-csvllm-csvlast updated 27 Nov 20182814 udpllm-csvllm-csvlast updated 27 Nov 20182815 tcpLBC Measurementlbc-measurelast updated 27 Nov 20182815 udpLBC Measurementlbc-measurelast updated 27 Nov 20182816 tcpLBC Watchdoglbc-watchdoglast updated 27 Nov 20182816 udpLBC Watchdoglbc-watchdoglast updated 27 Nov 20182817 tcpNMSig Portnmsigportlast updated 27 Nov 20182817 udpNMSig Portnmsigportlast updated 27 Nov 20182818 tcprmlnkrmlnklast updated 27 Nov 20182818 udprmlnkrmlnklast updated 27 Nov 20182819 tcpFC Fault Notificationfc-faultnotifylast updated 27 Nov 20182819 udpFC Fault Notificationfc-faultnotifylast updated 27 Nov 20182820 tcpUniVisionunivisionlast updated 27 Nov 20182820 udpUniVisionunivisionlast updated 27 Nov 20182821 tcpVERITAS Authentication Servicevrts-at-portlast updated 27 Nov 20182821 udpVERITAS Authentication Servicevrts-at-portlast updated 27 Nov 20182822 tcpka0wucka0wuclast updated 27 Nov 20182822 udpka0wucka0wuclast updated 27 Nov 20182823 tcpCQG Net/LANcqg-netlanlast updated 27 Nov 20182823 udpCQG Net/LANcqg-netlanlast updated 27 Nov 20182824 tcpCQG Net/LAN 1cqg-netlan-1last updated 27 Nov 20182824 udpCQG Net/Lan 1cqg-netlan-1last updated 27 Nov 20182825 (unassigned) Possibly assignedN/Alast updated 27 Nov 20182826 tcpslc systemlogslc-systemloglast updated 27 Nov 20182826 udpslc systemlogslc-systemloglast updated 27 Nov 20182827 tcpslc ctrlrloopsslc-ctrlrloopslast updated 27 Nov 20182827 udpslc ctrlrloopsslc-ctrlrloopslast updated 27 Nov 20182828 tcpITM License Manageritm-lmlast updated 27 Nov 20182828 udpITM License Manageritm-lmlast updated 27 Nov 20182829 tcpsilkp1silkp1last updated 27 Nov 20182829 udpsilkp1silkp1last updated 27 Nov 20182830 tcpsilkp2silkp2last updated 27 Nov 20182830 udpsilkp2silkp2last updated 27 Nov 20182831 tcpsilkp3silkp3last updated 27 Nov 20182831 udpsilkp3silkp3last updated 27 Nov 20182832 tcpsilkp4silkp4last updated 27 Nov 20182832 udpsilkp4silkp4last updated 27 Nov 20182833 tcpglishdglishdlast updated 27 Nov 20182833 udpglishdglishdlast updated 27 Nov 20182834 tcpEVTPevtplast updated 27 Nov 20182834 udpEVTPevtplast updated 27 Nov 20182835 tcpEVTP-DATAevtp-datalast updated 27 Nov 20182835 udpEVTP-DATAevtp-datalast updated 27 Nov 20182836 tcpcatalystcatalystlast updated 27 Nov 20182836 udpcatalystcatalystlast updated 27 Nov 20182837 tcpRepliwebrepliweblast updated 27 Nov 20182837 udpRepliwebrepliweblast updated 27 Nov 20182838 tcpStarbotstarbotlast updated 27 Nov 20182838 udpStarbotstarbotlast updated 27 Nov 20182839 tcpNMSigPortnmsigportlast updated 27 Nov 20182839 udpNMSigPortnmsigportlast updated 27 Nov 20182840 tcpl3-exprtl3-exprtlast updated 27 Nov 20182840 udpl3-exprtl3-exprtlast updated 27 Nov 20182841 tcpl3-rangerl3-rangerlast updated 27 Nov 20182841 udpl3-rangerl3-rangerlast updated 27 Nov 20182842 tcpl3-hawkl3-hawklast updated 27 Nov 20182842 udpl3-hawkl3-hawklast updated 27 Nov 20182843 tcpPDnetpdnetlast updated 27 Nov 20182843 udpPDnetpdnetlast updated 27 Nov 20182844 tcpBPCP POLLbpcp-polllast updated 27 Nov 20182844 udpBPCP POLLbpcp-polllast updated 27 Nov 20182845 tcpBPCP TRAPbpcp-traplast updated 27 Nov 20182845 udpBPCP TRAPbpcp-traplast updated 27 Nov 20182846 tcpAIMPP Helloaimpp-hellolast updated 27 Nov 20182846 udpAIMPP Helloaimpp-hellolast updated 27 Nov 20182847 tcpAIMPP Port Reqaimpp-port-reqlast updated 27 Nov 20182847 udpAIMPP Port Reqaimpp-port-reqlast updated 27 Nov 20182848 tcpAMT-BLC-PORTamt-blc-portlast updated 27 Nov 20182848 udpAMT-BLC-PORTamt-blc-portlast updated 27 Nov 20182849 tcpFXPfxplast updated 27 Nov 20182849 udpFXPfxplast updated 27 Nov 20182850 tcpMetaConsolemetaconsolelast updated 27 Nov 20182850 udpMetaConsolemetaconsolelast updated 27 Nov 20182851 tcpwebemshttpwebemshttplast updated 27 Nov 20182851 udpwebemshttpwebemshttplast updated 27 Nov 20182852 tcpbears-01bears-01last updated 27 Nov 20182852 udpbears-01bears-01last updated 27 Nov 20182853 tcpISPipesispipeslast updated 27 Nov 20182853 udpISPipesispipeslast updated 27 Nov 20182854 tcpInfoMoverinfomoverlast updated 27 Nov 20182854 udpInfoMoverinfomoverlast updated 27 Nov 20182855 tcpMSRP over TCPmsrplast updated 27 Nov 20182855 udpReservedN/Alast updated 27 Nov 20182856 tcpcesdinvcesdinvlast updated 27 Nov 20182856 udpcesdinvcesdinvlast updated 27 Nov 20182857 tcpSimCtIPsimctlplast updated 27 Nov 20182857 udpSimCtIPsimctlplast updated 27 Nov 20182858 tcpECNPecnplast updated 27 Nov 20182858 udpECNPecnplast updated 27 Nov 20182859 tcpActive Memoryactivememorylast updated 27 Nov 20182859 udpActive Memoryactivememorylast updated 27 Nov 20182860 tcpDialpad Voice 1dialpad-voice1last updated 27 Nov 20182860 udpDialpad Voice 1dialpad-voice1last updated 27 Nov 20182861 tcpDialpad Voice 2dialpad-voice2last updated 27 Nov 20182861 udpDialpad Voice 2dialpad-voice2last updated 27 Nov 20182862 tcpTTG Protocolttg-protocollast updated 27 Nov 20182862 udpTTG Protocolttg-protocollast updated 27 Nov 20182863 tcpSonar Datasonardatalast updated 27 Nov 20182863 udpSonar Datasonardatalast updated 27 Nov 20182864 tcpmain 5001 cmdastromed-mainlast updated 27 Nov 20182864 udpmain 5001 cmdastromed-mainlast updated 27 Nov 20182865 tcppit-vpnpit-vpnlast updated 27 Nov 20182865 udppit-vpnpit-vpnlast updated 27 Nov 20182866 tcpiwlisteneriwlistenerlast updated 27 Nov 20182866 udpiwlisteneriwlistenerlast updated 27 Nov 20182867 tcpesps-portalesps-portallast updated 27 Nov 20182867 udpesps-portalesps-portallast updated 27 Nov 20182868 tcpNorman Proprietaqry Events Protocolnpep-messaginglast updated 27 Nov 20182868 udpNorman Proprietaqry Events Protocolnpep-messaginglast updated 27 Nov 20182869 tcpICSLAPicslaplast updated 27 Nov 20182869 udpICSLAPicslaplast updated 27 Nov 20182870 tcpdaishidaishilast updated 27 Nov 20182870 udpdaishidaishilast updated 27 Nov 20182871 tcpMSI Select Playmsi-selectplaylast updated 27 Nov 20182871 udpMSI Select Playmsi-selectplaylast updated 27 Nov 20182872 tcpRADIXradixlast updated 27 Nov 20182872 udpRADIXradixlast updated 27 Nov 20182873 UnassignedN/Alast updated 27 Nov 20182874 tcpDX Message Base Transport Protocoldxmessagebase1last updated 27 Nov 20182874 udpDX Message Base Transport Protocoldxmessagebase1last updated 27 Nov 20182875 tcpDX Message Base Transport Protocoldxmessagebase2last updated 27 Nov 20182875 udpDX Message Base Transport Protocoldxmessagebase2last updated 27 Nov 20182876 tcpSPS Tunnelsps-tunnellast updated 27 Nov 20182876 udpSPS Tunnelsps-tunnellast updated 27 Nov 20182877 tcpBLUELANCEbluelancelast updated 27 Nov 20182877 udpBLUELANCEbluelancelast updated 27 Nov 20182878 tcpAAPaaplast updated 27 Nov 20182878 udpAAPaaplast updated 27 Nov 20182879 tcpucentric-dsucentric-dslast updated 27 Nov 20182879 udpucentric-dsucentric-dslast updated 27 Nov 20182880 tcpSynapse Transportsynapselast updated 27 Nov 20182880 udpSynapse Transportsynapselast updated 27 Nov 20182881 tcpNDSPndsplast updated 27 Nov 20182881 udpNDSPndsplast updated 27 Nov 20182882 tcpNDTPndtplast updated 27 Nov 20182882 udpNDTPndtplast updated 27 Nov 20182883 tcpNDNPndnplast updated 27 Nov 20182883 udpNDNPndnplast updated 27 Nov 20182884 tcpFlash Msgflashmsglast updated 27 Nov 20182884 udpFlash Msgflashmsglast updated 27 Nov 20182885 tcpTopFlowtopflowlast updated 27 Nov 20182885 udpTopFlowtopflowlast updated 27 Nov 20182886 tcpRESPONSELOGICresponselogiclast updated 27 Nov 20182886 udpRESPONSELOGICresponselogiclast updated 27 Nov 20182887 tcpaironetaironetddplast updated 27 Nov 20182887 udpaironetaironetddplast updated 27 Nov 20182888 tcpSPCSDLOBBYspcsdlobbylast updated 27 Nov 20182888 udpSPCSDLOBBYspcsdlobbylast updated 27 Nov 20182889 tcpRSOMrsomlast updated 27 Nov 20182889 udpRSOMrsomlast updated 27 Nov 20182890 tcpCSPCLMULTIcspclmultilast updated 27 Nov 20182890 udpCSPCLMULTIcspclmultilast updated 27 Nov 20182891 tcpCINEGRFX-ELMD License Managercinegrfx-elmdlast updated 27 Nov 20182891 udpCINEGRFX-ELMD License Managercinegrfx-elmdlast updated 27 Nov 20182892 tcpSNIFFERDATAsnifferdatalast updated 27 Nov 20182892 udpSNIFFERDATAsnifferdatalast updated 27 Nov 20182893 tcpVSECONNECTORvseconnectorlast updated 27 Nov 20182893 udpVSECONNECTORvseconnectorlast updated 27 Nov 20182894 tcpABACUS-REMOTEabacus-remotelast updated 27 Nov 20182894 udpABACUS-REMOTEabacus-remotelast updated 27 Nov 20182895 tcpNATUS LINKnatuslinklast updated 27 Nov 20182895 udpNATUS LINKnatuslinklast updated 27 Nov 20182896 tcpECOVISIONG6-1ecovisiong6-1last updated 27 Nov 20182896 udpECOVISIONG6-1ecovisiong6-1last updated 27 Nov 20182897 tcpCitrix RTMPcitrix-rtmplast updated 27 Nov 20182897 udpCitrix RTMPcitrix-rtmplast updated 27 Nov 20182898 tcpAPPLIANCE-CFGappliance-cfglast updated 27 Nov 20182898 udpAPPLIANCE-CFGappliance-cfglast updated 27 Nov 20182899 tcpPOWERGEMPLUSpowergempluslast updated 27 Nov 20182899 udpPOWERGEMPLUSpowergempluslast updated 27 Nov 20182900 tcpQUICKSUITEquicksuitelast updated 27 Nov 20182900 udpQUICKSUITEquicksuitelast updated 27 Nov 20182901 tcpALLSTORCNSallstorcnslast updated 27 Nov 20182901 udpALLSTORCNSallstorcnslast updated 27 Nov 20182902 tcpNET ASPInetaspilast updated 27 Nov 20182902 udpNET ASPInetaspilast updated 27 Nov 20182903 tcpSUITCASEsuitcaselast updated 27 Nov 20182903 udpSUITCASEsuitcaselast updated 27 Nov 20182904 tcpM2UAm2ualast updated 27 Nov 20182904 udpM2UAm2ualast updated 27 Nov 20182904 sctpM2UAm2ualast updated 27 Nov 20182905 tcpM3UAm3ualast updated 27 Nov 20182905 udpDe-registeredN/Alast updated 27 Nov 20182905 sctpM3UAm3ualast updated 27 Nov 20182906 tcpCALLER9caller9last updated 27 Nov 20182906 udpCALLER9caller9last updated 27 Nov 20182907 tcpWEBMETHODS B2Bwebmethods-b2blast updated 27 Nov 20182907 udpWEBMETHODS B2Bwebmethods-b2blast updated 27 Nov 20182908 tcpmaomaolast updated 27 Nov 20182908 udpmaomaolast updated 27 Nov 20182909 tcpFunk Dialoutfunk-dialoutlast updated 27 Nov 20182909 udpFunk Dialoutfunk-dialoutlast updated 27 Nov 20182910 tcpTDAccesstdaccesslast updated 27 Nov 20182910 udpTDAccesstdaccesslast updated 27 Nov 20182911 tcpBlockadeblockadelast updated 27 Nov 20182911 udpBlockadeblockadelast updated 27 Nov 20182912 tcpEpiconepiconlast updated 27 Nov 20182912 udpEpiconepiconlast updated 27 Nov 20182913 tcpBooster Wareboosterwarelast updated 27 Nov 20182913 udpBooster Wareboosterwarelast updated 27 Nov 20182914 tcpGame Lobbygamelobbylast updated 27 Nov 20182914 udpGame Lobbygamelobbylast updated 27 Nov 20182915 tcpTK Sockettksocketlast updated 27 Nov 20182915 udpTK Sockettksocketlast updated 27 Nov 20182916 tcpElvin Server IANA assigned this well-formed service name as a replacement for "elvin_server".elvin-serverlast updated 27 Nov 20182916 tcp (elvin_server)Elvin Serverelvin_serverlast updated 27 Nov 20182916 udpElvin Server IANA assigned this well-formed service name as a replacement for "elvin_server".elvin-serverlast updated 27 Nov 20182916 udp (elvin_server)Elvin Serverelvin_serverlast updated 27 Nov 20182917 tcpElvin Client IANA assigned this well-formed service name as a replacement for "elvin_client".elvin-clientlast updated 27 Nov 20182917 tcp (elvin_client)Elvin Clientelvin_clientlast updated 27 Nov 20182917 udpElvin Client IANA assigned this well-formed service name as a replacement for "elvin_client".elvin-clientlast updated 27 Nov 20182917 udp (elvin_client)Elvin Clientelvin_clientlast updated 27 Nov 20182918 tcpKasten Chase Padkastenchasepadlast updated 27 Nov 20182918 udpKasten Chase Padkastenchasepadlast updated 27 Nov 20182919 tcproboERroboerlast updated 27 Nov 20182919 udproboERroboerlast updated 27 Nov 20182920 tcproboEDAroboedalast updated 27 Nov 20182920 udproboEDAroboedalast updated 27 Nov 20182921 tcpCESD Contents Delivery Managementcesdcdmanlast updated 27 Nov 20182921 udpCESD Contents Delivery Managementcesdcdmanlast updated 27 Nov 20182922 tcpCESD Contents Delivery Data Transfercesdcdtrnlast updated 27 Nov 20182922 udpCESD Contents Delivery Data Transfercesdcdtrnlast updated 27 Nov 20182923 tcpWTA-WSP-WTP-Swta-wsp-wtp-slast updated 27 Nov 20182923 udpWTA-WSP-WTP-Swta-wsp-wtp-slast updated 27 Nov 20182924 tcpPRECISE-VIPprecise-viplast updated 27 Nov 20182924 udpPRECISE-VIPprecise-viplast updated 27 Nov 20182925 Unassigned (FRP-Released 12/7/00)N/Alast updated 27 Nov 20182926 tcpMOBILE-FILE-DLmobile-file-dllast updated 27 Nov 20182926 udpMOBILE-FILE-DLmobile-file-dllast updated 27 Nov 20182927 tcpUNIMOBILECTRLunimobilectrllast updated 27 Nov 20182927 udpUNIMOBILECTRLunimobilectrllast updated 27 Nov 20182928 tcpREDSTONE-CPSSredstone-cpsslast updated 27 Nov 20182928 udpREDSTONE-CPSSredstone-cpsslast updated 27 Nov 20182929 tcpAMX-WEBADMINamx-webadminlast updated 27 Nov 20182929 udpAMX-WEBADMINamx-webadminlast updated 27 Nov 20182930 tcpAMX-WEBLINXamx-weblinxlast updated 27 Nov 20182930 udpAMX-WEBLINXamx-weblinxlast updated 27 Nov 20182931 tcpCircle-Xcircle-xlast updated 27 Nov 20182931 udpCircle-Xcircle-xlast updated 27 Nov 20182932 tcpINCPincplast updated 27 Nov 20182932 udpINCPincplast updated 27 Nov 20182933 tcp4-TIER OPM GW4-tieropmgwlast updated 27 Nov 20182933 udp4-TIER OPM GW4-tieropmgwlast updated 27 Nov 20182934 tcp4-TIER OPM CLI4-tieropmclilast updated 27 Nov 20182934 udp4-TIER OPM CLI4-tieropmclilast updated 27 Nov 20182935 tcpQTPqtplast updated 27 Nov 20182935 udpQTPqtplast updated 27 Nov 20182936 tcpOTPatchotpatchlast updated 27 Nov 20182936 udpOTPatchotpatchlast updated 27 Nov 20182937 tcpPNACONSULT-LMpnaconsult-lmlast updated 27 Nov 20182937 udpPNACONSULT-LMpnaconsult-lmlast updated 27 Nov 20182938 tcpSM-PAS-1sm-pas-1last updated 27 Nov 20182938 udpSM-PAS-1sm-pas-1last updated 27 Nov 20182939 tcpSM-PAS-2sm-pas-2last updated 27 Nov 20182939 udpSM-PAS-2sm-pas-2last updated 27 Nov 20182940 tcpSM-PAS-3sm-pas-3last updated 27 Nov 20182940 udpSM-PAS-3sm-pas-3last updated 27 Nov 20182941 tcpSM-PAS-4sm-pas-4last updated 27 Nov 20182941 udpSM-PAS-4sm-pas-4last updated 27 Nov 20182942 tcpSM-PAS-5sm-pas-5last updated 27 Nov 20182942 udpSM-PAS-5sm-pas-5last updated 27 Nov 20182943 tcpTTNRepositoryttnrepositorylast updated 27 Nov 20182943 udpTTNRepositoryttnrepositorylast updated 27 Nov 20182944 tcpMegaco H-248megaco-h248last updated 27 Nov 20182944 udpMegaco H-248megaco-h248last updated 27 Nov 20182944 sctpMegaco-H.248 textmegaco-h248last updated 27 Nov 20182945 tcpH248 Binaryh248-binarylast updated 27 Nov 20182945 udpH248 Binaryh248-binarylast updated 27 Nov 20182945 sctpMegaco/H.248 binaryh248-binarylast updated 27 Nov 20182946 tcpFJSVmporfjsvmporlast updated 27 Nov 20182946 udpFJSVmporfjsvmporlast updated 27 Nov 20182947 tcpGPS Daemon request/response protocolgpsdlast updated 27 Nov 20182947 udpGPS Daemon request/response protocolgpsdlast updated 27 Nov 20182948 tcpWAP PUSHwap-pushlast updated 27 Nov 20182948 udpWAP PUSHwap-pushlast updated 27 Nov 20182949 tcpWAP PUSH SECUREwap-pushsecurelast updated 27 Nov 20182949 udpWAP PUSH SECUREwap-pushsecurelast updated 27 Nov 20182950 tcpESIPesiplast updated 27 Nov 20182950 udpESIPesiplast updated 27 Nov 20182951 tcpOTTPottplast updated 27 Nov 20182951 udpOTTPottplast updated 27 Nov 20182952 tcpMPFWSASmpfwsaslast updated 27 Nov 20182952 udpMPFWSASmpfwsaslast updated 27 Nov 20182953 tcpOVALARMSRVovalarmsrvlast updated 27 Nov 20182953 udpOVALARMSRVovalarmsrvlast updated 27 Nov 20182954 tcpOVALARMSRV-CMDovalarmsrv-cmdlast updated 27 Nov 20182954 udpOVALARMSRV-CMDovalarmsrv-cmdlast updated 27 Nov 20182955 tcpCSNOTIFYcsnotifylast updated 27 Nov 20182955 udpCSNOTIFYcsnotifylast updated 27 Nov 20182956 tcpOVRIMOSDBMANovrimosdbmanlast updated 27 Nov 20182956 udpOVRIMOSDBMANovrimosdbmanlast updated 27 Nov 20182957 tcpJAMCT5jmact5last updated 27 Nov 20182957 udpJAMCT5jmact5last updated 27 Nov 20182958 tcpJAMCT6jmact6last updated 27 Nov 20182958 udpJAMCT6jmact6last updated 27 Nov 20182959 tcpRMOPAGTrmopagtlast updated 27 Nov 20182959 udpRMOPAGTrmopagtlast updated 27 Nov 20182960 tcpDFOXSERVERdfoxserverlast updated 27 Nov 20182960 udpDFOXSERVERdfoxserverlast updated 27 Nov 20182961 tcpBOLDSOFT-LMboldsoft-lmlast updated 27 Nov 20182961 udpBOLDSOFT-LMboldsoft-lmlast updated 27 Nov 20182962 tcpIPH-POLICY-CLIiph-policy-clilast updated 27 Nov 20182962 udpIPH-POLICY-CLIiph-policy-clilast updated 27 Nov 20182963 tcpIPH-POLICY-ADMiph-policy-admlast updated 27 Nov 20182963 udpIPH-POLICY-ADMiph-policy-admlast updated 27 Nov 20182964 tcpBULLANT SRAPbullant-sraplast updated 27 Nov 20182964 udpBULLANT SRAPbullant-sraplast updated 27 Nov 20182965 tcpBULLANT RAPbullant-raplast updated 27 Nov 20182965 udpBULLANT RAPbullant-raplast updated 27 Nov 20182966 tcpIDP-INFOTRIEVEidp-infotrievelast updated 27 Nov 20182966 udpIDP-INFOTRIEVEidp-infotrievelast updated 27 Nov 20182967 tcpSSC-AGENTssc-agentlast updated 27 Nov 20182967 udpSSC-AGENTssc-agentlast updated 27 Nov 20182968 tcpENPPenpplast updated 27 Nov 20182968 udpENPPenpplast updated 27 Nov 20182969 tcpESSPessplast updated 27 Nov 20182969 udpESSPessplast updated 27 Nov 20182970 tcpINDEX-NETindex-netlast updated 27 Nov 20182970 udpINDEX-NETindex-netlast updated 27 Nov 20182971 tcpNetClip clipboard daemonnetcliplast updated 27 Nov 20182971 udpNetClip clipboard daemonnetcliplast updated 27 Nov 20182972 tcpPMSM Webrctlpmsm-webrctllast updated 27 Nov 20182972 udpPMSM Webrctlpmsm-webrctllast updated 27 Nov 20182973 tcpSV Networkssvnetworkslast updated 27 Nov 20182973 udpSV Networkssvnetworkslast updated 27 Nov 20182974 tcpSignalsignallast updated 27 Nov 20182974 udpSignalsignallast updated 27 Nov 20182975 tcpFujitsu Configuration Management Servicefjmpcmlast updated 27 Nov 20182975 udpFujitsu Configuration Management Servicefjmpcmlast updated 27 Nov 20182976 tcpCNS Server Portcns-srv-portlast updated 27 Nov 20182976 udpCNS Server Portcns-srv-portlast updated 27 Nov 20182977 tcpTTCs Enterprise Test Access Protocol - NSttc-etap-nslast updated 27 Nov 20182977 udpTTCs Enterprise Test Access Protocol - NSttc-etap-nslast updated 27 Nov 20182978 tcpTTCs Enterprise Test Access Protocol - DSttc-etap-dslast updated 27 Nov 20182978 udpTTCs Enterprise Test Access Protocol - DSttc-etap-dslast updated 27 Nov 20182979 tcpH.263 Video Streamingh263-videolast updated 27 Nov 20182979 udpH.263 Video Streamingh263-videolast updated 27 Nov 20182980 tcpInstant Messaging Servicewimdlast updated 27 Nov 20182980 udpInstant Messaging Servicewimdlast updated 27 Nov 20182981 tcpMYLXAMPORTmylxamportlast updated 27 Nov 20182981 udpMYLXAMPORTmylxamportlast updated 27 Nov 20182982 tcpIWB-WHITEBOARDiwb-whiteboardlast updated 27 Nov 20182982 udpIWB-WHITEBOARDiwb-whiteboardlast updated 27 Nov 20182983 tcpNETPLANnetplanlast updated 27 Nov 20182983 udpNETPLANnetplanlast updated 27 Nov 20182984 tcpHPIDSADMINhpidsadminlast updated 27 Nov 20182984 udpHPIDSADMINhpidsadminlast updated 27 Nov 20182985 tcpHPIDSAGENThpidsagentlast updated 27 Nov 20182985 udpHPIDSAGENThpidsagentlast updated 27 Nov 20182986 tcpSTONEFALLSstonefallslast updated 27 Nov 20182986 udpSTONEFALLSstonefallslast updated 27 Nov 20182987 tcpidentifyidentifylast updated 27 Nov 20182987 udpidentifyidentifylast updated 27 Nov 20182988 tcpHIPPA Reporting Protocolhippadlast updated 27 Nov 20182988 udpHIPPA Reporting Protocolhippadlast updated 27 Nov 20182989 tcpZARKOV Intelligent Agent Communicationzarkovlast updated 27 Nov 20182989 udpZARKOV Intelligent Agent Communicationzarkovlast updated 27 Nov 20182990 tcpBOSCAPboscaplast updated 27 Nov 20182990 udpBOSCAPboscaplast updated 27 Nov 20182991 tcpWKSTN-MONwkstn-monlast updated 27 Nov 20182991 udpWKSTN-MONwkstn-monlast updated 27 Nov 20182992 tcpAvenyo Serveravenyolast updated 27 Nov 20182992 udpAvenyo Serveravenyolast updated 27 Nov 20182993 tcpVERITAS VIS1veritas-vis1last updated 27 Nov 20182993 udpVERITAS VIS1veritas-vis1last updated 27 Nov 20182994 tcpVERITAS VIS2veritas-vis2last updated 27 Nov 20182994 udpVERITAS VIS2veritas-vis2last updated 27 Nov 20182995 tcpIDRSidrslast updated 27 Nov 20182995 udpIDRSidrslast updated 27 Nov 20182996 tcpvsixmlvsixmllast updated 27 Nov 20182996 udpvsixmlvsixmllast updated 27 Nov 20182997 tcpREBOLrebollast updated 27 Nov 20182997 udpREBOLrebollast updated 27 Nov 20182998 tcpReal Securerealsecurelast updated 27 Nov 20182998 udpReal Securerealsecurelast updated 27 Nov 20182999 tcpRemoteWare Unassignedremoteware-unlast updated 27 Nov 20182999 udpRemoteWare Unassignedremoteware-unlast updated 27 Nov 20183000 tcpHBCIhbcilast updated 27 Nov 20183000 udpHBCIhbcilast updated 27 Nov 20183000 tcp (remoteware-cl)RemoteWare Clientremoteware-cllast updated 27 Nov 20183000 udp (remoteware-cl)RemoteWare Clientremoteware-cllast updated 27 Nov 20183001 tcpOrigoDB Server Native Interfaceorigo-nativelast updated 27 Nov 20183001 udpReservedN/Alast updated 27 Nov 20183002 tcpEXLM Agentexlm-agentlast updated 27 Nov 20183002 udpEXLM Agentexlm-agentlast updated 27 Nov 20183002 tcp (remoteware-srv)RemoteWare Serverremoteware-srvlast updated 27 Nov 20183002 udp (remoteware-srv)RemoteWare Serverremoteware-srvlast updated 27 Nov 20183003 tcpCGMScgmslast updated 27 Nov 20183003 udpCGMScgmslast updated 27 Nov 20183004 tcpCsoft Agentcsoftragentlast updated 27 Nov 20183004 udpCsoft Agentcsoftragentlast updated 27 Nov 20183005 tcpGenius License Managergeniuslmlast updated 27 Nov 20183005 udpGenius License Managergeniuslmlast updated 27 Nov 20183006 tcpInstant Internet Adminii-adminlast updated 27 Nov 20183006 udpInstant Internet Adminii-adminlast updated 27 Nov 20183007 tcpLotus Mail Tracking Agent Protocollotusmtaplast updated 27 Nov 20183007 udpLotus Mail Tracking Agent Protocollotusmtaplast updated 27 Nov 20183008 tcpMidnight Technologiesmidnight-techlast updated 27 Nov 20183008 udpMidnight Technologiesmidnight-techlast updated 27 Nov 20183009 tcpPXC-NTFYpxc-ntfylast updated 27 Nov 20183009 udpPXC-NTFYpxc-ntfylast updated 27 Nov 20183010 tcpTelerate Workstationgwlast updated 27 Nov 20183010 udpTelerate Workstationping-ponglast updated 27 Nov 20183011 tcpTrusted Webtrusted-weblast updated 27 Nov 20183011 udpTrusted Webtrusted-weblast updated 27 Nov 20183012 tcpTrusted Web Clienttwsdsslast updated 27 Nov 20183012 udpTrusted Web Clienttwsdsslast updated 27 Nov 20183013 tcpGilat Sky Surfergilatskysurferlast updated 27 Nov 20183013 udpGilat Sky Surfergilatskysurferlast updated 27 Nov 20183014 tcpBroker Service IANA assigned this well-formed service name as a replacement for "broker_service".broker-servicelast updated 27 Nov 20183014 tcp (broker_service)Broker Servicebroker_servicelast updated 27 Nov 20183014 udpBroker Service IANA assigned this well-formed service name as a replacement for "broker_service".broker-servicelast updated 27 Nov 20183014 udp (broker_service)Broker Servicebroker_servicelast updated 27 Nov 20183015 tcpNATI DSTPnati-dstplast updated 27 Nov 20183015 udpNATI DSTPnati-dstplast updated 27 Nov 20183016 tcpNotify Server IANA assigned this well-formed service name as a replacement for "notify_srvr".notify-srvrlast updated 27 Nov 20183016 tcp (notify_srvr)Notify Servernotify_srvrlast updated 27 Nov 20183016 udpNotify Server IANA assigned this well-formed service name as a replacement for "notify_srvr".notify-srvrlast updated 27 Nov 20183016 udp (notify_srvr)Notify Servernotify_srvrlast updated 27 Nov 20183017 tcpEvent Listener IANA assigned this well-formed service name as a replacement for "event_listener".event-listenerlast updated 27 Nov 20183017 tcp (event_listener)Event Listenerevent_listenerlast updated 27 Nov 20183017 udpEvent Listener IANA assigned this well-formed service name as a replacement for "event_listener".event-listenerlast updated 27 Nov 20183017 udp (event_listener)Event Listenerevent_listenerlast updated 27 Nov 20183018 tcpService Registry IANA assigned this well-formed service name as a replacement for "srvc_registry".srvc-registrylast updated 27 Nov 20183018 tcp (srvc_registry)Service Registrysrvc_registrylast updated 27 Nov 20183018 udpService Registry IANA assigned this well-formed service name as a replacement for "srvc_registry".srvc-registrylast updated 27 Nov 20183018 udp (srvc_registry)Service Registrysrvc_registrylast updated 27 Nov 20183019 tcpResource Manager IANA assigned this well-formed service name as a replacement for "resource_mgr".resource-mgrlast updated 27 Nov 20183019 tcp (resource_mgr)Resource Managerresource_mgrlast updated 27 Nov 20183019 udpResource Manager IANA assigned this well-formed service name as a replacement for "resource_mgr".resource-mgrlast updated 27 Nov 20183019 udp (resource_mgr)Resource Managerresource_mgrlast updated 27 Nov 20183020 tcpCIFScifslast updated 27 Nov 20183020 udpCIFScifslast updated 27 Nov 20183021 tcpAGRI Serveragriserverlast updated 27 Nov 20183021 udpAGRI Serveragriserverlast updated 27 Nov 20183022 tcpCSREGAGENTcsregagentlast updated 27 Nov 20183022 udpCSREGAGENTcsregagentlast updated 27 Nov 20183023 tcpmagicnotesmagicnoteslast updated 27 Nov 20183023 udpmagicnotesmagicnoteslast updated 27 Nov 20183024 tcpNDS_SSO IANA assigned this well-formed service name as a replacement for "nds_sso".nds-ssolast updated 27 Nov 20183024 tcp (nds_sso)NDS_SSOnds_ssolast updated 27 Nov 20183024 udpNDS_SSO IANA assigned this well-formed service name as a replacement for "nds_sso".nds-ssolast updated 27 Nov 20183024 udp (nds_sso)NDS_SSOnds_ssolast updated 27 Nov 20183025 tcpArepa Raftarepa-raftlast updated 27 Nov 20183025 udpArepa Raftarepa-raftlast updated 27 Nov 20183026 tcpAGRI Gatewayagri-gatewaylast updated 27 Nov 20183026 udpAGRI Gatewayagri-gatewaylast updated 27 Nov 20183027 tcpLiebDevMgmt_C IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_C".LiebDevMgmt-Clast updated 27 Nov 20183027 tcp (LiebDevMgmt_C)LiebDevMgmt_CLiebDevMgmt_Clast updated 27 Nov 20183027 udpLiebDevMgmt_C IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_C".LiebDevMgmt-Clast updated 27 Nov 20183027 udp (LiebDevMgmt_C)LiebDevMgmt_CLiebDevMgmt_Clast updated 27 Nov 20183028 tcpLiebDevMgmt_DM IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_DM".LiebDevMgmt-DMlast updated 27 Nov 20183028 tcp (LiebDevMgmt_DM)LiebDevMgmt_DMLiebDevMgmt_DMlast updated 27 Nov 20183028 udpLiebDevMgmt_DM IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_DM".LiebDevMgmt-DMlast updated 27 Nov 20183028 udp (LiebDevMgmt_DM)LiebDevMgmt_DMLiebDevMgmt_DMlast updated 27 Nov 20183029 tcpLiebDevMgmt_A IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_A".LiebDevMgmt-Alast updated 27 Nov 20183029 tcp (LiebDevMgmt_A)LiebDevMgmt_ALiebDevMgmt_Alast updated 27 Nov 20183029 udpLiebDevMgmt_A IANA assigned this well-formed service name as a replacement for "LiebDevMgmt_A".LiebDevMgmt-Alast updated 27 Nov 20183029 udp (LiebDevMgmt_A)LiebDevMgmt_ALiebDevMgmt_Alast updated 27 Nov 20183030 tcpArepa Casarepa-caslast updated 27 Nov 20183030 udpArepa Casarepa-caslast updated 27 Nov 20183031 tcpRemote AppleEvents/PPC Toolboxeppclast updated 27 Nov 20183031 udpRemote AppleEvents/PPC Toolboxeppclast updated 27 Nov 20183032 tcpRedwood Chatredwood-chatlast updated 27 Nov 20183032 udpRedwood Chatredwood-chatlast updated 27 Nov 20183033 tcpPDBpdblast updated 27 Nov 20183033 udpPDBpdblast updated 27 Nov 20183034 tcpOsmosis / Helix (R) AEEA Portosmosis-aeealast updated 27 Nov 20183034 udpOsmosis / Helix (R) AEEA Portosmosis-aeealast updated 27 Nov 20183035 tcpFJSV gssagtfjsv-gssagtlast updated 27 Nov 20183035 udpFJSV gssagtfjsv-gssagtlast updated 27 Nov 20183036 tcpHagel DUMPhagel-dumplast updated 27 Nov 20183036 udpHagel DUMPhagel-dumplast updated 27 Nov 20183037 tcpHP SAN Mgmthp-san-mgmtlast updated 27 Nov 20183037 udpHP SAN Mgmthp-san-mgmtlast updated 27 Nov 20183038 tcpSantak UPSsantak-upslast updated 27 Nov 20183038 udpSantak UPSsantak-upslast updated 27 Nov 20183039 tcpCogitate, Inc.cogitatelast updated 27 Nov 20183039 udpCogitate, Inc.cogitatelast updated 27 Nov 20183040 tcpTomato Springstomato-springslast updated 27 Nov 20183040 udpTomato Springstomato-springslast updated 27 Nov 20183041 tcpdi-tracewaredi-tracewarelast updated 27 Nov 20183041 udpdi-tracewaredi-tracewarelast updated 27 Nov 20183042 tcpjourneejourneelast updated 27 Nov 20183042 udpjourneejourneelast updated 27 Nov 20183043 tcpBroadcast Routing Protocolbrplast updated 27 Nov 20183043 udpBroadcast Routing Protocolbrplast updated 27 Nov 20183044 tcpEndPoint Protocolepplast updated 27 Nov 20183044 udpEndPoint Protocolepplast updated 27 Nov 20183045 tcpResponseNetresponsenetlast updated 27 Nov 20183045 udpResponseNetresponsenetlast updated 27 Nov 20183046 tcpdi-asedi-aselast updated 27 Nov 20183046 udpdi-asedi-aselast updated 27 Nov 20183047 tcpFast Security HL Serverhlserverlast updated 27 Nov 20183047 udpFast Security HL Serverhlserverlast updated 27 Nov 20183048 tcpSierra Net PC Traderpctraderlast updated 27 Nov 20183048 udpSierra Net PC Traderpctraderlast updated 27 Nov 20183049 tcpNSWSnswslast updated 27 Nov 20183049 udpNSWSnswslast updated 27 Nov 20183050 tcpgds_db IANA assigned this well-formed service name as a replacement for "gds_db".gds-dblast updated 27 Nov 20183050 tcp (gds_db)gds_dbgds_dblast updated 27 Nov 20183050 udpgds_db IANA assigned this well-formed service name as a replacement for "gds_db".gds-dblast updated 27 Nov 20183050 udp (gds_db)gds_dbgds_dblast updated 27 Nov 20183051 tcpGalaxy Servergalaxy-serverlast updated 27 Nov 20183051 udpGalaxy Servergalaxy-serverlast updated 27 Nov 20183052 tcpAPC 3052apc-3052last updated 27 Nov 20183052 udpAPC 3052apc-3052last updated 27 Nov 20183053 tcpdsom-serverdsom-serverlast updated 27 Nov 20183053 udpdsom-serverdsom-serverlast updated 27 Nov 20183054 tcpAMT CNF PROTamt-cnf-protlast updated 27 Nov 20183054 udpAMT CNF PROTamt-cnf-protlast updated 27 Nov 20183055 tcpPolicy Serverpolicyserverlast updated 27 Nov 20183055 udpPolicy Serverpolicyserverlast updated 27 Nov 20183056 tcpCDL Servercdl-serverlast updated 27 Nov 20183056 udpCDL Servercdl-serverlast updated 27 Nov 20183057 tcpGoAhead FldUpgoahead-flduplast updated 27 Nov 20183057 udpGoAhead FldUpgoahead-flduplast updated 27 Nov 20183058 tcpvideobeansvideobeanslast updated 27 Nov 20183058 udpvideobeansvideobeanslast updated 27 Nov 20183059 tcpqsoftqsoftlast updated 27 Nov 20183059 udpqsoftqsoftlast updated 27 Nov 20183060 tcpinterserverinterserverlast updated 27 Nov 20183060 udpinterserverinterserverlast updated 27 Nov 20183061 tcpcautcpdcautcpdlast updated 27 Nov 20183061 udpcautcpdcautcpdlast updated 27 Nov 20183062 tcpncacn-ip-tcpncacn-ip-tcplast updated 27 Nov 20183062 udpncacn-ip-tcpncacn-ip-tcplast updated 27 Nov 20183063 tcpncadg-ip-udpncadg-ip-udplast updated 27 Nov 20183063 udpncadg-ip-udpncadg-ip-udplast updated 27 Nov 20183064 tcpRemote Port Redirectorrprtlast updated 27 Nov 20183064 udpRemote Port Redirectorrprtlast updated 27 Nov 20183065 tcpslinterbaseslinterbaselast updated 27 Nov 20183065 udpslinterbaseslinterbaselast updated 27 Nov 20183066 tcpNETATTACHSDMPnetattachsdmplast updated 27 Nov 20183066 udpNETATTACHSDMPnetattachsdmplast updated 27 Nov 20183067 tcpFJHPJPfjhpjplast updated 27 Nov 20183067 udpFJHPJPfjhpjplast updated 27 Nov 20183068 tcpls3 Broadcastls3bcastlast updated 27 Nov 20183068 udpls3 Broadcastls3bcastlast updated 27 Nov 20183069 tcpls3ls3last updated 27 Nov 20183069 udpls3ls3last updated 27 Nov 20183070 tcpMGXSWITCHmgxswitchlast updated 27 Nov 20183070 udpMGXSWITCHmgxswitchlast updated 27 Nov 20183071 tcpCrossplatform replication protocolxplat-replicatelast updated 27 Nov 20183071 udpReservedN/Alast updated 27 Nov 20183072 tcpContinuStor Monitor Portcsd-monitorlast updated 27 Nov 20183072 udpContinuStor Monitor Portcsd-monitorlast updated 27 Nov 20183073 tcpVery simple chatroom protvcrplast updated 27 Nov 20183073 udpVery simple chatroom protvcrplast updated 27 Nov 20183074 tcpXbox game portxboxlast updated 27 Nov 20183074 udpXbox game portxboxlast updated 27 Nov 20183075 tcpOrbix 2000 Locatororbix-locatorlast updated 27 Nov 20183075 udpOrbix 2000 Locatororbix-locatorlast updated 27 Nov 20183076 tcpOrbix 2000 Configorbix-configlast updated 27 Nov 20183076 udpOrbix 2000 Configorbix-configlast updated 27 Nov 20183077 tcpOrbix 2000 Locator SSLorbix-loc-ssllast updated 27 Nov 20183077 udpOrbix 2000 Locator SSLorbix-loc-ssllast updated 27 Nov 20183078 tcpOrbix 2000 Locator SSLorbix-cfg-ssllast updated 27 Nov 20183078 udpOrbix 2000 Locator SSLorbix-cfg-ssllast updated 27 Nov 20183079 tcpLV Front Panellv-frontpanellast updated 27 Nov 20183079 udpLV Front Panellv-frontpanellast updated 27 Nov 20183080 tcpstm_pproc IANA assigned this well-formed service name as a replacement for "stm_pproc".stm-pproclast updated 27 Nov 20183080 tcp (stm_pproc)stm_pprocstm_pproclast updated 27 Nov 20183080 udpstm_pproc IANA assigned this well-formed service name as a replacement for "stm_pproc".stm-pproclast updated 27 Nov 20183080 udp (stm_pproc)stm_pprocstm_pproclast updated 27 Nov 20183081 tcpTL1-LVtl1-lvlast updated 27 Nov 20183081 udpTL1-LVtl1-lvlast updated 27 Nov 20183082 tcpTL1-RAWtl1-rawlast updated 27 Nov 20183082 udpTL1-RAWtl1-rawlast updated 27 Nov 20183083 tcpTL1-TELNETtl1-telnetlast updated 27 Nov 20183083 udpTL1-TELNETtl1-telnetlast updated 27 Nov 20183084 tcpITM-MCCSitm-mccslast updated 27 Nov 20183084 udpITM-MCCSitm-mccslast updated 27 Nov 20183085 tcpPCIHReqpcihreqlast updated 27 Nov 20183085 udpPCIHReqpcihreqlast updated 27 Nov 20183086 tcpJDL-DBKitchenjdl-dbkitchenlast updated 27 Nov 20183086 udpJDL-DBKitchenjdl-dbkitchenlast updated 27 Nov 20183087 tcpAsoki SMAasoki-smalast updated 27 Nov 20183087 udpAsoki SMAasoki-smalast updated 27 Nov 20183088 tcpeXtensible Data Transfer Protocolxdtplast updated 27 Nov 20183088 udpeXtensible Data Transfer Protocolxdtplast updated 27 Nov 20183089 tcpParaTek Agent Linkingptk-alinklast updated 27 Nov 20183089 udpParaTek Agent Linkingptk-alinklast updated 27 Nov 20183090 tcpSenforce Session Servicesstsslast updated 27 Nov 20183090 udpSenforce Session Servicesstsslast updated 27 Nov 20183091 tcp1Ci Server Management1ci-smcslast updated 27 Nov 20183091 udp1Ci Server Management1ci-smcslast updated 27 Nov 20183092 UnassignedN/Alast updated 27 Nov 20183093 tcpJiiva RapidMQ Centerrapidmq-centerlast updated 27 Nov 20183093 udpJiiva RapidMQ Centerrapidmq-centerlast updated 27 Nov 20183094 tcpJiiva RapidMQ Registryrapidmq-reglast updated 27 Nov 20183094 udpJiiva RapidMQ Registryrapidmq-reglast updated 27 Nov 20183095 tcpPanasas rendezvous portpanasaslast updated 27 Nov 20183095 udpPanasas rendezvous portpanasaslast updated 27 Nov 20183096 tcpActive Print Server Portndl-apslast updated 27 Nov 20183096 udpActive Print Server Portndl-apslast updated 27 Nov 20183097 tcpReservedN/Alast updated 27 Nov 20183097 udpReservedN/Alast updated 27 Nov 20183097 sctpITU-T Q.1902.1/Q.2150.3itu-bicc-stclast updated 27 Nov 20183098 tcpUniversal Message Managerumm-portlast updated 27 Nov 20183098 udpUniversal Message Managerumm-portlast updated 27 Nov 20183099 tcpCHIPSY Machine Daemonchmdlast updated 27 Nov 20183099 udpCHIPSY Machine Daemonchmdlast updated 27 Nov 20183100 tcpOpCon/xpsopcon-xpslast updated 27 Nov 20183100 udpOpCon/xpsopcon-xpslast updated 27 Nov 20183101 tcpHP PolicyXpert PIB Serverhp-pxpiblast updated 27 Nov 20183101 udpHP PolicyXpert PIB Serverhp-pxpiblast updated 27 Nov 20183102 tcpSoftlinK Slave Mon Portslslavemonlast updated 27 Nov 20183102 udpSoftlinK Slave Mon Portslslavemonlast updated 27 Nov 20183103 tcpAutocue SMI Protocolautocuesmilast updated 27 Nov 20183103 udpAutocue SMI Protocolautocuesmilast updated 27 Nov 20183104 tcpAutocue Logger Protocolautocueloglast updated 27 Nov 20183104 udpAutocue Time Serviceautocuetimelast updated 27 Nov 20183105 tcpCardboxcardboxlast updated 27 Nov 20183105 udpCardboxcardboxlast updated 27 Nov 20183106 tcpCardbox HTTPcardbox-httplast updated 27 Nov 20183106 udpCardbox HTTPcardbox-httplast updated 27 Nov 20183107 tcpBusiness protocolbusinesslast updated 27 Nov 20183107 udpBusiness protocolbusinesslast updated 27 Nov 20183108 tcpGeolocate protocolgeolocatelast updated 27 Nov 20183108 udpGeolocate protocolgeolocatelast updated 27 Nov 20183109 tcpPersonnel protocolpersonnellast updated 27 Nov 20183109 udpPersonnel protocolpersonnellast updated 27 Nov 20183110 tcpsimulator control portsim-controllast updated 27 Nov 20183110 udpsimulator control portsim-controllast updated 27 Nov 20183111 tcpWeb Synchronous Serviceswsynchlast updated 27 Nov 20183111 udpWeb Synchronous Serviceswsynchlast updated 27 Nov 20183112 tcpKDE System Guardksysguardlast updated 27 Nov 20183112 udpKDE System Guardksysguardlast updated 27 Nov 20183113 tcpCS-Authenticate Svr Portcs-auth-svrlast updated 27 Nov 20183113 udpCS-Authenticate Svr Portcs-auth-svrlast updated 27 Nov 20183114 tcpCCM AutoDiscoverccmadlast updated 27 Nov 20183114 udpCCM AutoDiscoverccmadlast updated 27 Nov 20183115 tcpMCTET Mastermctet-masterlast updated 27 Nov 20183115 udpMCTET Mastermctet-masterlast updated 27 Nov 20183116 tcpMCTET Gatewaymctet-gatewaylast updated 27 Nov 20183116 udpMCTET Gatewaymctet-gatewaylast updated 27 Nov 20183117 tcpMCTET Jservmctet-jservlast updated 27 Nov 20183117 udpMCTET Jservmctet-jservlast updated 27 Nov 20183118 tcpPKAgentpkagentlast updated 27 Nov 20183118 udpPKAgentpkagentlast updated 27 Nov 20183119 tcpD2000 Kernel Portd2000kernellast updated 27 Nov 20183119 udpD2000 Kernel Portd2000kernellast updated 27 Nov 20183120 tcpD2000 Webserver Portd2000webserverlast updated 27 Nov 20183120 udpD2000 Webserver Portd2000webserverlast updated 27 Nov 20183121 tcpThe pacemaker remote (pcmk-remote) service extends high availability functionality outside of the Linux cluster into remote nodes.pcmk-remotelast updated 27 Nov 20183121 udpReservedN/Alast updated 27 Nov 20183122 tcpMTI VTR Emulator portvtr-emulatorlast updated 27 Nov 20183122 udpMTI VTR Emulator portvtr-emulatorlast updated 27 Nov 20183123 tcpEDI Translation Protocoledixlast updated 27 Nov 20183123 udpEDI Translation Protocoledixlast updated 27 Nov 20183124 tcpBeacon Portbeacon-portlast updated 27 Nov 20183124 udpBeacon Portbeacon-portlast updated 27 Nov 20183125 tcpA13-AN Interfacea13-anlast updated 27 Nov 20183125 udpA13-AN Interfacea13-anlast updated 27 Nov 20183126 UnassignedN/Alast updated 27 Nov 20183127 tcpCTX Bridge Portctx-bridgelast updated 27 Nov 20183127 udpCTX Bridge Portctx-bridgelast updated 27 Nov 20183128 tcpActive API Server Portndl-aaslast updated 27 Nov 20183128 udpActive API Server Portndl-aaslast updated 27 Nov 20183129 tcpNetPort Discovery Portnetport-idlast updated 27 Nov 20183129 udpNetPort Discovery Portnetport-idlast updated 27 Nov 20183130 tcpICPv2icpv2last updated 27 Nov 20183130 udpICPv2icpv2last updated 27 Nov 20183131 tcpNet Book Marknetbookmarklast updated 27 Nov 20183131 udpNet Book Marknetbookmarklast updated 27 Nov 20183132 tcpMicrosoft Business Rule Engine Update Servicems-rule-enginelast updated 27 Nov 20183132 udpMicrosoft Business Rule Engine Update Servicems-rule-enginelast updated 27 Nov 20183133 tcpPrism Deploy User Portprism-deploylast updated 27 Nov 20183133 udpPrism Deploy User Portprism-deploylast updated 27 Nov 20183134 tcpExtensible Code Protocolecplast updated 27 Nov 20183134 udpExtensible Code Protocolecplast updated 27 Nov 20183135 tcpPeerBook Portpeerbook-portlast updated 27 Nov 20183135 udpPeerBook Portpeerbook-portlast updated 27 Nov 20183136 tcpGrub Server Portgrubdlast updated 27 Nov 20183136 udpGrub Server Portgrubdlast updated 27 Nov 20183137 tcprtnt-1 data packetsrtnt-1last updated 27 Nov 20183137 udprtnt-1 data packetsrtnt-1last updated 27 Nov 20183138 tcprtnt-2 data packetsrtnt-2last updated 27 Nov 20183138 udprtnt-2 data packetsrtnt-2last updated 27 Nov 20183139 tcpIncognito Rendez-Vousincognitorvlast updated 27 Nov 20183139 udpIncognito Rendez-Vousincognitorvlast updated 27 Nov 20183140 tcpArilia Multiplexorariliamultilast updated 27 Nov 20183140 udpArilia Multiplexorariliamultilast updated 27 Nov 20183141 tcpVMODEMvmodemlast updated 27 Nov 20183141 udpVMODEMvmodemlast updated 27 Nov 20183142 tcpRDC WH EOSrdc-wh-eoslast updated 27 Nov 20183142 udpRDC WH EOSrdc-wh-eoslast updated 27 Nov 20183143 tcpSea Viewseaviewlast updated 27 Nov 20183143 udpSea Viewseaviewlast updated 27 Nov 20183144 tcpTarantellatarantellalast updated 27 Nov 20183144 udpTarantellatarantellalast updated 27 Nov 20183145 tcpCSI-LFAPcsi-lfaplast updated 27 Nov 20183145 udpCSI-LFAPcsi-lfaplast updated 27 Nov 20183146 tcpbears-02bears-02last updated 27 Nov 20183146 udpbears-02bears-02last updated 27 Nov 20183147 tcpRFIOrfiolast updated 27 Nov 20183147 udpRFIOrfiolast updated 27 Nov 20183148 tcpNetMike Game Administratornm-game-adminlast updated 27 Nov 20183148 udpNetMike Game Administratornm-game-adminlast updated 27 Nov 20183149 tcpNetMike Game Servernm-game-serverlast updated 27 Nov 20183149 udpNetMike Game Servernm-game-serverlast updated 27 Nov 20183150 tcpNetMike Assessor Administratornm-asses-adminlast updated 27 Nov 20183150 udpNetMike Assessor Administratornm-asses-adminlast updated 27 Nov 20183151 tcpNetMike Assessornm-assessorlast updated 27 Nov 20183151 udpNetMike Assessornm-assessorlast updated 27 Nov 20183152 tcpFeiTian Portfeitianrockeylast updated 27 Nov 20183152 udpFeiTian Portfeitianrockeylast updated 27 Nov 20183153 tcpS8Cargo Client Ports8-client-portlast updated 27 Nov 20183153 udpS8Cargo Client Ports8-client-portlast updated 27 Nov 20183154 tcpON RMI Registryccmrmilast updated 27 Nov 20183154 udpON RMI Registryccmrmilast updated 27 Nov 20183155 tcpJpegMpeg Portjpegmpeglast updated 27 Nov 20183155 udpJpegMpeg Portjpegmpeglast updated 27 Nov 20183156 tcpIndura Collectorinduralast updated 27 Nov 20183156 udpIndura Collectorinduralast updated 27 Nov 20183157 tcpCCC Listener Porte3consultantslast updated 27 Nov 20183157 udpCCC Listener Porte3consultantslast updated 27 Nov 20183158 tcpSmashTV Protocolstvplast updated 27 Nov 20183158 udpSmashTV Protocolstvplast updated 27 Nov 20183159 tcpNavegaWeb Tarificationnavegaweb-portlast updated 27 Nov 20183159 udpNavegaWeb Tarificationnavegaweb-portlast updated 27 Nov 20183160 tcpTIP Application Servertip-app-serverlast updated 27 Nov 20183160 udpTIP Application Servertip-app-serverlast updated 27 Nov 20183161 tcpDOC1 License Managerdoc1lmlast updated 27 Nov 20183161 udpDOC1 License Managerdoc1lmlast updated 27 Nov 20183162 tcpSFLMsflmlast updated 27 Nov 20183162 udpSFLMsflmlast updated 27 Nov 20183163 tcpRES-SAPres-saplast updated 27 Nov 20183163 udpRES-SAPres-saplast updated 27 Nov 20183164 tcpIMPRSimprslast updated 27 Nov 20183164 udpIMPRSimprslast updated 27 Nov 20183165 tcpNewgenpay Engine Servicenewgenpaylast updated 27 Nov 20183165 udpNewgenpay Engine Servicenewgenpaylast updated 27 Nov 20183166 tcpQuest Spotlight Out-Of-Process Collectorsossecollectorlast updated 27 Nov 20183166 udpQuest Spotlight Out-Of-Process Collectorsossecollectorlast updated 27 Nov 20183167 tcpNow Contact Public Servernowcontactlast updated 27 Nov 20183167 udpNow Contact Public Servernowcontactlast updated 27 Nov 20183168 tcpNow Up-to-Date Public Serverpoweronnudlast updated 27 Nov 20183168 udpNow Up-to-Date Public Serverpoweronnudlast updated 27 Nov 20183169 tcpSERVERVIEW-ASserverview-aslast updated 27 Nov 20183169 udpSERVERVIEW-ASserverview-aslast updated 27 Nov 20183170 tcpSERVERVIEW-ASNserverview-asnlast updated 27 Nov 20183170 udpSERVERVIEW-ASNserverview-asnlast updated 27 Nov 20183171 tcpSERVERVIEW-GFserverview-gflast updated 27 Nov 20183171 udpSERVERVIEW-GFserverview-gflast updated 27 Nov 20183172 tcpSERVERVIEW-RMserverview-rmlast updated 27 Nov 20183172 udpSERVERVIEW-RMserverview-rmlast updated 27 Nov 20183173 tcpSERVERVIEW-ICCserverview-icclast updated 27 Nov 20183173 udpSERVERVIEW-ICCserverview-icclast updated 27 Nov 20183174 tcpARMI Serverarmi-serverlast updated 27 Nov 20183174 udpARMI Serverarmi-serverlast updated 27 Nov 20183175 tcpT1_E1_Over_IPt1-e1-over-iplast updated 27 Nov 20183175 udpT1_E1_Over_IPt1-e1-over-iplast updated 27 Nov 20183176 tcpARS Masterars-masterlast updated 27 Nov 20183176 udpARS Masterars-masterlast updated 27 Nov 20183177 tcpPhonex Protocolphonex-portlast updated 27 Nov 20183177 udpPhonex Protocolphonex-portlast updated 27 Nov 20183178 tcpRadiance UltraEdge Portradclientportlast updated 27 Nov 20183178 udpRadiance UltraEdge Portradclientportlast updated 27 Nov 20183179 tcpH2GF W.2m Handover prot.h2gf-w-2mlast updated 27 Nov 20183179 udpH2GF W.2m Handover prot.h2gf-w-2mlast updated 27 Nov 20183180 tcpMillicent Broker Servermc-brk-srvlast updated 27 Nov 20183180 udpMillicent Broker Servermc-brk-srvlast updated 27 Nov 20183181 tcpBMC Patrol Agentbmcpatrolagentlast updated 27 Nov 20183181 udpBMC Patrol Agentbmcpatrolagentlast updated 27 Nov 20183182 tcpBMC Patrol Rendezvousbmcpatrolrnvulast updated 27 Nov 20183182 udpBMC Patrol Rendezvousbmcpatrolrnvulast updated 27 Nov 20183183 tcpCOPS/TLScops-tlslast updated 27 Nov 20183183 udpCOPS/TLScops-tlslast updated 27 Nov 20183184 tcpApogeeX Portapogeex-portlast updated 27 Nov 20183184 udpApogeeX Portapogeex-portlast updated 27 Nov 20183185 tcpSuSE Meta PPPDsmpppdlast updated 27 Nov 20183185 udpSuSE Meta PPPDsmpppdlast updated 27 Nov 20183186 tcpIIW Monitor User Portiiw-portlast updated 27 Nov 20183186 udpIIW Monitor User Portiiw-portlast updated 27 Nov 20183187 tcpOpen Design Listen Portodi-portlast updated 27 Nov 20183187 udpOpen Design Listen Portodi-portlast updated 27 Nov 20183188 tcpBroadcom Portbrcm-comm-portlast updated 27 Nov 20183188 udpBroadcom Portbrcm-comm-portlast updated 27 Nov 20183189 tcpPinnacle Sys InfEx Portpcle-infexlast updated 27 Nov 20183189 udpPinnacle Sys InfEx Portpcle-infexlast updated 27 Nov 20183190 tcpConServR Proxycsvr-proxylast updated 27 Nov 20183190 udpConServR Proxycsvr-proxylast updated 27 Nov 20183191 tcpConServR SSL Proxycsvr-sslproxylast updated 27 Nov 20183191 udpConServR SSL Proxycsvr-sslproxylast updated 27 Nov 20183192 tcpFireMon Revision Controlfiremonrcclast updated 27 Nov 20183192 udpFireMon Revision Controlfiremonrcclast updated 27 Nov 20183193 tcpSpanDataPortspandataportlast updated 27 Nov 20183193 udpSpanDataPortspandataportlast updated 27 Nov 20183194 tcpRockstorm MAG protocolmagbindlast updated 27 Nov 20183194 udpRockstorm MAG protocolmagbindlast updated 27 Nov 20183195 tcpNetwork Control Unitncu-1last updated 27 Nov 20183195 udpNetwork Control Unitncu-1last updated 27 Nov 20183196 tcpNetwork Control Unitncu-2last updated 27 Nov 20183196 udpNetwork Control Unitncu-2last updated 27 Nov 20183197 tcpEmbrace Device Protocol Serverembrace-dp-slast updated 27 Nov 20183197 udpEmbrace Device Protocol Serverembrace-dp-slast updated 27 Nov 20183198 tcpEmbrace Device Protocol Clientembrace-dp-clast updated 27 Nov 20183198 udpEmbrace Device Protocol Clientembrace-dp-clast updated 27 Nov 20183199 tcpDMOD WorkSpacedmod-workspacelast updated 27 Nov 20183199 udpDMOD WorkSpacedmod-workspacelast updated 27 Nov 20183200 tcpPress-sense Tick Porttick-portlast updated 27 Nov 20183200 udpPress-sense Tick Porttick-portlast updated 27 Nov 20183201 tcpCPQ-TaskSmartcpq-tasksmartlast updated 27 Nov 20183201 udpCPQ-TaskSmartcpq-tasksmartlast updated 27 Nov 20183202 tcpIntraIntraintraintralast updated 27 Nov 20183202 udpIntraIntraintraintralast updated 27 Nov 20183203 tcpNetwork Watcher Monitornetwatcher-monlast updated 27 Nov 20183203 udpNetwork Watcher Monitornetwatcher-monlast updated 27 Nov 20183204 tcpNetwork Watcher DB Accessnetwatcher-dblast updated 27 Nov 20183204 udpNetwork Watcher DB Accessnetwatcher-dblast updated 27 Nov 20183205 tcpiSNS Server Portisnslast updated 27 Nov 20183205 udpiSNS Server Portisnslast updated 27 Nov 20183206 tcpIronMail POP Proxyironmaillast updated 27 Nov 20183206 udpIronMail POP Proxyironmaillast updated 27 Nov 20183207 tcpVeritas Authentication Portvx-auth-portlast updated 27 Nov 20183207 udpVeritas Authentication Portvx-auth-portlast updated 27 Nov 20183208 tcpPFU PR Callbackpfu-prcallbacklast updated 27 Nov 20183208 udpPFU PR Callbackpfu-prcallbacklast updated 27 Nov 20183209 tcpHP OpenView Network Path Engine Servernetwkpathenginelast updated 27 Nov 20183209 udpHP OpenView Network Path Engine Servernetwkpathenginelast updated 27 Nov 20183210 tcpFlamenco Networks Proxyflamenco-proxylast updated 27 Nov 20183210 udpFlamenco Networks Proxyflamenco-proxylast updated 27 Nov 20183211 tcpAvocent Secure Managementavsecuremgmtlast updated 27 Nov 20183211 udpAvocent Secure Managementavsecuremgmtlast updated 27 Nov 20183212 tcpSurvey Instrumentsurveyinstlast updated 27 Nov 20183212 udpSurvey Instrumentsurveyinstlast updated 27 Nov 20183213 tcpNEON 24X7 Mission Controlneon24x7last updated 27 Nov 20183213 udpNEON 24X7 Mission Controlneon24x7last updated 27 Nov 20183214 tcpJMQ Daemon Port 1jmq-daemon-1last updated 27 Nov 20183214 udpJMQ Daemon Port 1jmq-daemon-1last updated 27 Nov 20183215 tcpJMQ Daemon Port 2jmq-daemon-2last updated 27 Nov 20183215 udpJMQ Daemon Port 2jmq-daemon-2last updated 27 Nov 20183216 tcpFerrari electronic FOAMferrari-foamlast updated 27 Nov 20183216 udpFerrari electronic FOAMferrari-foamlast updated 27 Nov 20183217 tcpUnified IP & Telecom Environmentunitelast updated 27 Nov 20183217 udpUnified IP & Telecom Environmentunitelast updated 27 Nov 20183218 tcpEMC SmartPacketssmartpacketslast updated 27 Nov 20183218 udpEMC SmartPacketssmartpacketslast updated 27 Nov 20183219 tcpWMS Messengerwms-messengerlast updated 27 Nov 20183219 udpWMS Messengerwms-messengerlast updated 27 Nov 20183220 tcpXML NM over SSLxnm-ssllast updated 27 Nov 20183220 udpXML NM over SSLxnm-ssllast updated 27 Nov 20183221 tcpXML NM over TCPxnm-clear-textlast updated 27 Nov 20183221 udpXML NM over TCPxnm-clear-textlast updated 27 Nov 20183222 tcpGateway Load Balancing Prglbplast updated 27 Nov 20183222 udpGateway Load Balancing Prglbplast updated 27 Nov 20183223 tcpDIGIVOTE (R) Vote-Serverdigivotelast updated 27 Nov 20183223 udpDIGIVOTE (R) Vote-Serverdigivotelast updated 27 Nov 20183224 tcpAES Discovery Portaes-discoverylast updated 27 Nov 20183224 udpAES Discovery Portaes-discoverylast updated 27 Nov 20183225 tcpFCIPfcip-portlast updated 27 Nov 20183225 udpFCIPfcip-portlast updated 27 Nov 20183226 tcpISI Industry Software IRPisi-irplast updated 27 Nov 20183226 udpISI Industry Software IRPisi-irplast updated 27 Nov 20183227 tcpDiamondWave NMS Serverdwnmshttplast updated 27 Nov 20183227 udpDiamondWave NMS Serverdwnmshttplast updated 27 Nov 20183228 tcpDiamondWave MSG Serverdwmsgserverlast updated 27 Nov 20183228 udpDiamondWave MSG Serverdwmsgserverlast updated 27 Nov 20183229 tcpGlobal CD Portglobal-cd-portlast updated 27 Nov 20183229 udpGlobal CD Portglobal-cd-portlast updated 27 Nov 20183230 tcpSoftware Distributor Portsftdst-portlast updated 27 Nov 20183230 udpSoftware Distributor Portsftdst-portlast updated 27 Nov 20183231 tcpVidiGo communication (previous was: Delta Solutions Direct)vidigolast updated 27 Nov 20183231 udpVidiGo communication (previous was: Delta Solutions Direct)vidigolast updated 27 Nov 20183232 tcpMDT portmdtplast updated 27 Nov 20183232 udpMDT portmdtplast updated 27 Nov 20183233 tcpWhiskerControl main portwhiskerlast updated 27 Nov 20183233 udpWhiskerControl main portwhiskerlast updated 27 Nov 20183234 tcpAlchemy Serveralchemylast updated 27 Nov 20183234 udpAlchemy Serveralchemylast updated 27 Nov 20183235 tcpMDAP portmdap-portlast updated 27 Nov 20183235 udpMDAP Portmdap-portlast updated 27 Nov 20183236 tcpappareNet Test Serverapparenet-tslast updated 27 Nov 20183236 udpappareNet Test Serverapparenet-tslast updated 27 Nov 20183237 tcpappareNet Test Packet Sequencerapparenet-tpslast updated 27 Nov 20183237 udpappareNet Test Packet Sequencerapparenet-tpslast updated 27 Nov 20183238 tcpappareNet Analysis Serverapparenet-aslast updated 27 Nov 20183238 udpappareNet Analysis Serverapparenet-aslast updated 27 Nov 20183239 tcpappareNet User Interfaceapparenet-uilast updated 27 Nov 20183239 udpappareNet User Interfaceapparenet-uilast updated 27 Nov 20183240 tcpTrio Motion Control Porttriomotionlast updated 27 Nov 20183240 udpTrio Motion Control Porttriomotionlast updated 27 Nov 20183241 tcpSysOrb Monitoring Serversysorblast updated 27 Nov 20183241 udpSysOrb Monitoring Serversysorblast updated 27 Nov 20183242 tcpSession Description IDsdp-id-portlast updated 27 Nov 20183242 udpSession Description IDsdp-id-portlast updated 27 Nov 20183243 tcpTimelot Porttimelotlast updated 27 Nov 20183243 udpTimelot Porttimelotlast updated 27 Nov 20183244 tcpOneSAFonesaflast updated 27 Nov 20183244 udpOneSAFonesaflast updated 27 Nov 20183245 tcpVIEO Fabric Executivevieo-felast updated 27 Nov 20183245 udpVIEO Fabric Executivevieo-felast updated 27 Nov 20183246 tcpDVT SYSTEM PORTdvt-systemlast updated 27 Nov 20183246 udpDVT SYSTEM PORTdvt-systemlast updated 27 Nov 20183247 tcpDVT DATA LINKdvt-datalast updated 27 Nov 20183247 udpDVT DATA LINKdvt-datalast updated 27 Nov 20183248 tcpPROCOS LMprocos-lmlast updated 27 Nov 20183248 udpPROCOS LMprocos-lmlast updated 27 Nov 20183249 tcpState Sync Protocolssplast updated 27 Nov 20183249 udpState Sync Protocolssplast updated 27 Nov 20183250 tcpHMS hicp porthicplast updated 27 Nov 20183250 udpHMS hicp porthicplast updated 27 Nov 20183251 tcpSys Scannersysscannerlast updated 27 Nov 20183251 udpSys Scannersysscannerlast updated 27 Nov 20183252 tcpDHE portdhelast updated 27 Nov 20183252 udpDHE portdhelast updated 27 Nov 20183253 tcpPDA Datapda-datalast updated 27 Nov 20183253 udpPDA Datapda-datalast updated 27 Nov 20183254 tcpPDA Systempda-syslast updated 27 Nov 20183254 udpPDA Systempda-syslast updated 27 Nov 20183255 tcpSemaphore Connection Portsemaphorelast updated 27 Nov 20183255 udpSemaphore Connection Portsemaphorelast updated 27 Nov 20183256 tcpCompaq RPM Agent Portcpqrpm-agentlast updated 27 Nov 20183256 udpCompaq RPM Agent Portcpqrpm-agentlast updated 27 Nov 20183257 tcpCompaq RPM Server Portcpqrpm-serverlast updated 27 Nov 20183257 udpCompaq RPM Server Portcpqrpm-serverlast updated 27 Nov 20183258 tcpIvecon Server Portivecon-portlast updated 27 Nov 20183258 udpIvecon Server Portivecon-portlast updated 27 Nov 20183259 tcpEpson Network Common Deviepncdp2last updated 27 Nov 20183259 udpEpson Network Common Deviepncdp2last updated 27 Nov 20183260 tcpiSCSI portiscsi-targetlast updated 27 Nov 20183260 udpiSCSI portiscsi-targetlast updated 27 Nov 20183261 tcpwinShadowwinshadowlast updated 27 Nov 20183261 udpwinShadowwinshadowlast updated 27 Nov 20183262 tcpNECPnecplast updated 27 Nov 20183262 udpNECPnecplast updated 27 Nov 20183263 tcpE-Color Enterprise Imagerecolor-imagerlast updated 27 Nov 20183263 udpE-Color Enterprise Imagerecolor-imagerlast updated 27 Nov 20183264 tcpcc:mail/lotusccmaillast updated 27 Nov 20183264 udpcc:mail/lotusccmaillast updated 27 Nov 20183265 tcpAltav Tunnelaltav-tunnellast updated 27 Nov 20183265 udpAltav Tunnelaltav-tunnellast updated 27 Nov 20183266 tcpNS CFG Serverns-cfg-serverlast updated 27 Nov 20183266 udpNS CFG Serverns-cfg-serverlast updated 27 Nov 20183267 tcpIBM Dial Outibm-dial-outlast updated 27 Nov 20183267 udpIBM Dial Outibm-dial-outlast updated 27 Nov 20183268 tcpMicrosoft Global Catalogmsft-gclast updated 27 Nov 20183268 udpMicrosoft Global Catalogmsft-gclast updated 27 Nov 20183269 tcpMicrosoft Global Catalog with LDAP/SSLmsft-gc-ssllast updated 27 Nov 20183269 udpMicrosoft Global Catalog with LDAP/SSLmsft-gc-ssllast updated 27 Nov 20183270 tcpVerismartverismartlast updated 27 Nov 20183270 udpVerismartverismartlast updated 27 Nov 20183271 tcpCSoft Prev Portcsoft-prevlast updated 27 Nov 20183271 udpCSoft Prev Portcsoft-prevlast updated 27 Nov 20183272 tcpFujitsu User Manageruser-managerlast updated 27 Nov 20183272 udpFujitsu User Manageruser-managerlast updated 27 Nov 20183273 tcpSimple Extensible Multiplexed Protocolsxmplast updated 27 Nov 20183273 udpSimple Extensible Multiplexed Protocolsxmplast updated 27 Nov 20183274 tcpOrdinox Serverordinox-serverlast updated 27 Nov 20183274 udpOrdinox Serverordinox-serverlast updated 27 Nov 20183275 tcpSAMDsamdlast updated 27 Nov 20183275 udpSAMDsamdlast updated 27 Nov 20183276 tcpMaxim ASICsmaxim-asicslast updated 27 Nov 20183276 udpMaxim ASICsmaxim-asicslast updated 27 Nov 20183277 tcpAWG Proxyawg-proxylast updated 27 Nov 20183277 udpAWG Proxyawg-proxylast updated 27 Nov 20183278 tcpLKCM Serverlkcmserverlast updated 27 Nov 20183278 udpLKCM Serverlkcmserverlast updated 27 Nov 20183279 tcpadmindadmindlast updated 27 Nov 20183279 udpadmindadmindlast updated 27 Nov 20183280 tcpVS Servervs-serverlast updated 27 Nov 20183280 udpVS Servervs-serverlast updated 27 Nov 20183281 tcpSYSOPTsysoptlast updated 27 Nov 20183281 udpSYSOPTsysoptlast updated 27 Nov 20183282 tcpDatusorbdatusorblast updated 27 Nov 20183282 udpDatusorbdatusorblast updated 27 Nov 20183283 tcpNet AssistantApple Remote Desktop (Net Assistant)last updated 27 Nov 20183283 udpNet AssistantApple Remote Desktop (Net Assistant)last updated 27 Nov 20183284 tcp4Talk4talklast updated 27 Nov 20183284 udp4Talk4talklast updated 27 Nov 20183285 tcpPlatoplatolast updated 27 Nov 20183285 udpPlatoplatolast updated 27 Nov 20183286 tcpE-Nete-netlast updated 27 Nov 20183286 udpE-Nete-netlast updated 27 Nov 20183287 tcpDIRECTVDATAdirectvdatalast updated 27 Nov 20183287 udpDIRECTVDATAdirectvdatalast updated 27 Nov 20183288 tcpCOPScopslast updated 27 Nov 20183288 udpCOPScopslast updated 27 Nov 20183289 tcpENPCenpclast updated 27 Nov 20183289 udpENPCenpclast updated 27 Nov 20183290 tcpCAPS LOGISTICS TOOLKIT - LMcaps-lmlast updated 27 Nov 20183290 udpCAPS LOGISTICS TOOLKIT - LMcaps-lmlast updated 27 Nov 20183291 tcpS A Holditch & Associates - LMsah-lmlast updated 27 Nov 20183291 udpS A Holditch & Associates - LMsah-lmlast updated 27 Nov 20183292 tcpCart O Ramacart-o-ramalast updated 27 Nov 20183292 udpCart O Ramacart-o-ramalast updated 27 Nov 20183293 tcpfg-fpsfg-fpslast updated 27 Nov 20183293 udpfg-fpsfg-fpslast updated 27 Nov 20183294 tcpfg-gipfg-giplast updated 27 Nov 20183294 udpfg-gipfg-giplast updated 27 Nov 20183295 tcpDynamic IP Lookupdyniplookuplast updated 27 Nov 20183295 udpDynamic IP Lookupdyniplookuplast updated 27 Nov 20183296 tcpRib License Managerrib-slmlast updated 27 Nov 20183296 udpRib License Managerrib-slmlast updated 27 Nov 20183297 tcpCytel License Managercytel-lmlast updated 27 Nov 20183297 udpCytel License Managercytel-lmlast updated 27 Nov 20183298 tcpDeskViewdeskviewlast updated 27 Nov 20183298 udpDeskViewdeskviewlast updated 27 Nov 20183299 tcppdrncspdrncslast updated 27 Nov 20183299 udppdrncspdrncslast updated 27 Nov 20183300 tcpCeph monitorcephlast updated 27 Nov 20183300 udpReservedN/Alast updated 27 Nov 20183301 unassignedN/Alast updated 27 Nov 20183302 tcpMCS Fastmailmcs-fastmaillast updated 27 Nov 20183302 udpMCS Fastmailmcs-fastmaillast updated 27 Nov 20183303 tcpOP Session Clientopsession-clntlast updated 27 Nov 20183303 udpOP Session Clientopsession-clntlast updated 27 Nov 20183304 tcpOP Session Serveropsession-srvrlast updated 27 Nov 20183304 udpOP Session Serveropsession-srvrlast updated 27 Nov 20183305 tcpODETTE-FTPodette-ftplast updated 27 Nov 20183305 udpODETTE-FTPodette-ftplast updated 27 Nov 20183306 tcpMySQLmysqllast updated 27 Nov 20183306 udpMySQLmysqllast updated 27 Nov 20183307 tcpOP Session Proxyopsession-prxylast updated 27 Nov 20183307 udpOP Session Proxyopsession-prxylast updated 27 Nov 20183308 tcpTNS Servertns-serverlast updated 27 Nov 20183308 udpTNS Servertns-serverlast updated 27 Nov 20183309 tcpTNS ADVtns-advlast updated 27 Nov 20183309 udpTNS ADVtns-advlast updated 27 Nov 20183310 tcpDyna Accessdyna-accesslast updated 27 Nov 20183310 udpDyna Accessdyna-accesslast updated 27 Nov 20183311 tcpMCNS Tel Retmcns-tel-retlast updated 27 Nov 20183311 udpMCNS Tel Retmcns-tel-retlast updated 27 Nov 20183312 tcpApplication Management Serverappman-serverlast updated 27 Nov 20183312 udpApplication Management Serverappman-serverlast updated 27 Nov 20183313 tcpUnify Object Brokeruorblast updated 27 Nov 20183313 udpUnify Object Brokeruorblast updated 27 Nov 20183314 tcpUnify Object Hostuohostlast updated 27 Nov 20183314 udpUnify Object Hostuohostlast updated 27 Nov 20183315 tcpCDIDcdidlast updated 27 Nov 20183315 udpCDIDcdidlast updated 27 Nov 20183316 tcpAICC/CMIaicc-cmilast updated 27 Nov 20183316 udpAICC/CMIaicc-cmilast updated 27 Nov 20183317 tcpVSAI PORTvsaiportlast updated 27 Nov 20183317 udpVSAI PORTvsaiportlast updated 27 Nov 20183318 tcpSwith to Swith Routing Information Protocolssriplast updated 27 Nov 20183318 udpSwith to Swith Routing Information Protocolssriplast updated 27 Nov 20183319 tcpSDT License Managersdt-lmdlast updated 27 Nov 20183319 udpSDT License Managersdt-lmdlast updated 27 Nov 20183320 tcpOffice Link 2000officelink2000last updated 27 Nov 20183320 udpOffice Link 2000officelink2000last updated 27 Nov 20183321 tcpVNSSTRvnsstrlast updated 27 Nov 20183321 udpVNSSTRvnsstrlast updated 27 Nov 20183322-3325 Active Networksactive-netlast updated 27 Nov 20183326 tcpSFTUsftulast updated 27 Nov 20183326 udpSFTUsftulast updated 27 Nov 20183327 tcpBBARSbbarslast updated 27 Nov 20183327 udpBBARSbbarslast updated 27 Nov 20183328 tcpEaglepoint License Manageregptlmlast updated 27 Nov 20183328 udpEaglepoint License Manageregptlmlast updated 27 Nov 20183329 tcpHP Device Dischp-device-disclast updated 27 Nov 20183329 udpHP Device Dischp-device-disclast updated 27 Nov 20183330 tcpMCS Calypso ICFmcs-calypsoicflast updated 27 Nov 20183330 udpMCS Calypso ICFmcs-calypsoicflast updated 27 Nov 20183331 tcpMCS Messagingmcs-messaginglast updated 27 Nov 20183331 udpMCS Messagingmcs-messaginglast updated 27 Nov 20183332 tcpMCS Mail Servermcs-mailsvrlast updated 27 Nov 20183332 udpMCS Mail Servermcs-mailsvrlast updated 27 Nov 20183333 tcpDEC Notesdec-noteslast updated 27 Nov 20183333 udpDEC Notesdec-noteslast updated 27 Nov 20183334 tcpDirect TV Webcastingdirectv-weblast updated 27 Nov 20183334 udpDirect TV Webcastingdirectv-weblast updated 27 Nov 20183335 tcpDirect TV Software Updatesdirectv-softlast updated 27 Nov 20183335 udpDirect TV Software Updatesdirectv-softlast updated 27 Nov 20183336 tcpDirect TV Tickersdirectv-ticklast updated 27 Nov 20183336 udpDirect TV Tickersdirectv-ticklast updated 27 Nov 20183337 tcpDirect TV Data Catalogdirectv-catlglast updated 27 Nov 20183337 udpDirect TV Data Catalogdirectv-catlglast updated 27 Nov 20183338 tcpOMF data banet-blast updated 27 Nov 20183338 udpOMF data banet-blast updated 27 Nov 20183339 tcpOMF data lanet-llast updated 27 Nov 20183339 udpOMF data lanet-llast updated 27 Nov 20183340 tcpOMF data manet-mlast updated 27 Nov 20183340 udpOMF data manet-mlast updated 27 Nov 20183341 tcpOMF data hanet-hlast updated 27 Nov 20183341 udpOMF data hanet-hlast updated 27 Nov 20183342 tcpWebTIEwebtielast updated 27 Nov 20183342 udpWebTIEwebtielast updated 27 Nov 20183343 tcpMS Cluster Netms-cluster-netlast updated 27 Nov 20183343 udpMS Cluster Netms-cluster-netlast updated 27 Nov 20183344 tcpBNT Managerbnt-managerlast updated 27 Nov 20183344 udpBNT Managerbnt-managerlast updated 27 Nov 20183345 tcpInfluenceinfluencelast updated 27 Nov 20183345 udpInfluenceinfluencelast updated 27 Nov 20183346 tcpTrnsprnt Proxytrnsprntproxylast updated 27 Nov 20183346 udpTrnsprnt Proxytrnsprntproxylast updated 27 Nov 20183347 tcpPhoenix RPCphoenix-rpclast updated 27 Nov 20183347 udpPhoenix RPCphoenix-rpclast updated 27 Nov 20183348 tcpPangolin Laserpangolin-laserlast updated 27 Nov 20183348 udpPangolin Laserpangolin-laserlast updated 27 Nov 20183349 tcpChevin Serviceschevinserviceslast updated 27 Nov 20183349 udpChevin Serviceschevinserviceslast updated 27 Nov 20183350 tcpFINDVIATVfindviatvlast updated 27 Nov 20183350 udpFINDVIATVfindviatvlast updated 27 Nov 20183351 tcpBtrieve portbtrievelast updated 27 Nov 20183351 udpBtrieve portbtrievelast updated 27 Nov 20183352 tcpScalable SQLssqllast updated 27 Nov 20183352 udpScalable SQLssqllast updated 27 Nov 20183353 tcpFATPIPEfatpipelast updated 27 Nov 20183353 udpFATPIPEfatpipelast updated 27 Nov 20183354 tcpSUITJDsuitjdlast updated 27 Nov 20183354 udpSUITJDsuitjdlast updated 27 Nov 20183355 tcpOrdinox Dbaseordinox-dbaselast updated 27 Nov 20183355 udpOrdinox Dbaseordinox-dbaselast updated 27 Nov 20183356 tcpUPNOTIFYPSupnotifypslast updated 27 Nov 20183356 udpUPNOTIFYPSupnotifypslast updated 27 Nov 20183357 tcpAdtech Test IPadtech-testlast updated 27 Nov 20183357 udpAdtech Test IPadtech-testlast updated 27 Nov 20183358 tcpMp Sys Rmsvrmpsysrmsvrlast updated 27 Nov 20183358 udpMp Sys Rmsvrmpsysrmsvrlast updated 27 Nov 20183359 tcpWG NetForcewg-netforcelast updated 27 Nov 20183359 udpWG NetForcewg-netforcelast updated 27 Nov 20183360 tcpKV Serverkv-serverlast updated 27 Nov 20183360 udpKV Serverkv-serverlast updated 27 Nov 20183361 tcpKV Agentkv-agentlast updated 27 Nov 20183361 udpKV Agentkv-agentlast updated 27 Nov 20183362 tcpDJ ILMdj-ilmlast updated 27 Nov 20183362 udpDJ ILMdj-ilmlast updated 27 Nov 20183363 tcpNATI Vi Servernati-vi-serverlast updated 27 Nov 20183363 udpNATI Vi Servernati-vi-serverlast updated 27 Nov 20183364 tcpCreative Servercreativeserverlast updated 27 Nov 20183364 udpCreative Servercreativeserverlast updated 27 Nov 20183365 tcpContent Servercontentserverlast updated 27 Nov 20183365 udpContent Servercontentserverlast updated 27 Nov 20183366 tcpCreative Partnercreativepartnrlast updated 27 Nov 20183366 udpCreative Partnercreativepartnrlast updated 27 Nov 20183367-3371 Satellite Video Data Linksatvid-datalnklast updated 27 Nov 20183372 tcpTIP 2tip2last updated 27 Nov 20183372 udpTIP 2tip2last updated 27 Nov 20183373 tcpLavenir License Managerlavenir-lmlast updated 27 Nov 20183373 udpLavenir License Managerlavenir-lmlast updated 27 Nov 20183374 tcpCluster Disccluster-disclast updated 27 Nov 20183374 udpCluster Disccluster-disclast updated 27 Nov 20183375 tcpVSNM Agentvsnm-agentlast updated 27 Nov 20183375 udpVSNM Agentvsnm-agentlast updated 27 Nov 20183376 tcpCD Brokercdbrokerlast updated 27 Nov 20183376 udpCD Brokercdbrokerlast updated 27 Nov 20183377 tcpCogsys Network License Managercogsys-lmlast updated 27 Nov 20183377 udpCogsys Network License Managercogsys-lmlast updated 27 Nov 20183378 tcpWSICOPYwsicopylast updated 27 Nov 20183378 udpWSICOPYwsicopylast updated 27 Nov 20183379 tcpSOCORFSsocorfslast updated 27 Nov 20183379 udpSOCORFSsocorfslast updated 27 Nov 20183380 tcpSNS Channelssns-channelslast updated 27 Nov 20183380 udpSNS Channelssns-channelslast updated 27 Nov 20183381 tcpGeneousgeneouslast updated 27 Nov 20183381 udpGeneousgeneouslast updated 27 Nov 20183382 tcpFujitsu Network Enhanced Antitheft functionfujitsu-neatlast updated 27 Nov 20183382 udpFujitsu Network Enhanced Antitheft functionfujitsu-neatlast updated 27 Nov 20183383 tcpEnterprise Software Products License Manageresp-lmlast updated 27 Nov 20183383 udpEnterprise Software Products License Manageresp-lmlast updated 27 Nov 20183384 tcpCluster Management Serviceshp-cliclast updated 27 Nov 20183384 udpHardware Managementhp-cliclast updated 27 Nov 20183385 tcpqnxnetmanqnxnetmanlast updated 27 Nov 20183385 udpqnxnetmanqnxnetmanlast updated 27 Nov 20183386 tcpGPRS Datagprs-datalast updated 27 Nov 20183386 udpGPRS SIGgprs-siglast updated 27 Nov 20183387 tcpBack Room Netbackroomnetlast updated 27 Nov 20183387 udpBack Room Netbackroomnetlast updated 27 Nov 20183388 tcpCB Servercbserverlast updated 27 Nov 20183388 udpCB Servercbserverlast updated 27 Nov 20183389 tcpMS WBT Serverms-wbt-serverlast updated 27 Nov 20183389 udpMS WBT Serverms-wbt-serverlast updated 27 Nov 20183390 tcpDistributed Service Coordinatordsclast updated 27 Nov 20183390 udpDistributed Service Coordinatordsclast updated 27 Nov 20183391 tcpSAVANTsavantlast updated 27 Nov 20183391 udpSAVANTsavantlast updated 27 Nov 20183392 tcpEFI License Managementefi-lmlast updated 27 Nov 20183392 udpEFI License Managementefi-lmlast updated 27 Nov 20183393 tcpD2K Tapestry Client to Serverd2k-tapestry1last updated 27 Nov 20183393 udpD2K Tapestry Client to Serverd2k-tapestry1last updated 27 Nov 20183394 tcpD2K Tapestry Server to Serverd2k-tapestry2last updated 27 Nov 20183394 udpD2K Tapestry Server to Serverd2k-tapestry2last updated 27 Nov 20183395 tcpDyna License Manager (Elam)dyna-lmlast updated 27 Nov 20183395 udpDyna License Manager (Elam)dyna-lmlast updated 27 Nov 20183396 tcpPrinter Agent IANA assigned this well-formed service name as a replacement for "printer_agent".printer-agentlast updated 27 Nov 20183396 tcp (printer_agent)Printer Agentprinter_agentlast updated 27 Nov 20183396 udpPrinter Agent IANA assigned this well-formed service name as a replacement for "printer_agent".printer-agentlast updated 27 Nov 20183396 udp (printer_agent)Printer Agentprinter_agentlast updated 27 Nov 20183397 tcpCloanto License Managercloanto-lmlast updated 27 Nov 20183397 udpCloanto License Managercloanto-lmlast updated 27 Nov 20183398 tcpMercantilemercantilelast updated 27 Nov 20183398 udpMercantilemercantilelast updated 27 Nov 20183399 tcpCSMScsmslast updated 27 Nov 20183399 udpCSMScsmslast updated 27 Nov 20183400 tcpCSMS2csms2last updated 27 Nov 20183400 udpCSMS2csms2last updated 27 Nov 20183401 tcpfilecastfilecastlast updated 27 Nov 20183401 udpfilecastfilecastlast updated 27 Nov 20183402 tcpFXa Engine Network Portfxaengine-netlast updated 27 Nov 20183402 udpFXa Engine Network Portfxaengine-netlast updated 27 Nov 20183403 De-registeredN/Alast updated 27 Nov 20183404 RemovedN/Alast updated 27 Nov 20183405 tcpNokia Announcement ch 1nokia-ann-ch1last updated 27 Nov 20183405 udpNokia Announcement ch 1nokia-ann-ch1last updated 27 Nov 20183406 tcpNokia Announcement ch 2nokia-ann-ch2last updated 27 Nov 20183406 udpNokia Announcement ch 2nokia-ann-ch2last updated 27 Nov 20183407 tcpLDAP admin server portldap-adminlast updated 27 Nov 20183407 udpLDAP admin server portldap-adminlast updated 27 Nov 20183408 tcpBES Api PortBESApilast updated 27 Nov 20183408 udpBES Api PortBESApilast updated 27 Nov 20183409 tcpNetworkLens Event Portnetworklenslast updated 27 Nov 20183409 udpNetworkLens Event Portnetworklenslast updated 27 Nov 20183410 tcpNetworkLens SSL Eventnetworklensslast updated 27 Nov 20183410 udpNetworkLens SSL Eventnetworklensslast updated 27 Nov 20183411 tcpBioLink Authenteon serverbiolink-authlast updated 27 Nov 20183411 udpBioLink Authenteon serverbiolink-authlast updated 27 Nov 20183412 tcpxmlBlasterxmlblasterlast updated 27 Nov 20183412 udpxmlBlasterxmlblasterlast updated 27 Nov 20183413 tcpSpecView Networkingsvnetlast updated 27 Nov 20183413 udpSpecView Networkingsvnetlast updated 27 Nov 20183414 tcpBroadCloud WIP Portwip-portlast updated 27 Nov 20183414 udpBroadCloud WIP Portwip-portlast updated 27 Nov 20183415 tcpBCI Name Servicebcinameservicelast updated 27 Nov 20183415 udpBCI Name Servicebcinameservicelast updated 27 Nov 20183416 tcpAirMobile IS Command Portcommandportlast updated 27 Nov 20183416 udpAirMobile IS Command Portcommandportlast updated 27 Nov 20183417 tcpConServR file translationcsvrlast updated 27 Nov 20183417 udpConServR file translationcsvrlast updated 27 Nov 20183418 tcpRemote nmaprnmaplast updated 27 Nov 20183418 udpRemote nmaprnmaplast updated 27 Nov 20183419 tcpIsogon SoftAuditsoftauditlast updated 27 Nov 20183419 udpISogon SoftAuditsoftauditlast updated 27 Nov 20183420 tcpiFCP User Portifcp-portlast updated 27 Nov 20183420 udpiFCP User Portifcp-portlast updated 27 Nov 20183421 tcpBull Apprise portmapperbmaplast updated 27 Nov 20183421 udpBull Apprise portmapperbmaplast updated 27 Nov 20183422 tcpRemote USB System Portrusb-sys-portlast updated 27 Nov 20183422 udpRemote USB System Portrusb-sys-portlast updated 27 Nov 20183423 tcpxTrade Reliable Messagingxtrmlast updated 27 Nov 20183423 udpxTrade Reliable Messagingxtrmlast updated 27 Nov 20183424 tcpxTrade over TLS/SSLxtrmslast updated 27 Nov 20183424 udpxTrade over TLS/SSLxtrmslast updated 27 Nov 20183425 tcpAGPS Access Portagps-portlast updated 27 Nov 20183425 udpAGPS Access Portagps-portlast updated 27 Nov 20183426 tcpArkivio Storage Protocolarkiviolast updated 27 Nov 20183426 udpArkivio Storage Protocolarkiviolast updated 27 Nov 20183427 tcpWebSphere SNMPwebsphere-snmplast updated 27 Nov 20183427 udpWebSphere SNMPwebsphere-snmplast updated 27 Nov 20183428 tcp2Wire CSStwcsslast updated 27 Nov 20183428 udp2Wire CSStwcsslast updated 27 Nov 20183429 tcpGCSP user portgcsplast updated 27 Nov 20183429 udpGCSP user portgcsplast updated 27 Nov 20183430 tcpScott Studios Dispatchssdispatchlast updated 27 Nov 20183430 udpScott Studios Dispatchssdispatchlast updated 27 Nov 20183431 tcpActive License Server Portndl-alslast updated 27 Nov 20183431 udpActive License Server Portndl-alslast updated 27 Nov 20183432 tcpSecure Device Protocolosdcplast updated 27 Nov 20183432 udpSecure Device Protocolosdcplast updated 27 Nov 20183433 tcpOPNET Service Management Platformopnet-smplast updated 27 Nov 20183433 udpOPNET Service Management Platformopnet-smplast updated 27 Nov 20183434 tcpOpenCM Serveropencmlast updated 27 Nov 20183434 udpOpenCM Serveropencmlast updated 27 Nov 20183435 tcpPacom Security User Portpacomlast updated 27 Nov 20183435 udpPacom Security User Portpacomlast updated 27 Nov 20183436 tcpGuardControl Exchange Protocolgc-configlast updated 27 Nov 20183436 udpGuardControl Exchange Protocolgc-configlast updated 27 Nov 20183437 tcpAutocue Directory Serviceautocuedslast updated 27 Nov 20183437 udpAutocue Directory Serviceautocuedslast updated 27 Nov 20183438 tcpSpiralcraft Adminspiral-adminlast updated 27 Nov 20183438 udpSpiralcraft Adminspiral-adminlast updated 27 Nov 20183439 tcpHRI Interface Porthri-portlast updated 27 Nov 20183439 udpHRI Interface Porthri-portlast updated 27 Nov 20183440 tcpNet Steward Mgmt Consoleans-consolelast updated 27 Nov 20183440 udpNet Steward Mgmt Consoleans-consolelast updated 27 Nov 20183441 tcpOC Connect Clientconnect-clientlast updated 27 Nov 20183441 udpOC Connect Clientconnect-clientlast updated 27 Nov 20183442 tcpOC Connect Serverconnect-serverlast updated 27 Nov 20183442 udpOC Connect Serverconnect-serverlast updated 27 Nov 20183443 tcpOpenView Network Node Manager WEB Serverov-nnm-websrvlast updated 27 Nov 20183443 udpOpenView Network Node Manager WEB Serverov-nnm-websrvlast updated 27 Nov 20183444 tcpDenali Serverdenali-serverlast updated 27 Nov 20183444 udpDenali Serverdenali-serverlast updated 27 Nov 20183445 tcpMedia Object Networkmonplast updated 27 Nov 20183445 udpMedia Object Networkmonplast updated 27 Nov 20183446 tcp3Com FAX RPC port3comfaxrpclast updated 27 Nov 20183446 udp3Com FAX RPC port3comfaxrpclast updated 27 Nov 20183447 tcpDirectNet IM Systemdirectnetlast updated 27 Nov 20183447 udpDirectNet IM Systemdirectnetlast updated 27 Nov 20183448 tcpDiscovery and Net Configdnc-portlast updated 27 Nov 20183448 udpDiscovery and Net Configdnc-portlast updated 27 Nov 20183449 tcpHotU Chathotu-chatlast updated 27 Nov 20183449 udpHotU Chathotu-chatlast updated 27 Nov 20183450 tcpCAStorProxycastorproxylast updated 27 Nov 20183450 udpCAStorProxycastorproxylast updated 27 Nov 20183451 tcpASAM Servicesasamlast updated 27 Nov 20183451 udpASAM Servicesasamlast updated 27 Nov 20183452 tcpSABP-Signalling Protocolsabp-signallast updated 27 Nov 20183452 udpSABP-Signalling Protocolsabp-signallast updated 27 Nov 20183453 tcpPSC Updatepscupdlast updated 27 Nov 20183453 udpPSC Updatepscupdlast updated 27 Nov 20183454 tcpApple Remote Access Protocolmiralast updated 27 Nov 20183454 udpApple Remote Access Protocolmiralast updated 27 Nov 20183455 tcpRSVP Portprsvplast updated 27 Nov 20183455 udpRSVP Portprsvplast updated 27 Nov 20183456 tcpVAT default datavatlast updated 27 Nov 20183456 udpVAT default datavatlast updated 27 Nov 20183457 tcpVAT default controlvat-controllast updated 27 Nov 20183457 udpVAT default controlvat-controllast updated 27 Nov 20183458 tcpD3WinOSFId3winosfilast updated 27 Nov 20183458 udpD3WinOSFId3winosfilast updated 27 Nov 20183459 tcpTIP Integralintegrallast updated 27 Nov 20183459 udpTIP Integralintegrallast updated 27 Nov 20183460 tcpEDM Mangeredm-managerlast updated 27 Nov 20183460 udpEDM Mangeredm-managerlast updated 27 Nov 20183461 tcpEDM Stageredm-stagerlast updated 27 Nov 20183461 udpEDM Stageredm-stagerlast updated 27 Nov 20183462 tcpEDM STD Notifyedm-std-notifylast updated 27 Nov 20183462 udpEDM STD Notifyedm-std-notifylast updated 27 Nov 20183463 tcpEDM ADM Notifyedm-adm-notifylast updated 27 Nov 20183463 udpEDM ADM Notifyedm-adm-notifylast updated 27 Nov 20183464 tcpEDM MGR Syncedm-mgr-synclast updated 27 Nov 20183464 udpEDM MGR Syncedm-mgr-synclast updated 27 Nov 20183465 tcpEDM MGR Cntrledm-mgr-cntrllast updated 27 Nov 20183465 udpEDM MGR Cntrledm-mgr-cntrllast updated 27 Nov 20183466 tcpWORKFLOWworkflowlast updated 27 Nov 20183466 udpWORKFLOWworkflowlast updated 27 Nov 20183467 tcpRCSTrcstlast updated 27 Nov 20183467 udpRCSTrcstlast updated 27 Nov 20183468 tcpTTCM Remote Controllttcmremotectrllast updated 27 Nov 20183468 udpTTCM Remote Controllttcmremotectrllast updated 27 Nov 20183469 tcpPluribuspluribuslast updated 27 Nov 20183469 udpPluribuspluribuslast updated 27 Nov 20183470 tcpjt400jt400last updated 27 Nov 20183470 udpjt400jt400last updated 27 Nov 20183471 tcpjt400-ssljt400-ssllast updated 27 Nov 20183471 udpjt400-ssljt400-ssllast updated 27 Nov 20183472 tcpJAUGS N-G Remotec 1jaugsremotec-1last updated 27 Nov 20183472 udpJAUGS N-G Remotec 1jaugsremotec-1last updated 27 Nov 20183473 tcpJAUGS N-G Remotec 2jaugsremotec-2last updated 27 Nov 20183473 udpJAUGS N-G Remotec 2jaugsremotec-2last updated 27 Nov 20183474 tcpTSP Automationttntspautolast updated 27 Nov 20183474 udpTSP Automationttntspautolast updated 27 Nov 20183475 tcpGenisar Comm Portgenisar-portlast updated 27 Nov 20183475 udpGenisar Comm Portgenisar-portlast updated 27 Nov 20183476 tcpNVIDIA Mgmt Protocolnppmplast updated 27 Nov 20183476 udpNVIDIA Mgmt Protocolnppmplast updated 27 Nov 20183477 tcpeComm link portecommlast updated 27 Nov 20183477 udpeComm link portecommlast updated 27 Nov 20183478 tcpSession Traversal Utilities for NAT (STUN) portstunlast updated 27 Nov 20183478 udpSession Traversal Utilities for NAT (STUN) portstunlast updated 27 Nov 20183478 tcp (turn)TURN over TCPturnlast updated 27 Nov 20183478 udp (turn)TURN over UDPturnlast updated 27 Nov 20183478 tcp (stun-behavior)STUN Behavior Discovery over TCPstun-behaviorlast updated 27 Nov 20183478 udp (stun-behavior)STUN Behavior Discovery over UDPstun-behaviorlast updated 27 Nov 20183479 tcp2Wire RPCtwrpclast updated 27 Nov 20183479 udp2Wire RPCtwrpclast updated 27 Nov 20183480 tcpSecure Virtual Workspaceplethoralast updated 27 Nov 20183480 udpSecure Virtual Workspaceplethoralast updated 27 Nov 20183481 tcpCleanerLive remote ctrlcleanerliverclast updated 27 Nov 20183481 udpCleanerLive remote ctrlcleanerliverclast updated 27 Nov 20183482 tcpVulture Monitoring Systemvulturelast updated 27 Nov 20183482 udpVulture Monitoring Systemvulturelast updated 27 Nov 20183483 tcpSlim Devices Protocolslim-deviceslast updated 27 Nov 20183483 udpSlim Devices Protocolslim-deviceslast updated 27 Nov 20183484 tcpGBS SnapTalk Protocolgbs-stplast updated 27 Nov 20183484 udpGBS SnapTalk Protocolgbs-stplast updated 27 Nov 20183485 tcpCelaTalkcelatalklast updated 27 Nov 20183485 udpCelaTalkcelatalklast updated 27 Nov 20183486 tcpIFSF Heartbeat Portifsf-hb-portlast updated 27 Nov 20183486 udpIFSF Heartbeat Portifsf-hb-portlast updated 27 Nov 20183487 tcpLISA TCP Transfer Channelltctcplast updated 27 Nov 20183487 udpLISA UDP Transfer Channelltcudplast updated 27 Nov 20183488 tcpFS Remote Host Serverfs-rh-srvlast updated 27 Nov 20183488 udpFS Remote Host Serverfs-rh-srvlast updated 27 Nov 20183489 tcpDTP/DIAdtp-dialast updated 27 Nov 20183489 udpDTP/DIAdtp-dialast updated 27 Nov 20183490 tcpColubris Management Portcolubrislast updated 27 Nov 20183490 udpColubris Management Portcolubrislast updated 27 Nov 20183491 tcpSWR Portswr-portlast updated 27 Nov 20183491 udpSWR Portswr-portlast updated 27 Nov 20183492 tcpTVDUM Tray Porttvdumtray-portlast updated 27 Nov 20183492 udpTVDUM Tray Porttvdumtray-portlast updated 27 Nov 20183493 tcpNetwork UPS Toolsnutlast updated 27 Nov 20183493 udpNetwork UPS Toolsnutlast updated 27 Nov 20183494 tcpIBM 3494ibm3494last updated 27 Nov 20183494 udpIBM 3494ibm3494last updated 27 Nov 20183495 tcpsecuritylayer over tcpseclayer-tcplast updated 27 Nov 20183495 udpsecuritylayer over tcpseclayer-tcplast updated 27 Nov 20183496 tcpsecuritylayer over tlsseclayer-tlslast updated 27 Nov 20183496 udpsecuritylayer over tlsseclayer-tlslast updated 27 Nov 20183497 tcpipEther232Portipether232portlast updated 27 Nov 20183497 udpipEther232Portipether232portlast updated 27 Nov 20183498 tcpDASHPAS user portdashpas-portlast updated 27 Nov 20183498 udpDASHPAS user portdashpas-portlast updated 27 Nov 20183499 tcpSccIP Mediasccip-medialast updated 27 Nov 20183499 udpSccIP Mediasccip-medialast updated 27 Nov 20183500 tcpRTMP Portrtmp-portlast updated 27 Nov 20183500 udpRTMP Portrtmp-portlast updated 27 Nov 20183501 tcpiSoft-P2Pisoft-p2plast updated 27 Nov 20183501 udpiSoft-P2Pisoft-p2plast updated 27 Nov 20183502 tcpAvocent Install Discoveryavinstalldisclast updated 27 Nov 20183502 udpAvocent Install Discoveryavinstalldisclast updated 27 Nov 20183503 tcpMPLS LSP-echo Portlsp-pinglast updated 27 Nov 20183503 udpMPLS LSP-echo Portlsp-pinglast updated 27 Nov 20183504 tcpIronStorm game serverironstormlast updated 27 Nov 20183504 udpIronStorm game serverironstormlast updated 27 Nov 20183505 tcpCCM communications portccmcommlast updated 27 Nov 20183505 udpCCM communications portccmcommlast updated 27 Nov 20183506 tcpAPC 3506apc-3506last updated 27 Nov 20183506 udpAPC 3506apc-3506last updated 27 Nov 20183507 tcpNesh Broker Portnesh-brokerlast updated 27 Nov 20183507 udpNesh Broker Portnesh-brokerlast updated 27 Nov 20183508 tcpInteraction Webinteractionweblast updated 27 Nov 20183508 udpInteraction Webinteractionweblast updated 27 Nov 20183509 tcpVirtual Token SSL Portvt-ssllast updated 27 Nov 20183509 udpVirtual Token SSL Portvt-ssllast updated 27 Nov 20183510 tcpXSS Portxss-portlast updated 27 Nov 20183510 udpXSS Portxss-portlast updated 27 Nov 20183511 tcpWebMail/2webmail-2last updated 27 Nov 20183511 udpWebMail/2webmail-2last updated 27 Nov 20183512 tcpAztec Distribution Portazteclast updated 27 Nov 20183512 udpAztec Distribution Portazteclast updated 27 Nov 20183513 tcpAdaptec Remote Protocolarcpdlast updated 27 Nov 20183513 udpAdaptec Remote Protocolarcpdlast updated 27 Nov 20183514 tcpMUST Peer to Peermust-p2plast updated 27 Nov 20183514 udpMUST Peer to Peermust-p2plast updated 27 Nov 20183515 tcpMUST Backplanemust-backplanelast updated 27 Nov 20183515 udpMUST Backplanemust-backplanelast updated 27 Nov 20183516 tcpSmartcard Portsmartcard-portlast updated 27 Nov 20183516 udpSmartcard Portsmartcard-portlast updated 27 Nov 20183517 tcpIEEE 802.11 WLANs WG IAPP802-11-iapplast updated 27 Nov 20183517 udpIEEE 802.11 WLANs WG IAPP802-11-iapplast updated 27 Nov 20183518 tcpArtifact Message Serverartifact-msglast updated 27 Nov 20183518 udpArtifact Message Serverartifact-msglast updated 27 Nov 20183519 tcpNetvion Messenger Portnvmsgdlast updated 27 Nov 20183519 udpNetvion Galileo Portgalileolast updated 27 Nov 20183520 tcpNetvion Galileo Log Portgalileologlast updated 27 Nov 20183520 udpNetvion Galileo Log Portgalileologlast updated 27 Nov 20183521 tcpTelequip Labs MC3SSmc3sslast updated 27 Nov 20183521 udpTelequip Labs MC3SSmc3sslast updated 27 Nov 20183522 tcpDO over NSSocketPortnssocketportlast updated 27 Nov 20183522 udpDO over NSSocketPortnssocketportlast updated 27 Nov 20183523 tcpOdeum Serverlinkodeumservlinklast updated 27 Nov 20183523 udpOdeum Serverlinkodeumservlinklast updated 27 Nov 20183524 tcpECM Server portecmportlast updated 27 Nov 20183524 udpECM Server portecmportlast updated 27 Nov 20183525 tcpEIS Server porteisportlast updated 27 Nov 20183525 udpEIS Server porteisportlast updated 27 Nov 20183526 tcpstarQuiz Portstarquiz-portlast updated 27 Nov 20183526 udpstarQuiz Portstarquiz-portlast updated 27 Nov 20183527 tcpVERITAS Backup Exec Serverbeserver-msg-qlast updated 27 Nov 20183527 udpVERITAS Backup Exec Serverbeserver-msg-qlast updated 27 Nov 20183528 tcpJBoss IIOPjboss-iioplast updated 27 Nov 20183528 udpJBoss IIOPjboss-iioplast updated 27 Nov 20183529 tcpJBoss IIOP/SSLjboss-iiop-ssllast updated 27 Nov 20183529 udpJBoss IIOP/SSLjboss-iiop-ssllast updated 27 Nov 20183530 tcpGrid Friendlygflast updated 27 Nov 20183530 udpGrid Friendlygflast updated 27 Nov 20183531 tcpJoltidjoltidlast updated 27 Nov 20183531 udpJoltidjoltidlast updated 27 Nov 20183532 tcpRaven Remote Management Controlraven-rmplast updated 27 Nov 20183532 udpRaven Remote Management Controlraven-rmplast updated 27 Nov 20183533 tcpRaven Remote Management Dataraven-rdplast updated 27 Nov 20183533 udpRaven Remote Management Dataraven-rdplast updated 27 Nov 20183534 tcpURL Daemon Porturld-portlast updated 27 Nov 20183534 udpURL Daemon Porturld-portlast updated 27 Nov 20183535 tcpMS-LAms-lalast updated 27 Nov 20183535 udpMS-LAms-lalast updated 27 Nov 20183536 tcpSNACsnaclast updated 27 Nov 20183536 udpSNACsnaclast updated 27 Nov 20183537 tcpRemote NI-VISA portni-visa-remotelast updated 27 Nov 20183537 udpRemote NI-VISA portni-visa-remotelast updated 27 Nov 20183538 tcpIBM Directory Serveribm-diradmlast updated 27 Nov 20183538 udpIBM Directory Serveribm-diradmlast updated 27 Nov 20183539 tcpIBM Directory Server SSLibm-diradm-ssllast updated 27 Nov 20183539 udpIBM Directory Server SSLibm-diradm-ssllast updated 27 Nov 20183540 tcpPNRP User Portpnrp-portlast updated 27 Nov 20183540 udpPNRP User Portpnrp-portlast updated 27 Nov 20183541 tcpVoiSpeed Portvoispeed-portlast updated 27 Nov 20183541 udpVoiSpeed Portvoispeed-portlast updated 27 Nov 20183542 tcpHA cluster monitorhacl-monitorlast updated 27 Nov 20183542 udpHA cluster monitorhacl-monitorlast updated 27 Nov 20183543 tcpqftest Lookup Portqftest-lookuplast updated 27 Nov 20183543 udpqftest Lookup Portqftest-lookuplast updated 27 Nov 20183544 tcpTeredo Portteredolast updated 27 Nov 20183544 udpTeredo Portteredolast updated 27 Nov 20183545 tcpCAMAC equipmentcamaclast updated 27 Nov 20183545 udpCAMAC equipmentcamaclast updated 27 Nov 20183546 UnassignedN/Alast updated 27 Nov 20183547 tcpSymantec SIMsymantec-simlast updated 27 Nov 20183547 udpSymantec SIMsymantec-simlast updated 27 Nov 20183548 tcpInterworldinterworldlast updated 27 Nov 20183548 udpInterworldinterworldlast updated 27 Nov 20183549 tcpTellumat MDR NMStellumat-nmslast updated 27 Nov 20183549 udpTellumat MDR NMStellumat-nmslast updated 27 Nov 20183550 tcpSecure SMPPssmpplast updated 27 Nov 20183550 udpSecure SMPPssmpplast updated 27 Nov 20183551 tcpApcupsd Information Portapcupsdlast updated 27 Nov 20183551 udpApcupsd Information Portapcupsdlast updated 27 Nov 20183552 tcpTeamAgenda Server Porttaserverlast updated 27 Nov 20183552 udpTeamAgenda Server Porttaserverlast updated 27 Nov 20183553 tcpRed Box Recorder ADPrbr-discoverylast updated 27 Nov 20183553 udpRed Box Recorder ADPrbr-discoverylast updated 27 Nov 20183554 tcpQuest Notification Serverquestnotifylast updated 27 Nov 20183554 udpQuest Notification Serverquestnotifylast updated 27 Nov 20183555 tcpVipul's Razorrazorlast updated 27 Nov 20183555 udpVipul's Razorrazorlast updated 27 Nov 20183556 tcpSky Transport Protocolsky-transportlast updated 27 Nov 20183556 udpSky Transport Protocolsky-transportlast updated 27 Nov 20183557 tcpPersonalOS Comm Portpersonalos-001last updated 27 Nov 20183557 udpPersonalOS Comm Portpersonalos-001last updated 27 Nov 20183558 tcpMCP user portmcp-portlast updated 27 Nov 20183558 udpMCP user portmcp-portlast updated 27 Nov 20183559 tcpCCTV control portcctv-portlast updated 27 Nov 20183559 udpCCTV control portcctv-portlast updated 27 Nov 20183560 tcpINIServe portiniserve-portlast updated 27 Nov 20183560 udpINIServe portiniserve-portlast updated 27 Nov 20183561 tcpBMC-OneKeybmc-onekeylast updated 27 Nov 20183561 udpBMC-OneKeybmc-onekeylast updated 27 Nov 20183562 tcpSDBProxysdbproxylast updated 27 Nov 20183562 udpSDBProxysdbproxylast updated 27 Nov 20183563 tcpWatcom Debugwatcomdebuglast updated 27 Nov 20183563 udpWatcom Debugwatcomdebuglast updated 27 Nov 20183564 tcpElectromed SIM portesimportlast updated 27 Nov 20183564 udpElectromed SIM portesimportlast updated 27 Nov 20183565 tcpM2PAm2palast updated 27 Nov 20183565 udpReservedN/Alast updated 27 Nov 20183565 sctpM2PAm2palast updated 27 Nov 20183566 tcpQuest Data Hubquest-data-hublast updated 27 Nov 20183566 udpReservedN/Alast updated 27 Nov 20183567 tcpDOF Protocol Stackdof-epslast updated 27 Nov 20183567 udpDOF Protocol Stackdof-epslast updated 27 Nov 20183568 tcpDOF Secure Tunneldof-tunnel-seclast updated 27 Nov 20183568 udpDOF Secure Tunneldof-tunnel-seclast updated 27 Nov 20183569 tcpMeinberg Control Servicembg-ctrllast updated 27 Nov 20183569 udpMeinberg Control Servicembg-ctrllast updated 27 Nov 20183570 tcpMCC Web Server Portmccwebsvr-portlast updated 27 Nov 20183570 udpMCC Web Server Portmccwebsvr-portlast updated 27 Nov 20183571 tcpMegaRAID Server Portmegardsvr-portlast updated 27 Nov 20183571 udpMegaRAID Server Portmegardsvr-portlast updated 27 Nov 20183572 tcpRegistration Server Portmegaregsvrportlast updated 27 Nov 20183572 udpRegistration Server Portmegaregsvrportlast updated 27 Nov 20183573 tcpAdvantage Group UPS Suitetag-ups-1last updated 27 Nov 20183573 udpAdvantage Group UPS Suitetag-ups-1last updated 27 Nov 20183574 tcpDMAF Serverdmaf-serverlast updated 27 Nov 20183574 udpDMAF Casterdmaf-casterlast updated 27 Nov 20183575 tcpCoalsere CCM Portccm-portlast updated 27 Nov 20183575 udpCoalsere CCM Portccm-portlast updated 27 Nov 20183576 tcpCoalsere CMC Portcmc-portlast updated 27 Nov 20183576 udpCoalsere CMC Portcmc-portlast updated 27 Nov 20183577 tcpConfiguration Portconfig-portlast updated 27 Nov 20183577 udpConfiguration Portconfig-portlast updated 27 Nov 20183578 tcpData Portdata-portlast updated 27 Nov 20183578 udpData Portdata-portlast updated 27 Nov 20183579 tcpTarantella Load Balancingttat3lblast updated 27 Nov 20183579 udpTarantella Load Balancingttat3lblast updated 27 Nov 20183580 tcpNATI-ServiceLocatornati-svrloclast updated 27 Nov 20183580 udpNATI-ServiceLocatornati-svrloclast updated 27 Nov 20183581 tcpAscent Capture Licensingkfxaclicensinglast updated 27 Nov 20183581 udpAscent Capture Licensingkfxaclicensinglast updated 27 Nov 20183582 tcpPEG PRESS Serverpresslast updated 27 Nov 20183582 udpPEG PRESS Serverpresslast updated 27 Nov 20183583 tcpCANEX Watch Systemcanex-watchlast updated 27 Nov 20183583 udpCANEX Watch Systemcanex-watchlast updated 27 Nov 20183584 tcpU-DBase Access Protocolu-dbaplast updated 27 Nov 20183584 udpU-DBase Access Protocolu-dbaplast updated 27 Nov 20183585 tcpEmprise License Serveremprise-llslast updated 27 Nov 20183585 udpEmprise License Serveremprise-llslast updated 27 Nov 20183586 tcpLicense Server Consoleemprise-lsclast updated 27 Nov 20183586 udpLicense Server Consoleemprise-lsclast updated 27 Nov 20183587 tcpPeer to Peer Groupingp2pgrouplast updated 27 Nov 20183587 udpPeer to Peer Groupingp2pgrouplast updated 27 Nov 20183588 tcpSentinel Serversentinellast updated 27 Nov 20183588 udpSentinel Serversentinellast updated 27 Nov 20183589 tcpisomairisomairlast updated 27 Nov 20183589 udpisomairisomairlast updated 27 Nov 20183590 tcpWV CSP SMS Bindingwv-csp-smslast updated 27 Nov 20183590 udpWV CSP SMS Bindingwv-csp-smslast updated 27 Nov 20183591 tcpLOCANIS G-TRACK Servergtrack-serverlast updated 27 Nov 20183591 udpLOCANIS G-TRACK Servergtrack-serverlast updated 27 Nov 20183592 tcpLOCANIS G-TRACK NE Portgtrack-nelast updated 27 Nov 20183592 udpLOCANIS G-TRACK NE Portgtrack-nelast updated 27 Nov 20183593 tcpBP Model Debuggerbpmdlast updated 27 Nov 20183593 udpBP Model Debuggerbpmdlast updated 27 Nov 20183594 tcpMediaSpacemediaspacelast updated 27 Nov 20183594 udpMediaSpacemediaspacelast updated 27 Nov 20183595 tcpShareAppshareapplast updated 27 Nov 20183595 udpShareAppshareapplast updated 27 Nov 20183596 tcpIllusion Wireless MMOGiw-mmogamelast updated 27 Nov 20183596 udpIllusion Wireless MMOGiw-mmogamelast updated 27 Nov 20183597 tcpA14 (AN-to-SC/MM)a14last updated 27 Nov 20183597 udpA14 (AN-to-SC/MM)a14last updated 27 Nov 20183598 tcpA15 (AN-to-AN)a15last updated 27 Nov 20183598 udpA15 (AN-to-AN)a15last updated 27 Nov 20183599 tcpQuasar Accounting Serverquasar-serverlast updated 27 Nov 20183599 udpQuasar Accounting Serverquasar-serverlast updated 27 Nov 20183600 tcptext relay-answertrap-daemonlast updated 27 Nov 20183600 udptext relay-answertrap-daemonlast updated 27 Nov 20183601 tcpVisinet Guivisinet-guilast updated 27 Nov 20183601 udpVisinet Guivisinet-guilast updated 27 Nov 20183602 tcpInfiniSwitch Mgr Clientinfiniswitchcllast updated 27 Nov 20183602 udpInfiniSwitch Mgr Clientinfiniswitchcllast updated 27 Nov 20183603 tcpIntegrated Rcvr Controlint-rcv-cntrllast updated 27 Nov 20183603 udpIntegrated Rcvr Controlint-rcv-cntrllast updated 27 Nov 20183604 tcpBMC JMX Portbmc-jmx-portlast updated 27 Nov 20183604 udpBMC JMX Portbmc-jmx-portlast updated 27 Nov 20183605 tcpComCam IO Portcomcam-iolast updated 27 Nov 20183605 udpComCam IO Portcomcam-iolast updated 27 Nov 20183606 tcpSplitlock Serversplitlocklast updated 27 Nov 20183606 udpSplitlock Serversplitlocklast updated 27 Nov 20183607 tcpPrecise I3precise-i3last updated 27 Nov 20183607 udpPrecise I3precise-i3last updated 27 Nov 20183608 tcpTrendchip control protocoltrendchip-dcplast updated 27 Nov 20183608 udpTrendchip control protocoltrendchip-dcplast updated 27 Nov 20183609 tcpCPDI PIDAS Connection Moncpdi-pidas-cmlast updated 27 Nov 20183609 udpCPDI PIDAS Connection Moncpdi-pidas-cmlast updated 27 Nov 20183610 tcpECHONETechonetlast updated 27 Nov 20183610 udpECHONETechonetlast updated 27 Nov 20183611 tcpSix Degrees Portsix-degreeslast updated 27 Nov 20183611 udpSix Degrees Portsix-degreeslast updated 27 Nov 20183612 tcpHP Data Protectorhp-dataprotectlast updated 27 Nov 20183612 udpHP Data Protectorhp-dataprotectlast updated 27 Nov 20183613 tcpAlaris Device Discoveryalaris-disclast updated 27 Nov 20183613 udpAlaris Device Discoveryalaris-disclast updated 27 Nov 20183614 tcpSatchwell Sigmasigma-portlast updated 27 Nov 20183614 udpSatchwell Sigmasigma-portlast updated 27 Nov 20183615 tcpStart Messaging Networkstart-networklast updated 27 Nov 20183615 udpStart Messaging Networkstart-networklast updated 27 Nov 20183616 tcpcd3o Control Protocolcd3o-protocollast updated 27 Nov 20183616 udpcd3o Control Protocolcd3o-protocollast updated 27 Nov 20183617 tcpATI SHARP Logic Enginesharp-serverlast updated 27 Nov 20183617 udpATI SHARP Logic Enginesharp-serverlast updated 27 Nov 20183618 tcpAAIR-Network 1aairnet-1last updated 27 Nov 20183618 udpAAIR-Network 1aairnet-1last updated 27 Nov 20183619 tcpAAIR-Network 2aairnet-2last updated 27 Nov 20183619 udpAAIR-Network 2aairnet-2last updated 27 Nov 20183620 tcpEPSON Projector Control Portep-pcplast updated 27 Nov 20183620 udpEPSON Projector Control Portep-pcplast updated 27 Nov 20183621 tcpEPSON Network Screen Portep-nsplast updated 27 Nov 20183621 udpEPSON Network Screen Portep-nsplast updated 27 Nov 20183622 tcpFF LAN Redundancy Portff-lr-portlast updated 27 Nov 20183622 udpFF LAN Redundancy Portff-lr-portlast updated 27 Nov 20183623 tcpHAIPIS Dynamic Discoveryhaipe-discoverlast updated 27 Nov 20183623 udpHAIPIS Dynamic Discoveryhaipe-discoverlast updated 27 Nov 20183624 tcpDistributed Upgrade Portdist-upgradelast updated 27 Nov 20183624 udpDistributed Upgrade Portdist-upgradelast updated 27 Nov 20183625 tcpVolleyvolleylast updated 27 Nov 20183625 udpVolleyvolleylast updated 27 Nov 20183626 tcpbvControl Daemonbvcdaemon-portlast updated 27 Nov 20183626 udpbvControl Daemonbvcdaemon-portlast updated 27 Nov 20183627 tcpJam Server Portjamserverportlast updated 27 Nov 20183627 udpJam Server Portjamserverportlast updated 27 Nov 20183628 tcpEPT Machine Interfaceept-machinelast updated 27 Nov 20183628 udpEPT Machine Interfaceept-machinelast updated 27 Nov 20183629 tcpESC/VP.netescvpnetlast updated 27 Nov 20183629 udpESC/VP.netescvpnetlast updated 27 Nov 20183630 tcpC&S Remote Database Portcs-remote-dblast updated 27 Nov 20183630 udpC&S Remote Database Portcs-remote-dblast updated 27 Nov 20183631 tcpC&S Web Services Portcs-serviceslast updated 27 Nov 20183631 udpC&S Web Services Portcs-serviceslast updated 27 Nov 20183632 tcpdistributed compilerdistcclast updated 27 Nov 20183632 udpdistributed compilerdistcclast updated 27 Nov 20183633 tcpWyrnix AIS portwacplast updated 27 Nov 20183633 udpWyrnix AIS portwacplast updated 27 Nov 20183634 tcphNTSP Library Managerhlibmgrlast updated 27 Nov 20183634 udphNTSP Library Managerhlibmgrlast updated 27 Nov 20183635 tcpSimple Distributed Objectssdolast updated 27 Nov 20183635 udpSimple Distributed Objectssdolast updated 27 Nov 20183636 tcpSerVistaITSMservistaitsmlast updated 27 Nov 20183636 udpSerVistaITSMservistaitsmlast updated 27 Nov 20183637 tcpCustomer Service Portscservplast updated 27 Nov 20183637 udpCustomer Service Portscservplast updated 27 Nov 20183638 tcpEHP Backup Protocolehp-backuplast updated 27 Nov 20183638 udpEHP Backup Protocolehp-backuplast updated 27 Nov 20183639 tcpExtensible Automationxap-halast updated 27 Nov 20183639 udpExtensible Automationxap-halast updated 27 Nov 20183640 tcpNetplay Port 1netplay-port1last updated 27 Nov 20183640 udpNetplay Port 1netplay-port1last updated 27 Nov 20183641 tcpNetplay Port 2netplay-port2last updated 27 Nov 20183641 udpNetplay Port 2netplay-port2last updated 27 Nov 20183642 tcpJuxml Replication portjuxml-portlast updated 27 Nov 20183642 udpJuxml Replication portjuxml-portlast updated 27 Nov 20183643 tcpAudioJuggleraudiojugglerlast updated 27 Nov 20183643 udpAudioJuggleraudiojugglerlast updated 27 Nov 20183644 tcpssowatchssowatchlast updated 27 Nov 20183644 udpssowatchssowatchlast updated 27 Nov 20183645 tcpCyccyclast updated 27 Nov 20183645 udpCyccyclast updated 27 Nov 20183646 tcpXSS Server Portxss-srv-portlast updated 27 Nov 20183646 udpXSS Server Portxss-srv-portlast updated 27 Nov 20183647 tcpSplitlock Gatewaysplitlock-gwlast updated 27 Nov 20183647 udpSplitlock Gatewaysplitlock-gwlast updated 27 Nov 20183648 tcpFujitsu Cooperation Portfjcplast updated 27 Nov 20183648 udpFujitsu Cooperation Portfjcplast updated 27 Nov 20183649 tcpNishioka Miyuki Msg Protocolnmmplast updated 27 Nov 20183649 udpNishioka Miyuki Msg Protocolnmmplast updated 27 Nov 20183650 tcpPRISMIQ VOD plug-inprismiq-pluginlast updated 27 Nov 20183650 udpPRISMIQ VOD plug-inprismiq-pluginlast updated 27 Nov 20183651 tcpXRPC Registryxrpc-registrylast updated 27 Nov 20183651 udpXRPC Registryxrpc-registrylast updated 27 Nov 20183652 tcpVxCR NBU Default Portvxcrnbuportlast updated 27 Nov 20183652 udpVxCR NBU Default Portvxcrnbuportlast updated 27 Nov 20183653 tcpTunnel Setup Protocoltsplast updated 27 Nov 20183653 udpTunnel Setup Protocoltsplast updated 27 Nov 20183654 tcpVAP RealTime Messengervaprtmlast updated 27 Nov 20183654 udpVAP RealTime Messengervaprtmlast updated 27 Nov 20183655 tcpActiveBatch Exec Agentabatemgrlast updated 27 Nov 20183655 udpActiveBatch Exec Agentabatemgrlast updated 27 Nov 20183656 tcpActiveBatch Job Schedulerabatjsslast updated 27 Nov 20183656 udpActiveBatch Job Schedulerabatjsslast updated 27 Nov 20183657 tcpImmediaNet Beaconimmedianet-bcnlast updated 27 Nov 20183657 udpImmediaNet Beaconimmedianet-bcnlast updated 27 Nov 20183658 tcpPlayStation AMS (Secure)ps-amslast updated 27 Nov 20183658 udpPlayStation AMS (Secure)ps-amslast updated 27 Nov 20183659 tcpApple SASLapple-sasllast updated 27 Nov 20183659 udpApple SASLapple-sasllast updated 27 Nov 20183660 tcpIBM Tivoli Directory Service using SSLcan-nds-ssllast updated 27 Nov 20183660 udpIBM Tivoli Directory Service using SSLcan-nds-ssllast updated 27 Nov 20183661 tcpIBM Tivoli Directory Service using SSLcan-ferret-ssllast updated 27 Nov 20183661 udpIBM Tivoli Directory Service using SSLcan-ferret-ssllast updated 27 Nov 20183662 tcppserverpserverlast updated 27 Nov 20183662 udppserverpserverlast updated 27 Nov 20183663 tcpDIRECWAY Tunnel Protocoldtplast updated 27 Nov 20183663 udpDIRECWAY Tunnel Protocoldtplast updated 27 Nov 20183664 tcpUPS Engine Portups-enginelast updated 27 Nov 20183664 udpUPS Engine Portups-enginelast updated 27 Nov 20183665 tcpEnterprise Engine Portent-enginelast updated 27 Nov 20183665 udpEnterprise Engine Portent-enginelast updated 27 Nov 20183666 tcpIBM eServer PAPeserver-paplast updated 27 Nov 20183666 udpIBM EServer PAPeserver-paplast updated 27 Nov 20183667 tcpIBM Information Exchangeinfoexchlast updated 27 Nov 20183667 udpIBM Information Exchangeinfoexchlast updated 27 Nov 20183668 tcpDell Remote Managementdell-rm-portlast updated 27 Nov 20183668 udpDell Remote Managementdell-rm-portlast updated 27 Nov 20183669 tcpCA SAN Switch Managementcasanswmgmtlast updated 27 Nov 20183669 udpCA SAN Switch Managementcasanswmgmtlast updated 27 Nov 20183670 tcpSMILE TCP/UDP Interfacesmilelast updated 27 Nov 20183670 udpSMILE TCP/UDP Interfacesmilelast updated 27 Nov 20183671 tcpe Field Control (EIBnet)efcplast updated 27 Nov 20183671 udpe Field Control (EIBnet)efcplast updated 27 Nov 20183672 tcpLispWorks ORBlispworks-orblast updated 27 Nov 20183672 udpLispWorks ORBlispworks-orblast updated 27 Nov 20183673 tcpOpenview Media Vault GUImediavault-guilast updated 27 Nov 20183673 udpOpenview Media Vault GUImediavault-guilast updated 27 Nov 20183674 tcpWinINSTALL IPC Portwininstall-ipclast updated 27 Nov 20183674 udpWinINSTALL IPC Portwininstall-ipclast updated 27 Nov 20183675 tcpCallTrax Data Portcalltraxlast updated 27 Nov 20183675 udpCallTrax Data Portcalltraxlast updated 27 Nov 20183676 tcpVisualAge Pacbase serverva-pacbaselast updated 27 Nov 20183676 udpVisualAge Pacbase serverva-pacbaselast updated 27 Nov 20183677 tcpRoverLog IPCroverloglast updated 27 Nov 20183677 udpRoverLog IPCroverloglast updated 27 Nov 20183678 tcpDataGuardianLTipr-dgltlast updated 27 Nov 20183678 udpDataGuardianLTipr-dgltlast updated 27 Nov 20183679 tcpNewton DockEscale (Newton Dock)last updated 27 Nov 20183679 udpNewton DockEscale (Newton Dock)last updated 27 Nov 20183680 tcpNPDS Trackernpds-trackerlast updated 27 Nov 20183680 udpNPDS Trackernpds-trackerlast updated 27 Nov 20183681 tcpBTS X73 Portbts-x73last updated 27 Nov 20183681 udpBTS X73 Portbts-x73last updated 27 Nov 20183682 tcpEMC SmartPackets-MAPIcas-mapilast updated 27 Nov 20183682 udpEMC SmartPackets-MAPIcas-mapilast updated 27 Nov 20183683 tcpBMC EDV/EAbmc-ealast updated 27 Nov 20183683 udpBMC EDV/EAbmc-ealast updated 27 Nov 20183684 tcpFAXstfXfaxstfx-portlast updated 27 Nov 20183684 udpFAXstfXfaxstfx-portlast updated 27 Nov 20183685 tcpDS Expert Agentdsx-agentlast updated 27 Nov 20183685 udpDS Expert Agentdsx-agentlast updated 27 Nov 20183686 tcpTrivial Network Managementtnmpv2last updated 27 Nov 20183686 udpTrivial Network Managementtnmpv2last updated 27 Nov 20183687 tcpsimple-pushsimple-pushlast updated 27 Nov 20183687 udpsimple-pushsimple-pushlast updated 27 Nov 20183688 tcpsimple-push Securesimple-push-slast updated 27 Nov 20183688 udpsimple-push Securesimple-push-slast updated 27 Nov 20183689 tcpDigital Audio Access Protocol (iTunes)daaplast updated 27 Nov 20183689 udpDigital Audio Access Protocol (iTunes)daaplast updated 27 Nov 20183690 tcpSubversionsvnlast updated 27 Nov 20183690 udpSubversionsvnlast updated 27 Nov 20183691 tcpMagaya Network Portmagaya-networklast updated 27 Nov 20183691 udpMagaya Network Portmagaya-networklast updated 27 Nov 20183692 tcpBrimstone IntelSyncintelsynclast updated 27 Nov 20183692 udpBrimstone IntelSyncintelsynclast updated 27 Nov 20183693 tcpEmergency Automatic Structure Lockdown Systemeasllast updated 27 Nov 20183693 udpReservedN/Alast updated 27 Nov 20183694 UnassignedN/Alast updated 27 Nov 20183695 tcpBMC Data Collectionbmc-data-colllast updated 27 Nov 20183695 udpBMC Data Collectionbmc-data-colllast updated 27 Nov 20183696 tcpTelnet Com Port Controltelnetcpcdlast updated 27 Nov 20183696 udpTelnet Com Port Controltelnetcpcdlast updated 27 Nov 20183697 tcpNavisWorks License Systemnw-licenselast updated 27 Nov 20183697 udpNavisWorks Licnese Systemnw-licenselast updated 27 Nov 20183698 tcpSAGECTLPANELsagectlpanellast updated 27 Nov 20183698 udpSAGECTLPANELsagectlpanellast updated 27 Nov 20183699 tcpInternet Call Waitingkpn-icwlast updated 27 Nov 20183699 udpInternet Call Waitingkpn-icwlast updated 27 Nov 20183700 tcpLRS NetPagelrs-paginglast updated 27 Nov 20183700 udpLRS NetPagelrs-paginglast updated 27 Nov 20183701 tcpNetCeleranetceleralast updated 27 Nov 20183701 udpNetCeleranetceleralast updated 27 Nov 20183702 tcpWeb Service Discoveryws-discoverylast updated 27 Nov 20183702 udpWeb Service Discoveryws-discoverylast updated 27 Nov 20183703 tcpAdobe Server 3adobeserver-3last updated 27 Nov 20183703 udpAdobe Server 3adobeserver-3last updated 27 Nov 20183704 tcpAdobe Server 4adobeserver-4last updated 27 Nov 20183704 udpAdobe Server 4adobeserver-4last updated 27 Nov 20183705 tcpAdobe Server 5adobeserver-5last updated 27 Nov 20183705 udpAdobe Server 5adobeserver-5last updated 27 Nov 20183706 tcpReal-Time Event Portrt-eventlast updated 27 Nov 20183706 udpReal-Time Event Portrt-eventlast updated 27 Nov 20183707 tcpReal-Time Event Secure Portrt-event-slast updated 27 Nov 20183707 udpReal-Time Event Secure Portrt-event-slast updated 27 Nov 20183708 tcpSun App Svr - Namingsun-as-iiopslast updated 27 Nov 20183708 udpSun App Svr - Namingsun-as-iiopslast updated 27 Nov 20183709 tcpCA-IDMS Serverca-idmslast updated 27 Nov 20183709 udpCA-IDMS Serverca-idmslast updated 27 Nov 20183710 tcpPortGate Authenticationportgate-authlast updated 27 Nov 20183710 udpPortGate Authenticationportgate-authlast updated 27 Nov 20183711 tcpEBD Server 2edb-server2last updated 27 Nov 20183711 udpEBD Server 2edb-server2last updated 27 Nov 20183712 tcpSentinel Enterprisesentinel-entlast updated 27 Nov 20183712 udpSentinel Enterprisesentinel-entlast updated 27 Nov 20183713 tcpTFTP over TLStftpslast updated 27 Nov 20183713 udpTFTP over TLStftpslast updated 27 Nov 20183714 tcpDELOS Direct Messagingdelos-dmslast updated 27 Nov 20183714 udpDELOS Direct Messagingdelos-dmslast updated 27 Nov 20183715 tcpAnoto Rendezvous Portanoto-rendezvlast updated 27 Nov 20183715 udpAnoto Rendezvous Portanoto-rendezvlast updated 27 Nov 20183716 tcpWV CSP SMS CIR Channelwv-csp-sms-cirlast updated 27 Nov 20183716 udpWV CSP SMS CIR Channelwv-csp-sms-cirlast updated 27 Nov 20183717 tcpWV CSP UDP/IP CIR Channelwv-csp-udp-cirlast updated 27 Nov 20183717 udpWV CSP UDP/IP CIR Channelwv-csp-udp-cirlast updated 27 Nov 20183718 tcpOPUS Server Portopus-serviceslast updated 27 Nov 20183718 udpOPUS Server Portopus-serviceslast updated 27 Nov 20183719 tcpiTel Server Portitelserverportlast updated 27 Nov 20183719 udpiTel Server Portitelserverportlast updated 27 Nov 20183720 tcpUF Astro. Instr. Servicesufastro-instrlast updated 27 Nov 20183720 udpUF Astro. Instr. Servicesufastro-instrlast updated 27 Nov 20183721 tcpXsyncxsynclast updated 27 Nov 20183721 udpXsyncxsynclast updated 27 Nov 20183722 tcpXserve RAIDxserveraidlast updated 27 Nov 20183722 udpXserve RAIDxserveraidlast updated 27 Nov 20183723 tcpSychron Service Daemonsychrondlast updated 27 Nov 20183723 udpSychron Service Daemonsychrondlast updated 27 Nov 20183724 tcpWorld of Warcraftblizwowlast updated 27 Nov 20183724 udpWorld of Warcraftblizwowlast updated 27 Nov 20183725 tcpNetia NA-ER Portna-er-tiplast updated 27 Nov 20183725 udpNetia NA-ER Portna-er-tiplast updated 27 Nov 20183726 tcpXyratex Array Managerarray-managerlast updated 27 Nov 20183726 udpXyartex Array Managerarray-managerlast updated 27 Nov 20183727 tcpEricsson Mobile Data Unite-mdulast updated 27 Nov 20183727 udpEricsson Mobile Data Unite-mdulast updated 27 Nov 20183728 tcpEricsson Web on Aire-woalast updated 27 Nov 20183728 udpEricsson Web on Aire-woalast updated 27 Nov 20183729 tcpFireking Audit Portfksp-auditlast updated 27 Nov 20183729 udpFireking Audit Portfksp-auditlast updated 27 Nov 20183730 tcpClient Controlclient-ctrllast updated 27 Nov 20183730 udpClient Controlclient-ctrllast updated 27 Nov 20183731 tcpService Managersmaplast updated 27 Nov 20183731 udpService Managersmaplast updated 27 Nov 20183732 tcpMobile Wnnm-wnnlast updated 27 Nov 20183732 udpMobile Wnnm-wnnlast updated 27 Nov 20183733 tcpMultipuesto Msg Portmultip-msglast updated 27 Nov 20183733 udpMultipuesto Msg Portmultip-msglast updated 27 Nov 20183734 tcpSynel Data Collection Portsynel-datalast updated 27 Nov 20183734 udpSynel Data Collection Portsynel-datalast updated 27 Nov 20183735 tcpPassword Distributionpwdislast updated 27 Nov 20183735 udpPassword Distributionpwdislast updated 27 Nov 20183736 tcpRealSpace RMIrs-rmilast updated 27 Nov 20183736 udpRealSpace RMIrs-rmilast updated 27 Nov 20183737 tcpXPanel Daemonxpanellast updated 27 Nov 20183737 udpReservedN/Alast updated 27 Nov 20183738 tcpversaTalk Server Portversatalklast updated 27 Nov 20183738 udpversaTalk Server Portversatalklast updated 27 Nov 20183739 tcpLaunchbird LicenseManagerlaunchbird-lmlast updated 27 Nov 20183739 udpLaunchbird LicenseManagerlaunchbird-lmlast updated 27 Nov 20183740 tcpHeartbeat Protocolheartbeatlast updated 27 Nov 20183740 udpHeartbeat Protocolheartbeatlast updated 27 Nov 20183741 tcpWysDM Agentwysdmalast updated 27 Nov 20183741 udpWysDM Agentwysdmalast updated 27 Nov 20183742 tcpCST - Configuration & Service Trackercst-portlast updated 27 Nov 20183742 udpCST - Configuration & Service Trackercst-portlast updated 27 Nov 20183743 tcpIP Control Systems Ltd.ipcs-commandlast updated 27 Nov 20183743 udpIP Control Systems Ltd.ipcs-commandlast updated 27 Nov 20183744 tcpSASGsasglast updated 27 Nov 20183744 udpSASGsasglast updated 27 Nov 20183745 tcpGWRTC Call Portgw-call-portlast updated 27 Nov 20183745 udpGWRTC Call Portgw-call-portlast updated 27 Nov 20183746 tcpLXPRO.COM LinkTestlinktestlast updated 27 Nov 20183746 udpLXPRO.COM LinkTestlinktestlast updated 27 Nov 20183747 tcpLXPRO.COM LinkTest SSLlinktest-slast updated 27 Nov 20183747 udpLXPRO.COM LinkTest SSLlinktest-slast updated 27 Nov 20183748 tcpwebDatawebdatalast updated 27 Nov 20183748 udpwebDatawebdatalast updated 27 Nov 20183749 tcpCimTrakcimtraklast updated 27 Nov 20183749 udpCimTrakcimtraklast updated 27 Nov 20183750 tcpCBOS/IP ncapsalation portcbos-ip-portlast updated 27 Nov 20183750 udpCBOS/IP ncapsalatoin portcbos-ip-portlast updated 27 Nov 20183751 tcpCommLinx GPRS Cubegprs-cubelast updated 27 Nov 20183751 udpCommLinx GPRS Cubegprs-cubelast updated 27 Nov 20183752 tcpVigil-IP RemoteAgentvipremoteagentlast updated 27 Nov 20183752 udpVigil-IP RemoteAgentvipremoteagentlast updated 27 Nov 20183753 tcpNattyServer Portnattyserverlast updated 27 Nov 20183753 udpNattyServer Portnattyserverlast updated 27 Nov 20183754 tcpTimesTen Broker Porttimestenbrokerlast updated 27 Nov 20183754 udpTimesTen Broker Porttimestenbrokerlast updated 27 Nov 20183755 tcpSAS Remote Help Serversas-remote-hlplast updated 27 Nov 20183755 udpSAS Remote Help Serversas-remote-hlplast updated 27 Nov 20183756 tcpCanon CAPT Portcanon-captlast updated 27 Nov 20183756 udpCanon CAPT Portcanon-captlast updated 27 Nov 20183757 tcpGRF Server Portgrf-portlast updated 27 Nov 20183757 udpGRF Server Portgrf-portlast updated 27 Nov 20183758 tcpapw RMI registryapw-registrylast updated 27 Nov 20183758 udpapw RMI registryapw-registrylast updated 27 Nov 20183759 tcpExapt License Managerexapt-lmgrlast updated 27 Nov 20183759 udpExapt License Managerexapt-lmgrlast updated 27 Nov 20183760 tcpadTempus Clientadtempusclientlast updated 27 Nov 20183760 udpadTEmpus Clientadtempusclientlast updated 27 Nov 20183761 tcpgsakmp portgsakmplast updated 27 Nov 20183761 udpgsakmp portgsakmplast updated 27 Nov 20183762 tcpGBS SnapMail Protocolgbs-smplast updated 27 Nov 20183762 udpGBS SnapMail Protocolgbs-smplast updated 27 Nov 20183763 tcpXO Wave Control Portxo-wavelast updated 27 Nov 20183763 udpXO Wave Control Portxo-wavelast updated 27 Nov 20183764 tcpMNI Protected Routingmni-prot-routlast updated 27 Nov 20183764 udpMNI Protected Routingmni-prot-routlast updated 27 Nov 20183765 tcpRemote Traceroutertraceroutelast updated 27 Nov 20183765 udpRemote Traceroutertraceroutelast updated 27 Nov 20183766 tcpSSL e-watch sitewatch serversitewatch-slast updated 27 Nov 20183766 udpReservedN/Alast updated 27 Nov 20183767 tcpListMGR Portlistmgr-portlast updated 27 Nov 20183767 udpListMGR Portlistmgr-portlast updated 27 Nov 20183768 tcprblcheckd server daemonrblcheckdlast updated 27 Nov 20183768 udprblcheckd server daemonrblcheckdlast updated 27 Nov 20183769 tcpHAIPE Network Keyinghaipe-otnklast updated 27 Nov 20183769 udpHAIPE Network Keyinghaipe-otnklast updated 27 Nov 20183770 tcpCinderella Collaborationcindycollablast updated 27 Nov 20183770 udpCinderella Collaborationcindycollablast updated 27 Nov 20183771 tcpRTP Paging Portpaging-portlast updated 27 Nov 20183771 udpRTP Paging Portpaging-portlast updated 27 Nov 20183772 tcpChantry Tunnel Protocolctplast updated 27 Nov 20183772 udpChantry Tunnel Protocolctplast updated 27 Nov 20183773 tcpctdherculesctdherculeslast updated 27 Nov 20183773 udpctdherculesctdherculeslast updated 27 Nov 20183774 tcpZICOMzicomlast updated 27 Nov 20183774 udpZICOMzicomlast updated 27 Nov 20183775 tcpISPM Manager Portispmmgrlast updated 27 Nov 20183775 udpISPM Manager Portispmmgrlast updated 27 Nov 20183776 tcpDevice Provisioning Portdvcprov-portlast updated 27 Nov 20183776 udpDevice Provisioning Portdvcprov-portlast updated 27 Nov 20183777 tcpJibe EdgeBurstjibe-eblast updated 27 Nov 20183777 udpJibe EdgeBurstjibe-eblast updated 27 Nov 20183778 tcpCutler-Hammer IT Portc-h-it-portlast updated 27 Nov 20183778 udpCutler-Hammer IT Portc-h-it-portlast updated 27 Nov 20183779 tcpCognima Replicationcognimalast updated 27 Nov 20183779 udpCognima Replicationcognimalast updated 27 Nov 20183780 tcpNuzzler Network Protocolnnplast updated 27 Nov 20183780 udpNuzzler Network Protocolnnplast updated 27 Nov 20183781 tcpABCvoice server portabcvoice-portlast updated 27 Nov 20183781 udpABCvoice server portabcvoice-portlast updated 27 Nov 20183782 tcpSecure ISO TP0 portiso-tp0slast updated 27 Nov 20183782 udpSecure ISO TP0 portiso-tp0slast updated 27 Nov 20183783 tcpImpact Mgr./PEM Gatewaybim-pemlast updated 27 Nov 20183783 udpImpact Mgr./PEM Gatewaybim-pemlast updated 27 Nov 20183784 tcpBFD Control Protocolbfd-controllast updated 27 Nov 20183784 udpBFD Control Protocolbfd-controllast updated 27 Nov 20183785 tcpBFD Echo Protocolbfd-echolast updated 27 Nov 20183785 udpBFD Echo Protocolbfd-echolast updated 27 Nov 20183786 tcpVSW Upstrigger portupstriggervswlast updated 27 Nov 20183786 udpVSW Upstrigger portupstriggervswlast updated 27 Nov 20183787 tcpFintrxfintrxlast updated 27 Nov 20183787 udpFintrxfintrxlast updated 27 Nov 20183788 tcpSPACEWAY Routing portisrp-portlast updated 27 Nov 20183788 udpSPACEWAY Routing portisrp-portlast updated 27 Nov 20183789 tcpRemoteDeploy Administration Port [July 2003]remotedeploylast updated 27 Nov 20183789 udpRemoteDeploy Administration Port [July 2003]remotedeploylast updated 27 Nov 20183790 tcpQuickBooks RDSquickbooksrdslast updated 27 Nov 20183790 udpQuickBooks RDSquickbooksrdslast updated 27 Nov 20183791 tcpTV NetworkVideo Data porttvnetworkvideolast updated 27 Nov 20183791 udpTV NetworkVideo Data porttvnetworkvideolast updated 27 Nov 20183792 tcpe-Watch Corporation SiteWatchsitewatchlast updated 27 Nov 20183792 udpe-Watch Corporation SiteWatchsitewatchlast updated 27 Nov 20183793 tcpDataCore Softwaredcsoftwarelast updated 27 Nov 20183793 udpDataCore Softwaredcsoftwarelast updated 27 Nov 20183794 tcpJAUS Robotsjauslast updated 27 Nov 20183794 udpJAUS Robotsjauslast updated 27 Nov 20183795 tcpmyBLAST Mekentosj portmyblastlast updated 27 Nov 20183795 udpmyBLAST Mekentosj portmyblastlast updated 27 Nov 20183796 tcpSpaceway Dialerspw-dialerlast updated 27 Nov 20183796 udpSpaceway Dialerspw-dialerlast updated 27 Nov 20183797 tcpidpsidpslast updated 27 Nov 20183797 udpidpsidpslast updated 27 Nov 20183798 tcpMinilockminilocklast updated 27 Nov 20183798 udpMinilockminilocklast updated 27 Nov 20183799 tcpRADIUS Dynamic Authorizationradius-dynauthlast updated 27 Nov 20183799 udpRADIUS Dynamic Authorizationradius-dynauthlast updated 27 Nov 20183800 tcpPrint Services Interfacepwgpsilast updated 27 Nov 20183800 udpPrint Services Interfacepwgpsilast updated 27 Nov 20183801 tcpibm manager serviceibm-mgrlast updated 27 Nov 20183801 udpibm manager serviceibm-mgrlast updated 27 Nov 20183802 tcpVHDvhdlast updated 27 Nov 20183802 udpVHDvhdlast updated 27 Nov 20183803 tcpSoniqSyncsoniqsynclast updated 27 Nov 20183803 udpSoniqSyncsoniqsynclast updated 27 Nov 20183804 tcpHarman IQNet Portiqnet-portlast updated 27 Nov 20183804 udpHarman IQNet Portiqnet-portlast updated 27 Nov 20183805 tcpThorGuard Server Porttcpdataserverlast updated 27 Nov 20183805 udpThorGuard Server Porttcpdataserverlast updated 27 Nov 20183806 tcpRemote System Managerwsmlblast updated 27 Nov 20183806 udpRemote System Managerwsmlblast updated 27 Nov 20183807 tcpSpuGNA Communication Portspugnalast updated 27 Nov 20183807 udpSpuGNA Communication Portspugnalast updated 27 Nov 20183808 tcpSun App Svr-IIOPClntAuthsun-as-iiops-calast updated 27 Nov 20183808 udpSun App Svr-IIOPClntAuthsun-as-iiops-calast updated 27 Nov 20183809 tcpJava Desktop System Configuration Agentapocdlast updated 27 Nov 20183809 udpJava Desktop System Configuration Agentapocdlast updated 27 Nov 20183810 tcpWLAN AS serverwlanauthlast updated 27 Nov 20183810 udpWLAN AS serverwlanauthlast updated 27 Nov 20183811 tcpAMPamplast updated 27 Nov 20183811 udpAMPamplast updated 27 Nov 20183812 tcpnetO WOL Serverneto-wol-serverlast updated 27 Nov 20183812 udpnetO WOL Serverneto-wol-serverlast updated 27 Nov 20183813 tcpRhapsody Interface Protocolrap-iplast updated 27 Nov 20183813 udpRhapsody Interface Protocolrap-iplast updated 27 Nov 20183814 tcpnetO DCSneto-dcslast updated 27 Nov 20183814 udpnetO DCSneto-dcslast updated 27 Nov 20183815 tcpLANsurveyor XMLlansurveyorxmllast updated 27 Nov 20183815 udpLANsurveyor XMLlansurveyorxmllast updated 27 Nov 20183816 tcpSun Local Patch Serversunlps-httplast updated 27 Nov 20183816 udpSun Local Patch Serversunlps-httplast updated 27 Nov 20183817 tcpYosemite Tech Tapewaretapewarelast updated 27 Nov 20183817 udpYosemite Tech Tapewaretapewarelast updated 27 Nov 20183818 tcpCrinis Heartbeatcrinis-hblast updated 27 Nov 20183818 udpCrinis Heartbeatcrinis-hblast updated 27 Nov 20183819 tcpEPL Sequ Layer Protocolepl-slplast updated 27 Nov 20183819 udpEPL Sequ Layer Protocolepl-slplast updated 27 Nov 20183820 tcpSiemens AuD SCPscplast updated 27 Nov 20183820 udpSiemens AuD SCPscplast updated 27 Nov 20183821 tcpATSC PMCP Standardpmcplast updated 27 Nov 20183821 udpATSC PMCP Standardpmcplast updated 27 Nov 20183822 tcpCompute Pool Discoveryacp-discoverylast updated 27 Nov 20183822 udpCompute Pool Discoveryacp-discoverylast updated 27 Nov 20183823 tcpCompute Pool Conduitacp-conduitlast updated 27 Nov 20183823 udpCompute Pool Conduitacp-conduitlast updated 27 Nov 20183824 tcpCompute Pool Policyacp-policylast updated 27 Nov 20183824 udpCompute Pool Policyacp-policylast updated 27 Nov 20183825 tcpAntera FlowFusion Process Simulationffserverlast updated 27 Nov 20183825 udpAntera FlowFusion Process Simulationffserverlast updated 27 Nov 20183826 tcpWarMUX game serverwarmuxlast updated 27 Nov 20183826 udpWarMUX game serverwarmuxlast updated 27 Nov 20183827 tcpNetadmin Systems MPI servicenetmpilast updated 27 Nov 20183827 udpNetadmin Systems MPI servicenetmpilast updated 27 Nov 20183828 tcpNetadmin Systems Event Handlernetehlast updated 27 Nov 20183828 udpNetadmin Systems Event Handlernetehlast updated 27 Nov 20183829 tcpNetadmin Systems Event Handler Externalneteh-extlast updated 27 Nov 20183829 udpNetadmin Systems Event Handler Externalneteh-extlast updated 27 Nov 20183830 tcpCerner System Management Agentcernsysmgmtagtlast updated 27 Nov 20183830 udpCerner System Management Agentcernsysmgmtagtlast updated 27 Nov 20183831 tcpDocsvault Application Servicedvappslast updated 27 Nov 20183831 udpDocsvault Application Servicedvappslast updated 27 Nov 20183832 tcpxxNETserverxxnetserverlast updated 27 Nov 20183832 udpxxNETserverxxnetserverlast updated 27 Nov 20183833 tcpAIPN LS Authenticationaipn-authlast updated 27 Nov 20183833 udpAIPN LS Authenticationaipn-authlast updated 27 Nov 20183834 tcpSpectar Data Stream Servicespectardatalast updated 27 Nov 20183834 udpSpectar Data Stream Servicespectardatalast updated 27 Nov 20183835 tcpSpectar Database Rights Servicespectardblast updated 27 Nov 20183835 udpSpectar Database Rights Servicespectardblast updated 27 Nov 20183836 tcpMARKEM NEXTGEN DCPmarkem-dcplast updated 27 Nov 20183836 udpMARKEM NEXTGEN DCPmarkem-dcplast updated 27 Nov 20183837 tcpMARKEM Auto-Discoverymkm-discoverylast updated 27 Nov 20183837 udpMARKEM Auto-Discoverymkm-discoverylast updated 27 Nov 20183838 tcpScito Object Serversoslast updated 27 Nov 20183838 udpScito Object Serversoslast updated 27 Nov 20183839 tcpAMX Resource Management Suiteamx-rmslast updated 27 Nov 20183839 udpAMX Resource Management Suiteamx-rmslast updated 27 Nov 20183840 tcpwww.FlirtMitMir.deflirtmitmirlast updated 27 Nov 20183840 udpwww.FlirtMitMir.deflirtmitmirlast updated 27 Nov 20183841 tcpShipRush Database Servershiprush-db-svrlast updated 27 Nov 20183841 udpReservedN/Alast updated 27 Nov 20183842 tcpNHCI status portnhcilast updated 27 Nov 20183842 udpNHCI status portnhcilast updated 27 Nov 20183843 tcpQuest Common Agentquest-agentlast updated 27 Nov 20183843 udpQuest Common Agentquest-agentlast updated 27 Nov 20183844 tcpRNMrnmlast updated 27 Nov 20183844 udpRNMrnmlast updated 27 Nov 20183845 tcpV-ONE Single Port Proxyv-one-spplast updated 27 Nov 20183845 udpV-ONE Single Port Proxyv-one-spplast updated 27 Nov 20183846 tcpAstare Network PCPan-pcplast updated 27 Nov 20183846 udpAstare Network PCPan-pcplast updated 27 Nov 20183847 tcpMS Firewall Controlmsfw-controllast updated 27 Nov 20183847 udpMS Firewall Controlmsfw-controllast updated 27 Nov 20183848 tcpIT Environmental Monitoritemlast updated 27 Nov 20183848 udpIT Environmental Monitoritemlast updated 27 Nov 20183849 tcpSPACEWAY DNS Preloadspw-dnspreloadlast updated 27 Nov 20183849 udpSPACEWAY DNS Prelaodspw-dnspreloadlast updated 27 Nov 20183850 tcpQTMS Bootstrap Protocolqtms-bootstraplast updated 27 Nov 20183850 udpQTMS Bootstrap Protocolqtms-bootstraplast updated 27 Nov 20183851 tcpSpectraTalk Portspectraportlast updated 27 Nov 20183851 udpSpectraTalk Portspectraportlast updated 27 Nov 20183852 tcpSSE App Configurationsse-app-configlast updated 27 Nov 20183852 udpSSE App Configurationsse-app-configlast updated 27 Nov 20183853 tcpSONY scanning protocolsscanlast updated 27 Nov 20183853 udpSONY scanning protocolsscanlast updated 27 Nov 20183854 tcpStryker Comm Portstryker-comlast updated 27 Nov 20183854 udpStryker Comm Portstryker-comlast updated 27 Nov 20183855 tcpOpenTRACopentraclast updated 27 Nov 20183855 udpOpenTRACopentraclast updated 27 Nov 20183856 tcpINFORMERinformerlast updated 27 Nov 20183856 udpINFORMERinformerlast updated 27 Nov 20183857 tcpTrap Porttrap-portlast updated 27 Nov 20183857 udpTrap Porttrap-portlast updated 27 Nov 20183858 tcpTrap Port MOMtrap-port-momlast updated 27 Nov 20183858 udpTrap Port MOMtrap-port-momlast updated 27 Nov 20183859 tcpNavini Portnav-portlast updated 27 Nov 20183859 udpNavini Portnav-portlast updated 27 Nov 20183860 tcpServer/Application State Protocol (SASP)sasplast updated 27 Nov 20183860 udpServer/Application State Protocol (SASP)sasplast updated 27 Nov 20183861 tcpwinShadow Host Discoverywinshadow-hdlast updated 27 Nov 20183861 udpwinShadow Host Discoverywinshadow-hdlast updated 27 Nov 20183862 tcpGIGA-POCKETgiga-pocketlast updated 27 Nov 20183862 udpGIGA-POCKETgiga-pocketlast updated 27 Nov 20183863 tcpasap tcp portasap-tcplast updated 27 Nov 20183863 udpasap udp portasap-udplast updated 27 Nov 20183863 sctpasap sctpasap-sctplast updated 27 Nov 20183864 tcpasap/tls tcp portasap-tcp-tlslast updated 27 Nov 20183864 udpReservedN/Alast updated 27 Nov 20183864 sctpasap-sctp/tlsasap-sctp-tlslast updated 27 Nov 20183865 tcpxpl automation protocolxpllast updated 27 Nov 20183865 udpxpl automation protocolxpllast updated 27 Nov 20183866 tcpSun SDViz DZDAEMON Portdzdaemonlast updated 27 Nov 20183866 udpSun SDViz DZDAEMON Portdzdaemonlast updated 27 Nov 20183867 tcpSun SDViz DZOGLSERVER Portdzoglserverlast updated 27 Nov 20183867 udpSun SDViz DZOGLSERVER Portdzoglserverlast updated 27 Nov 20183868 tcpDIAMETERdiameterlast updated 27 Nov 20183868 udpReservedN/Alast updated 27 Nov 20183868 sctpDIAMETERdiameterlast updated 27 Nov 20183869 tcphp OVSAM MgmtServer Discoovsam-mgmtlast updated 27 Nov 20183869 udphp OVSAM MgmtServer Discoovsam-mgmtlast updated 27 Nov 20183870 tcphp OVSAM HostAgent Discoovsam-d-agentlast updated 27 Nov 20183870 udphp OVSAM HostAgent Discoovsam-d-agentlast updated 27 Nov 20183871 tcpAvocent DS Authorizationavocent-adsaplast updated 27 Nov 20183871 udpAvocent DS Authorizationavocent-adsaplast updated 27 Nov 20183872 tcpOEM Agentoem-agentlast updated 27 Nov 20183872 udpOEM Agentoem-agentlast updated 27 Nov 20183873 tcpfagordncfagordnclast updated 27 Nov 20183873 udpfagordncfagordnclast updated 27 Nov 20183874 tcpSixXS Configurationsixxsconfiglast updated 27 Nov 20183874 udpSixXS Configurationsixxsconfiglast updated 27 Nov 20183875 tcpPNBSCADApnbscadalast updated 27 Nov 20183875 udpPNBSCADApnbscadalast updated 27 Nov 20183876 tcpDirectoryLockdown Agent IANA assigned this well-formed service name as a replacement for "dl_agent".dl-agentlast updated 27 Nov 20183876 tcp (dl_agent)DirectoryLockdown Agentdl_agentlast updated 27 Nov 20183876 udpDirectoryLockdown Agent IANA assigned this well-formed service name as a replacement for "dl_agent".dl-agentlast updated 27 Nov 20183876 udp (dl_agent)DirectoryLockdown Agentdl_agentlast updated 27 Nov 20183877 tcpXMPCR Interface Portxmpcr-interfacelast updated 27 Nov 20183877 udpXMPCR Interface Portxmpcr-interfacelast updated 27 Nov 20183878 tcpFotoG CAD interfacefotogcadlast updated 27 Nov 20183878 udpFotoG CAD interfacefotogcadlast updated 27 Nov 20183879 tcpappss license managerappss-lmlast updated 27 Nov 20183879 udpappss license managerappss-lmlast updated 27 Nov 20183880 tcpIGRSigrslast updated 27 Nov 20183880 udpIGRSigrslast updated 27 Nov 20183881 tcpData Acquisition and Controlidaclast updated 27 Nov 20183881 udpData Acquisition and Controlidaclast updated 27 Nov 20183882 tcpDTS Service Portmsdts1last updated 27 Nov 20183882 udpDTS Service Portmsdts1last updated 27 Nov 20183883 tcpVR Peripheral Networkvrpnlast updated 27 Nov 20183883 udpVR Peripheral Networkvrpnlast updated 27 Nov 20183884 tcpSofTrack Meteringsoftrack-meterlast updated 27 Nov 20183884 udpSofTrack Meteringsoftrack-meterlast updated 27 Nov 20183885 tcpTopFlow SSLtopflow-ssllast updated 27 Nov 20183885 udpTopFlow SSLtopflow-ssllast updated 27 Nov 20183886 tcpNEI management portnei-managementlast updated 27 Nov 20183886 udpNEI management portnei-managementlast updated 27 Nov 20183887 tcpCiphire Data Transportciphire-datalast updated 27 Nov 20183887 udpCiphire Data Transportciphire-datalast updated 27 Nov 20183888 tcpCiphire Servicesciphire-servlast updated 27 Nov 20183888 udpCiphire Servicesciphire-servlast updated 27 Nov 20183889 tcpD and V Tester Control Portdandv-testerlast updated 27 Nov 20183889 udpD and V Tester Control Portdandv-testerlast updated 27 Nov 20183890 tcpNiche Data Server Connectndsconnectlast updated 27 Nov 20183890 udpNiche Data Server Connectndsconnectlast updated 27 Nov 20183891 tcpOracle RTC-PM portrtc-pm-portlast updated 27 Nov 20183891 udpOracle RTC-PM portrtc-pm-portlast updated 27 Nov 20183892 tcpPCC-image-portpcc-image-portlast updated 27 Nov 20183892 udpPCC-image-portpcc-image-portlast updated 27 Nov 20183893 tcpCGI StarAPI Servercgi-starapilast updated 27 Nov 20183893 udpCGI StarAPI Servercgi-starapilast updated 27 Nov 20183894 tcpSyAM Agent Portsyam-agentlast updated 27 Nov 20183894 udpSyAM Agent Portsyam-agentlast updated 27 Nov 20183895 tcpSyAm SMC Service Portsyam-smclast updated 27 Nov 20183895 udpSyAm SMC Service Portsyam-smclast updated 27 Nov 20183896 tcpSimple Distributed Objects over TLSsdo-tlslast updated 27 Nov 20183896 udpSimple Distributed Objects over TLSsdo-tlslast updated 27 Nov 20183897 tcpSimple Distributed Objects over SSHsdo-sshlast updated 27 Nov 20183897 udpSimple Distributed Objects over SSHsdo-sshlast updated 27 Nov 20183898 tcpIAS, Inc. SmartEye NET Internet Protocolseniplast updated 27 Nov 20183898 udpIAS, Inc. SmartEye NET Internet Protocolseniplast updated 27 Nov 20183899 tcpITV Portitv-controllast updated 27 Nov 20183899 udpITV Portitv-controllast updated 27 Nov 20183900 tcpUnidata UDT OS IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 27 Nov 20183900 tcp (udt_os)Unidata UDT OSudt_oslast updated 27 Nov 20183900 udpUnidata UDT OS IANA assigned this well-formed service name as a replacement for "udt_os".udt-oslast updated 27 Nov 20183900 udp (udt_os)Unidata UDT OSudt_oslast updated 27 Nov 20183901 tcpNIM Service Handlernimshlast updated 27 Nov 20183901 udpNIM Service Handlernimshlast updated 27 Nov 20183902 tcpNIMsh Auxiliary Portnimauxlast updated 27 Nov 20183902 udpNIMsh Auxiliary Portnimauxlast updated 27 Nov 20183903 tcpCharsetMGRcharsetmgrlast updated 27 Nov 20183903 udpCharsetMGRcharsetmgrlast updated 27 Nov 20183904 tcpArnet Omnilink Portomnilink-portlast updated 27 Nov 20183904 udpArnet Omnilink Portomnilink-portlast updated 27 Nov 20183905 tcpMailbox Update (MUPDATE) protocolmupdatelast updated 27 Nov 20183905 udpMailbox Update (MUPDATE) protocolmupdatelast updated 27 Nov 20183906 tcpTopoVista elevation datatopovista-datalast updated 27 Nov 20183906 udpTopoVista elevation datatopovista-datalast updated 27 Nov 20183907 tcpImoguia Portimoguia-portlast updated 27 Nov 20183907 udpImoguia Portimoguia-portlast updated 27 Nov 20183908 tcpHP Procurve NetManagementhppronetmanlast updated 27 Nov 20183908 udpHP Procurve NetManagementhppronetmanlast updated 27 Nov 20183909 tcpSurfControl CPAsurfcontrolcpalast updated 27 Nov 20183909 udpSurfControl CPAsurfcontrolcpalast updated 27 Nov 20183910 tcpPrinter Request Portprnrequestlast updated 27 Nov 20183910 udpPrinter Request Portprnrequestlast updated 27 Nov 20183911 tcpPrinter Status Portprnstatuslast updated 27 Nov 20183911 udpPrinter Status Portprnstatuslast updated 27 Nov 20183912 tcpGlobal Maintech Starsgbmt-starslast updated 27 Nov 20183912 udpGlobal Maintech Starsgbmt-starslast updated 27 Nov 20183913 tcpListCREATOR Portlistcrt-portlast updated 27 Nov 20183913 udpListCREATOR Portlistcrt-portlast updated 27 Nov 20183914 tcpListCREATOR Port 2listcrt-port-2last updated 27 Nov 20183914 udpListCREATOR Port 2listcrt-port-2last updated 27 Nov 20183915 tcpAuto-Graphics Catalogingagcatlast updated 27 Nov 20183915 udpAuto-Graphics Catalogingagcatlast updated 27 Nov 20183916 tcpWysDM Controllerwysdmclast updated 27 Nov 20183916 udpWysDM Controllerwysdmclast updated 27 Nov 20183917 tcpAFT multiplex portaftmuxlast updated 27 Nov 20183917 udpAFT multiples portaftmuxlast updated 27 Nov 20183918 tcpPacketCableMultimediaCOPSpktcablemmcopslast updated 27 Nov 20183918 udpPacketCableMultimediaCOPSpktcablemmcopslast updated 27 Nov 20183919 tcpHyperIPhyperiplast updated 27 Nov 20183919 udpHyperIPhyperiplast updated 27 Nov 20183920 tcpExasoft IP Portexasoftport1last updated 27 Nov 20183920 udpExasoft IP Portexasoftport1last updated 27 Nov 20183921 tcpHerodotus Netherodotus-netlast updated 27 Nov 20183921 udpHerodotus Netherodotus-netlast updated 27 Nov 20183922 tcpSoronti Update Portsor-updatelast updated 27 Nov 20183922 udpSoronti Update Portsor-updatelast updated 27 Nov 20183923 tcpSymbian Service Brokersymb-sb-portlast updated 27 Nov 20183923 udpSymbian Service Brokersymb-sb-portlast updated 27 Nov 20183924 tcpMPL_GPRS_PORTmpl-gprs-portlast updated 27 Nov 20183924 udpMPL_GPRS_Portmpl-gprs-portlast updated 27 Nov 20183925 tcpZoran Media Portzmplast updated 27 Nov 20183925 udpZoran Media Portzmplast updated 27 Nov 20183926 tcpWINPortwinportlast updated 27 Nov 20183926 udpWINPortwinportlast updated 27 Nov 20183927 tcpScsTsrnatdataservicelast updated 27 Nov 20183927 udpScsTsrnatdataservicelast updated 27 Nov 20183928 tcpPXE NetBoot Managernetboot-pxelast updated 27 Nov 20183928 udpPXE NetBoot Managernetboot-pxelast updated 27 Nov 20183929 tcpAMS Portsmauth-portlast updated 27 Nov 20183929 udpAMS Portsmauth-portlast updated 27 Nov 20183930 tcpSyam Web Server Portsyam-webserverlast updated 27 Nov 20183930 udpSyam Web Server Portsyam-webserverlast updated 27 Nov 20183931 tcpMSR Plugin Portmsr-plugin-portlast updated 27 Nov 20183931 udpMSR Plugin Portmsr-plugin-portlast updated 27 Nov 20183932 tcpDynamic Site Systemdyn-sitelast updated 27 Nov 20183932 udpDynamic Site Systemdyn-sitelast updated 27 Nov 20183933 tcpPL/B App Server User Portplbserve-portlast updated 27 Nov 20183933 udpPL/B App Server User Portplbserve-portlast updated 27 Nov 20183934 tcpPL/B File Manager Portsunfm-portlast updated 27 Nov 20183934 udpPL/B File Manager Portsunfm-portlast updated 27 Nov 20183935 tcpSDP Port Mapper Protocolsdp-portmapperlast updated 27 Nov 20183935 udpSDP Port Mapper Protocolsdp-portmapperlast updated 27 Nov 20183936 tcpMailproxmailproxlast updated 27 Nov 20183936 udpMailproxmailproxlast updated 27 Nov 20183937 tcpDVB Service Discoverydvbservdsclast updated 27 Nov 20183937 udpDVB Service Discoverydvbservdsclast updated 27 Nov 20183938 tcpOracle dbControl Agent po IANA assigned this well-formed service name as a replacement for "dbcontrol_agent".dbcontrol-agentlast updated 27 Nov 20183938 tcp (dbcontrol_agent)Oracle dbControl Agent podbcontrol_agentlast updated 27 Nov 20183938 udpOracel dbControl Agent po IANA assigned this well-formed service name as a replacement for "dbcontrol_agent".dbcontrol-agentlast updated 27 Nov 20183938 udp (dbcontrol_agent)Oracel dbControl Agent podbcontrol_agentlast updated 27 Nov 20183939 tcpAnti-virus Application Management Portaamplast updated 27 Nov 20183939 udpAnti-virus Application Management Portaamplast updated 27 Nov 20183940 tcpXeCP Node Servicexecp-nodelast updated 27 Nov 20183940 udpXeCP Node Servicexecp-nodelast updated 27 Nov 20183941 tcpHome Portal Web Serverhomeportal-weblast updated 27 Nov 20183941 udpHome Portal Web Serverhomeportal-weblast updated 27 Nov 20183942 tcpsatellite distributionsrdplast updated 27 Nov 20183942 udpsatellite distributionsrdplast updated 27 Nov 20183943 tcpTetraNode Ip Gatewaytiglast updated 27 Nov 20183943 udpTetraNode Ip Gatewaytiglast updated 27 Nov 20183944 tcpS-Ops Managementsopslast updated 27 Nov 20183944 udpS-Ops Managementsopslast updated 27 Nov 20183945 tcpEMCADS Server Portemcadslast updated 27 Nov 20183945 udpEMCADS Server Portemcadslast updated 27 Nov 20183946 tcpBackupEDGE Serverbackupedgelast updated 27 Nov 20183946 udpBackupEDGE Serverbackupedgelast updated 27 Nov 20183947 tcpConnect and Control Protocol for Consumer, Commercial, and Industrial Electronic Devicesccplast updated 27 Nov 20183947 udpConnect and Control Protocol for Consumer, Commercial, and Industrial Electronic Devicesccplast updated 27 Nov 20183948 tcpAnton Paar Device Administration Protocolapdaplast updated 27 Nov 20183948 udpAnton Paar Device Administration Protocolapdaplast updated 27 Nov 20183949 tcpDynamic Routing Information Protocoldriplast updated 27 Nov 20183949 udpDynamic Routing Information Protocoldriplast updated 27 Nov 20183950 tcpName Mungingnamemungelast updated 27 Nov 20183950 udpName Mungingnamemungelast updated 27 Nov 20183951 tcpPWG IPP Facsimilepwgippfaxlast updated 27 Nov 20183951 udpPWG IPP Facsimilepwgippfaxlast updated 27 Nov 20183952 tcpI3 Session Manageri3-sessionmgrlast updated 27 Nov 20183952 udpI3 Session Manageri3-sessionmgrlast updated 27 Nov 20183953 tcpEydeas XMLink Connectxmlink-connectlast updated 27 Nov 20183953 udpEydeas XMLink Connectxmlink-connectlast updated 27 Nov 20183954 tcpAD Replication RPCadreplast updated 27 Nov 20183954 udpAD Replication RPCadreplast updated 27 Nov 20183955 tcpp2pCommunityp2pcommunitylast updated 27 Nov 20183955 udpp2pCommunityp2pcommunitylast updated 27 Nov 20183956 tcpGigE Vision Controlgvcplast updated 27 Nov 20183956 udpGigE Vision Controlgvcplast updated 27 Nov 20183957 tcpMQEnterprise Brokermqe-brokerlast updated 27 Nov 20183957 udpMQEnterprise Brokermqe-brokerlast updated 27 Nov 20183958 tcpMQEnterprise Agentmqe-agentlast updated 27 Nov 20183958 udpMQEnterprise Agentmqe-agentlast updated 27 Nov 20183959 tcpTree Hopper Networkingtreehopperlast updated 27 Nov 20183959 udpTree Hopper Networkingtreehopperlast updated 27 Nov 20183960 tcpBess Peer Assessmentbesslast updated 27 Nov 20183960 udpBess Peer Assessmentbesslast updated 27 Nov 20183961 tcpProAxess Serverproaxesslast updated 27 Nov 20183961 udpProAxess Serverproaxesslast updated 27 Nov 20183962 tcpSBI Agent Protocolsbi-agentlast updated 27 Nov 20183962 udpSBI Agent Protocolsbi-agentlast updated 27 Nov 20183963 tcpTeran Hybrid Routing Protocolthrplast updated 27 Nov 20183963 udpTeran Hybrid Routing Protocolthrplast updated 27 Nov 20183964 tcpSASG GPRSsasggprslast updated 27 Nov 20183964 udpSASG GPRSsasggprslast updated 27 Nov 20183965 tcpAvanti IP to NCPE APIati-ip-to-ncpelast updated 27 Nov 20183965 udpAvanti IP to NCPE APIati-ip-to-ncpelast updated 27 Nov 20183966 tcpBuildForge Lock Managerbflckmgrlast updated 27 Nov 20183966 udpBuildForge Lock Managerbflckmgrlast updated 27 Nov 20183967 tcpPPS Message Serviceppsmslast updated 27 Nov 20183967 udpPPS Message Serviceppsmslast updated 27 Nov 20183968 tcpiAnywhere DBNSianywhere-dbnslast updated 27 Nov 20183968 udpiAnywhere DBNSianywhere-dbnslast updated 27 Nov 20183969 tcpLandmark Messageslandmarkslast updated 27 Nov 20183969 udpLandmark Messageslandmarkslast updated 27 Nov 20183970 tcpLANrev Agentlanrevagentlast updated 27 Nov 20183970 udpLANrev Agentlanrevagentlast updated 27 Nov 20183971 tcpLANrev Serverlanrevserverlast updated 27 Nov 20183971 udpLANrev Serverlanrevserverlast updated 27 Nov 20183972 tcpict-control Protocoliconplast updated 27 Nov 20183972 udpict-control Protocoliconplast updated 27 Nov 20183973 tcpConnectShip Progisticsprogisticslast updated 27 Nov 20183973 udpConnectShip Progisticsprogisticslast updated 27 Nov 20183974 tcpRemote Applicant Tracking Servicecitysearchlast updated 27 Nov 20183974 udpRemote Applicant Tracking Servicecitysearchlast updated 27 Nov 20183975 tcpAir Shotairshotlast updated 27 Nov 20183975 udpAir Shotairshotlast updated 27 Nov 20183976 tcpServer Automation Agentopswagentlast updated 27 Nov 20183976 udpServer Automation Agentopswagentlast updated 27 Nov 20183977 tcpOpsware Manageropswmanagerlast updated 27 Nov 20183977 udpOpsware Manageropswmanagerlast updated 27 Nov 20183978 tcpSecured Configuration Serversecure-cfg-svrlast updated 27 Nov 20183978 udpSecured Configuration Serversecure-cfg-svrlast updated 27 Nov 20183979 tcpSmith Micro Wide Area Network Servicesmwanlast updated 27 Nov 20183979 udpSmith Micro Wide Area Network Servicesmwanlast updated 27 Nov 20183980 tcpAircraft Cabin Management Systemacmslast updated 27 Nov 20183980 udpAircraft Cabin Management Systemacmslast updated 27 Nov 20183981 tcpStarfish System Adminstarfishlast updated 27 Nov 20183981 udpStarfish System Adminstarfishlast updated 27 Nov 20183982 tcpESRI Image Servereislast updated 27 Nov 20183982 udpESRI Image Servereislast updated 27 Nov 20183983 tcpESRI Image Serviceeisplast updated 27 Nov 20183983 udpESRI Image Serviceeisplast updated 27 Nov 20183984 tcpMAPPER network node managermapper-nodemgrlast updated 27 Nov 20183984 udpMAPPER network node managermapper-nodemgrlast updated 27 Nov 20183985 tcpMAPPER TCP/IP servermapper-mapethdlast updated 27 Nov 20183985 udpMAPPER TCP/IP servermapper-mapethdlast updated 27 Nov 20183986 tcpMAPPER workstation server IANA assigned this well-formed service name as a replacement for "mapper-ws_ethd".mapper-ws-ethdlast updated 27 Nov 20183986 tcp (mapper-ws_ethd)MAPPER workstation servermapper-ws_ethdlast updated 27 Nov 20183986 udpMAPPER workstation server IANA assigned this well-formed service name as a replacement for "mapper-ws_ethd".mapper-ws-ethdlast updated 27 Nov 20183986 udp (mapper-ws_ethd)MAPPER workstation servermapper-ws_ethdlast updated 27 Nov 20183987 tcpCenterlinecenterlinelast updated 27 Nov 20183987 udpCenterlinecenterlinelast updated 27 Nov 20183988 tcpDCS Configuration Portdcs-configlast updated 27 Nov 20183988 udpDCS Configuration Portdcs-configlast updated 27 Nov 20183989 tcpBindView-Query Enginebv-queryenginelast updated 27 Nov 20183989 udpBindView-Query Enginebv-queryenginelast updated 27 Nov 20183990 tcpBindView-ISbv-islast updated 27 Nov 20183990 udpBindView-ISbv-islast updated 27 Nov 20183991 tcpBindView-SMCServerbv-smcsrvlast updated 27 Nov 20183991 udpBindView-SMCServerbv-smcsrvlast updated 27 Nov 20183992 tcpBindView-DirectoryServerbv-dslast updated 27 Nov 20183992 udpBindView-DirectoryServerbv-dslast updated 27 Nov 20183993 tcpBindView-Agentbv-agentlast updated 27 Nov 20183993 udpBindView-Agentbv-agentlast updated 27 Nov 20183994 UnassignedN/Alast updated 27 Nov 20183995 tcpISS Management Svcs SSLiss-mgmt-ssllast updated 27 Nov 20183995 udpISS Management Svcs SSLiss-mgmt-ssllast updated 27 Nov 20183996 tcpabcsoftware-01abcsoftwarelast updated 27 Nov 20183996 udpabcsoftware-01abcsoftwarelast updated 27 Nov 20183997 tcpaes_dbagentsease-dblast updated 27 Nov 20183997 udpaes_dbagentsease-dblast updated 27 Nov 20183998 tcpDistributed Nagios Executor Servicednxlast updated 27 Nov 20183998 udpDistributed Nagios Executor Servicednxlast updated 27 Nov 20183999 tcpNorman distributes scanning servicenvcnetlast updated 27 Nov 20183999 udpNorman distributes scanning servicenvcnetlast updated 27 Nov 20184000 tcpTerabaseterabaselast updated 27 Nov 20184000 udpTerabaseterabaselast updated 27 Nov 20184001 tcpNewOaknewoaklast updated 27 Nov 20184001 udpNewOaknewoaklast updated 27 Nov 20184002 tcppxc-spvr-ftpxc-spvr-ftlast updated 27 Nov 20184002 udppxc-spvr-ftpxc-spvr-ftlast updated 27 Nov 20184003 tcppxc-splr-ftpxc-splr-ftlast updated 27 Nov 20184003 udppxc-splr-ftpxc-splr-ftlast updated 27 Nov 20184004 tcppxc-roidpxc-roidlast updated 27 Nov 20184004 udppxc-roidpxc-roidlast updated 27 Nov 20184005 tcppxc-pinpxc-pinlast updated 27 Nov 20184005 udppxc-pinpxc-pinlast updated 27 Nov 20184006 tcppxc-spvrpxc-spvrlast updated 27 Nov 20184006 udppxc-spvrpxc-spvrlast updated 27 Nov 20184007 tcppxc-splrpxc-splrlast updated 27 Nov 20184007 udppxc-splrpxc-splrlast updated 27 Nov 20184008 tcpNetCheque accountingnetchequelast updated 27 Nov 20184008 udpNetCheque accountingnetchequelast updated 27 Nov 20184009 tcpChimera HWMchimera-hwmlast updated 27 Nov 20184009 udpChimera HWMchimera-hwmlast updated 27 Nov 20184010 tcpSamsung Unidexsamsung-unidexlast updated 27 Nov 20184010 udpSamsung Unidexsamsung-unidexlast updated 27 Nov 20184011 tcpAlternate Service Bootaltservicebootlast updated 27 Nov 20184011 udpAlternate Service Bootaltservicebootlast updated 27 Nov 20184012 tcpPDA Gatepda-gatelast updated 27 Nov 20184012 udpPDA Gatepda-gatelast updated 27 Nov 20184013 tcpACL Manageracl-managerlast updated 27 Nov 20184013 udpACL Manageracl-managerlast updated 27 Nov 20184014 tcpTAICLOCKtaiclocklast updated 27 Nov 20184014 udpTAICLOCKtaiclocklast updated 27 Nov 20184015 tcpTalarian Mcasttalarian-mcast1last updated 27 Nov 20184015 udpTalarian Mcasttalarian-mcast1last updated 27 Nov 20184016 tcpTalarian Mcasttalarian-mcast2last updated 27 Nov 20184016 udpTalarian Mcasttalarian-mcast2last updated 27 Nov 20184017 tcpTalarian Mcasttalarian-mcast3last updated 27 Nov 20184017 udpTalarian Mcasttalarian-mcast3last updated 27 Nov 20184018 tcpTalarian Mcasttalarian-mcast4last updated 27 Nov 20184018 udpTalarian Mcasttalarian-mcast4last updated 27 Nov 20184019 tcpTalarian Mcasttalarian-mcast5last updated 27 Nov 20184019 udpTalarian Mcasttalarian-mcast5last updated 27 Nov 20184020 tcpTRAP Porttraplast updated 27 Nov 20184020 udpTRAP Porttraplast updated 27 Nov 20184021 tcpNexus Portalnexus-portallast updated 27 Nov 20184021 udpNexus Portalnexus-portallast updated 27 Nov 20184022 tcpDNOXdnoxlast updated 27 Nov 20184022 udpDNOXdnoxlast updated 27 Nov 20184023 tcpESNM Zoning Portesnm-zoninglast updated 27 Nov 20184023 udpESNM Zoning Portesnm-zoninglast updated 27 Nov 20184024 tcpTNP1 User Porttnp1-portlast updated 27 Nov 20184024 udpTNP1 User Porttnp1-portlast updated 27 Nov 20184025 tcpPartition Image Portpartimagelast updated 27 Nov 20184025 udpPartition Image Portpartimagelast updated 27 Nov 20184026 tcpGraphical Debug Serveras-debuglast updated 27 Nov 20184026 udpGraphical Debug Serveras-debuglast updated 27 Nov 20184027 tcpbitxpressbxplast updated 27 Nov 20184027 udpbitxpressbxplast updated 27 Nov 20184028 tcpDTServer Portdtserver-portlast updated 27 Nov 20184028 udpDTServer Portdtserver-portlast updated 27 Nov 20184029 tcpIP Q signaling protocolip-qsiglast updated 27 Nov 20184029 udpIP Q signaling protocolip-qsiglast updated 27 Nov 20184030 tcpAccell/JSP Daemon Portjdmn-portlast updated 27 Nov 20184030 udpAccell/JSP Daemon Portjdmn-portlast updated 27 Nov 20184031 tcpUUCP over SSLsuucplast updated 27 Nov 20184031 udpUUCP over SSLsuucplast updated 27 Nov 20184032 tcpVERITAS Authorization Servicevrts-auth-portlast updated 27 Nov 20184032 udpVERITAS Authorization Servicevrts-auth-portlast updated 27 Nov 20184033 tcpSANavigator Peer Portsanavigatorlast updated 27 Nov 20184033 udpSANavigator Peer Portsanavigatorlast updated 27 Nov 20184034 tcpUbiquinox Daemonubxdlast updated 27 Nov 20184034 udpUbiquinox Daemonubxdlast updated 27 Nov 20184035 tcpWAP Push OTA-HTTP portwap-push-httplast updated 27 Nov 20184035 udpWAP Push OTA-HTTP portwap-push-httplast updated 27 Nov 20184036 tcpWAP Push OTA-HTTP securewap-push-httpslast updated 27 Nov 20184036 udpWAP Push OTA-HTTP securewap-push-httpslast updated 27 Nov 20184037 tcpRaveHD network controlravehdlast updated 27 Nov 20184037 udpRaveHD network controlravehdlast updated 27 Nov 20184038 tcpFazzt Point-To-Pointfazzt-ptplast updated 27 Nov 20184038 udpFazzt Point-To-Pointfazzt-ptplast updated 27 Nov 20184039 tcpFazzt Administrationfazzt-adminlast updated 27 Nov 20184039 udpFazzt Administrationfazzt-adminlast updated 27 Nov 20184040 tcpYo.net main serviceyo-mainlast updated 27 Nov 20184040 udpYo.net main serviceyo-mainlast updated 27 Nov 20184041 tcpRocketeer-Houstonhoustonlast updated 27 Nov 20184041 udpRocketeer-Houstonhoustonlast updated 27 Nov 20184042 tcpLDXPldxplast updated 27 Nov 20184042 udpLDXPldxplast updated 27 Nov 20184043 tcpNeighbour Identity Resolutionnirplast updated 27 Nov 20184043 udpNeighbour Identity Resolutionnirplast updated 27 Nov 20184044 tcpLocation Tracking Protocolltplast updated 27 Nov 20184044 udpLocation Tracking Protocolltplast updated 27 Nov 20184045 tcpNetwork Paging Protocolnpplast updated 27 Nov 20184045 udpNetwork Paging Protocolnpplast updated 27 Nov 20184046 tcpAccounting Protocolacp-protolast updated 27 Nov 20184046 udpAccounting Protocolacp-protolast updated 27 Nov 20184047 tcpContext Transfer Protocolctp-statelast updated 27 Nov 20184047 udpContext Transfer Protocolctp-statelast updated 27 Nov 20184048 UnassignedN/Alast updated 27 Nov 20184049 tcpWide Area File Serviceswafslast updated 27 Nov 20184049 udpWide Area File Serviceswafslast updated 27 Nov 20184050 tcpWide Area File Servicescisco-wafslast updated 27 Nov 20184050 udpWide Area File Servicescisco-wafslast updated 27 Nov 20184051 tcpCisco Peer to Peer Distribution Protocolcppdplast updated 27 Nov 20184051 udpCisco Peer to Peer Distribution Protocolcppdplast updated 27 Nov 20184052 tcpVoiceConnect Interactinteractlast updated 27 Nov 20184052 udpVoiceConnect Interactinteractlast updated 27 Nov 20184053 tcpCosmoCall Universe Communications Port 1ccu-comm-1last updated 27 Nov 20184053 udpCosmoCall Universe Communications Port 1ccu-comm-1last updated 27 Nov 20184054 tcpCosmoCall Universe Communications Port 2ccu-comm-2last updated 27 Nov 20184054 udpCosmoCall Universe Communications Port 2ccu-comm-2last updated 27 Nov 20184055 tcpCosmoCall Universe Communications Port 3ccu-comm-3last updated 27 Nov 20184055 udpCosmoCall Universe Communications Port 3ccu-comm-3last updated 27 Nov 20184056 tcpLocation Message Servicelmslast updated 27 Nov 20184056 udpLocation Message Servicelmslast updated 27 Nov 20184057 tcpServigistics WFM serverwfmlast updated 27 Nov 20184057 udpServigistics WFM serverwfmlast updated 27 Nov 20184058 tcpKingfisher protocolkingfisherlast updated 27 Nov 20184058 udpKingfisher protocolkingfisherlast updated 27 Nov 20184059 tcpDLMS/COSEMdlms-cosemlast updated 27 Nov 20184059 udpDLMS/COSEMdlms-cosemlast updated 27 Nov 20184060 tcpDSMETER Inter-Agent Transfer Channel IANA assigned this well-formed service name as a replacement for "dsmeter_iatc".dsmeter-iatclast updated 27 Nov 20184060 tcp (dsmeter_iatc)DSMETER Inter-Agent Transfer Channeldsmeter_iatclast updated 27 Nov 20184060 udpDSMETER Inter-Agent Transfer Channel IANA assigned this well-formed service name as a replacement for "dsmeter_iatc".dsmeter-iatclast updated 27 Nov 20184060 udp (dsmeter_iatc)DSMETER Inter-Agent Transfer Channeldsmeter_iatclast updated 27 Nov 20184061 tcpIce Location Service (TCP)ice-locationlast updated 27 Nov 20184061 udpIce Location Service (TCP)ice-locationlast updated 27 Nov 20184062 tcpIce Location Service (SSL)ice-slocationlast updated 27 Nov 20184062 udpIce Location Service (SSL)ice-slocationlast updated 27 Nov 20184063 tcpIce Firewall Traversal Service (TCP)ice-routerlast updated 27 Nov 20184063 udpIce Firewall Traversal Service (TCP)ice-routerlast updated 27 Nov 20184064 tcpIce Firewall Traversal Service (SSL)ice-srouterlast updated 27 Nov 20184064 udpIce Firewall Traversal Service (SSL)ice-srouterlast updated 27 Nov 20184065 tcpAvanti Common Data IANA assigned this well-formed service name as a replacement for "avanti_cdp".avanti-cdplast updated 27 Nov 20184065 tcp (avanti_cdp)Avanti Common Dataavanti_cdplast updated 27 Nov 20184065 udpAvanti Common Data IANA assigned this well-formed service name as a replacement for "avanti_cdp".avanti-cdplast updated 27 Nov 20184065 udp (avanti_cdp)Avanti Common Dataavanti_cdplast updated 27 Nov 20184066 tcpPerformance Measurement and Analysispmaslast updated 27 Nov 20184066 udpPerformance Measurement and Analysispmaslast updated 27 Nov 20184067 tcpInformation Distribution Protocolidplast updated 27 Nov 20184067 udpInformation Distribution Protocolidplast updated 27 Nov 20184068 tcpIP Fleet Broadcastipfltbcstlast updated 27 Nov 20184068 udpIP Fleet Broadcastipfltbcstlast updated 27 Nov 20184069 tcpMinger Email Address Validation Servicemingerlast updated 27 Nov 20184069 udpMinger Email Address Validation Servicemingerlast updated 27 Nov 20184070 tcpTrivial IP Encryption (TrIPE)tripelast updated 27 Nov 20184070 udpTrivial IP Encryption (TrIPE)tripelast updated 27 Nov 20184071 tcpAutomatically Incremental Backupaibkuplast updated 27 Nov 20184071 udpAutomatically Incremental Backupaibkuplast updated 27 Nov 20184072 tcpZieto Socket Communicationszieto-socklast updated 27 Nov 20184072 udpZieto Socket Communicationszieto-socklast updated 27 Nov 20184073 tcpInteractive Remote Application Pairing ProtocoliRAPPlast updated 27 Nov 20184073 udpInteractive Remote Application Pairing ProtocoliRAPPlast updated 27 Nov 20184074 tcpCequint City ID UI triggercequint-cityidlast updated 27 Nov 20184074 udpCequint City ID UI triggercequint-cityidlast updated 27 Nov 20184075 tcpISC Alarm Message Serviceperimlanlast updated 27 Nov 20184075 udpISC Alarm Message Serviceperimlanlast updated 27 Nov 20184076 tcpSeraph DCSseraphlast updated 27 Nov 20184076 udpSeraph DCSseraphlast updated 27 Nov 20184077 tcpReservedN/Alast updated 27 Nov 20184077 udpAscom IP Alarmingascomalarmlast updated 27 Nov 20184078 tcpCoordinated Security Service Protocolcssplast updated 27 Nov 20184078 udpReservedN/Alast updated 27 Nov 20184079 tcpSANtools Diagnostic Serversantoolslast updated 27 Nov 20184079 udpSANtools Diagnostic Serversantoolslast updated 27 Nov 20184080 tcpLorica inside facinglorica-inlast updated 27 Nov 20184080 udpLorica inside facinglorica-inlast updated 27 Nov 20184081 tcpLorica inside facing (SSL)lorica-in-seclast updated 27 Nov 20184081 udpLorica inside facing (SSL)lorica-in-seclast updated 27 Nov 20184082 tcpLorica outside facinglorica-outlast updated 27 Nov 20184082 udpLorica outside facinglorica-outlast updated 27 Nov 20184083 tcpLorica outside facing (SSL)lorica-out-seclast updated 27 Nov 20184083 udpLorica outside facing (SSL)lorica-out-seclast updated 27 Nov 20184084 tcpReservedN/Alast updated 27 Nov 20184084 udpFortisphere VM Servicefortisphere-vmlast updated 27 Nov 20184085 tcpEZNews Newsroom Message Serviceezmessagesrvlast updated 27 Nov 20184085 udpReservedN/Alast updated 27 Nov 20184086 tcpReservedN/Alast updated 27 Nov 20184086 udpFirewall/NAT state table synchronizationftsynclast updated 27 Nov 20184087 tcpAPplus Serviceapplusservicelast updated 27 Nov 20184087 udpReservedN/Alast updated 27 Nov 20184088 tcpNoah Printing Service Protocolnpsplast updated 27 Nov 20184088 udpReservedN/Alast updated 27 Nov 20184089 tcpOpenCORE Remote Control Serviceopencorelast updated 27 Nov 20184089 udpOpenCORE Remote Control Serviceopencorelast updated 27 Nov 20184090 tcpOMA BCAST Service Guideomasgportlast updated 27 Nov 20184090 udpOMA BCAST Service Guideomasgportlast updated 27 Nov 20184091 tcpEminentWare Installerewinstallerlast updated 27 Nov 20184091 udpEminentWare Installerewinstallerlast updated 27 Nov 20184092 tcpEminentWare DGSewdgslast updated 27 Nov 20184092 udpEminentWare DGSewdgslast updated 27 Nov 20184093 tcpPvx Plus CS Hostpvxpluscslast updated 27 Nov 20184093 udpPvx Plus CS Hostpvxpluscslast updated 27 Nov 20184094 tcpsysrq daemonsysrqdlast updated 27 Nov 20184094 udpsysrq daemonsysrqdlast updated 27 Nov 20184095 tcpxtgui information servicextguilast updated 27 Nov 20184095 udpxtgui information servicextguilast updated 27 Nov 20184096 tcpBRE (Bridge Relay Element)brelast updated 27 Nov 20184096 udpBRE (Bridge Relay Element)brelast updated 27 Nov 20184097 tcpPatrol Viewpatrolviewlast updated 27 Nov 20184097 udpPatrol Viewpatrolviewlast updated 27 Nov 20184098 tcpdrmsfsddrmsfsdlast updated 27 Nov 20184098 udpdrmsfsddrmsfsdlast updated 27 Nov 20184099 tcpDPCPdpcplast updated 27 Nov 20184099 udpDPCPdpcplast updated 27 Nov 20184100 tcpIGo Incognito Data Portigo-incognitolast updated 27 Nov 20184100 udpIGo Incognito Data Portigo-incognitolast updated 27 Nov 20184101 tcpBraille protocolbrlp-0last updated 27 Nov 20184101 udpBraille protocolbrlp-0last updated 27 Nov 20184102 tcpBraille protocolbrlp-1last updated 27 Nov 20184102 udpBraille protocolbrlp-1last updated 27 Nov 20184103 tcpBraille protocolbrlp-2last updated 27 Nov 20184103 udpBraille protocolbrlp-2last updated 27 Nov 20184104 tcpBraille protocolbrlp-3last updated 27 Nov 20184104 udpBraille protocolbrlp-3last updated 27 Nov 20184105 tcpShofarshofarlast updated 27 Nov 20184105 udpShofarshofarlast updated 27 Nov 20184106 tcpSynchronitesynchronitelast updated 27 Nov 20184106 udpSynchronitesynchronitelast updated 27 Nov 20184107 tcpJDL Accounting LAN Servicej-aclast updated 27 Nov 20184107 udpJDL Accounting LAN Servicej-aclast updated 27 Nov 20184108 tcpACCELaccellast updated 27 Nov 20184108 udpACCELaccellast updated 27 Nov 20184109 tcpInstantiated Zero-control Messagingizmlast updated 27 Nov 20184109 udpInstantiated Zero-control Messagingizmlast updated 27 Nov 20184110 tcpG2 RFID Tag Telemetry Datag2taglast updated 27 Nov 20184110 udpG2 RFID Tag Telemetry Datag2taglast updated 27 Nov 20184111 tcpXgridxgridlast updated 27 Nov 20184111 udpXgridxgridlast updated 27 Nov 20184112 tcpApple VPN Server Reporting Protocolapple-vpns-rplast updated 27 Nov 20184112 udpApple VPN Server Reporting Protocolapple-vpns-rplast updated 27 Nov 20184113 tcpAIPN LS Registrationaipn-reglast updated 27 Nov 20184113 udpAIPN LS Registrationaipn-reglast updated 27 Nov 20184114 tcpJomaMQMonitorjomamqmonitorlast updated 27 Nov 20184114 udpJomaMQMonitorjomamqmonitorlast updated 27 Nov 20184115 tcpCDS Transfer Agentcdslast updated 27 Nov 20184115 udpCDS Transfer Agentcdslast updated 27 Nov 20184116 tcpsmartcard-TLSsmartcard-tlslast updated 27 Nov 20184116 udpsmartcard-TLSsmartcard-tlslast updated 27 Nov 20184117 tcpHillr Connection Managerhillrservlast updated 27 Nov 20184117 udpHillr Connection Managerhillrservlast updated 27 Nov 20184118 tcpNetadmin Systems NETscript servicenetscriptlast updated 27 Nov 20184118 udpNetadmin Systems NETscript servicenetscriptlast updated 27 Nov 20184119 tcpAssuria Log Managerassuria-slmlast updated 27 Nov 20184119 udpAssuria Log Managerassuria-slmlast updated 27 Nov 20184120 tcpMiniRem Remote Telemetry and Controlminiremlast updated 27 Nov 20184120 udpReservedN/Alast updated 27 Nov 20184121 tcpe-Builder Application Communicatione-builderlast updated 27 Nov 20184121 udpe-Builder Application Communicatione-builderlast updated 27 Nov 20184122 tcpFiber Patrol Alarm Servicefpramslast updated 27 Nov 20184122 udpFiber Patrol Alarm Servicefpramslast updated 27 Nov 20184123 tcpZ-Wave Protocolz-wavelast updated 27 Nov 20184123 udpZ-Wave Protocolz-wavelast updated 27 Nov 20184124 tcpRohill TetraNode Ip Gateway v2tigv2last updated 27 Nov 20184124 udpRohill TetraNode Ip Gateway v2tigv2last updated 27 Nov 20184125 tcpOpsview Envoyopsview-envoylast updated 27 Nov 20184125 udpOpsview Envoyopsview-envoylast updated 27 Nov 20184126 tcpData Domain Replication Serviceddrepllast updated 27 Nov 20184126 udpData Domain Replication Serviceddrepllast updated 27 Nov 20184127 tcpNetUniKeyServerunikeyprolast updated 27 Nov 20184127 udpNetUniKeyServerunikeyprolast updated 27 Nov 20184128 tcpNuFW decision delegation protocolnufwlast updated 27 Nov 20184128 udpNuFW decision delegation protocolnufwlast updated 27 Nov 20184129 tcpNuFW authentication protocolnuauthlast updated 27 Nov 20184129 udpNuFW authentication protocolnuauthlast updated 27 Nov 20184130 tcpFRONET message protocolfronetlast updated 27 Nov 20184130 udpFRONET message protocolfronetlast updated 27 Nov 20184131 tcpGlobal Maintech Starsstarslast updated 27 Nov 20184131 udpGlobal Maintech Starsstarslast updated 27 Nov 20184132 tcpNUTS Daemon IANA assigned this well-formed service name as a replacement for "nuts_dem".nuts-demlast updated 27 Nov 20184132 tcp (nuts_dem)NUTS Daemonnuts_demlast updated 27 Nov 20184132 udpNUTS Daemon IANA assigned this well-formed service name as a replacement for "nuts_dem".nuts-demlast updated 27 Nov 20184132 udp (nuts_dem)NUTS Daemonnuts_demlast updated 27 Nov 20184133 tcpNUTS Bootp Server IANA assigned this well-formed service name as a replacement for "nuts_bootp".nuts-bootplast updated 27 Nov 20184133 tcp (nuts_bootp)NUTS Bootp Servernuts_bootplast updated 27 Nov 20184133 udpNUTS Bootp Server IANA assigned this well-formed service name as a replacement for "nuts_bootp".nuts-bootplast updated 27 Nov 20184133 udp (nuts_bootp)NUTS Bootp Servernuts_bootplast updated 27 Nov 20184134 tcpNIFTY-Serve HMI protocolnifty-hmilast updated 27 Nov 20184134 udpNIFTY-Serve HMI protocolnifty-hmilast updated 27 Nov 20184135 tcpClassic Line Database Server Attachcl-db-attachlast updated 27 Nov 20184135 udpClassic Line Database Server Attachcl-db-attachlast updated 27 Nov 20184136 tcpClassic Line Database Server Requestcl-db-requestlast updated 27 Nov 20184136 udpClassic Line Database Server Requestcl-db-requestlast updated 27 Nov 20184137 tcpClassic Line Database Server Remotecl-db-remotelast updated 27 Nov 20184137 udpClassic Line Database Server Remotecl-db-remotelast updated 27 Nov 20184138 tcpnettestnettestlast updated 27 Nov 20184138 udpnettestnettestlast updated 27 Nov 20184139 tcpImperfect Networks Serverthrtxlast updated 27 Nov 20184139 udpImperfect Networks Serverthrtxlast updated 27 Nov 20184140 tcpCedros Fraud Detection System IANA assigned this well-formed service name as a replacement for "cedros_fds".cedros-fdslast updated 27 Nov 20184140 tcp (cedros_fds)Cedros Fraud Detection Systemcedros_fdslast updated 27 Nov 20184140 udpCedros Fraud Detection System IANA assigned this well-formed service name as a replacement for "cedros_fds".cedros-fdslast updated 27 Nov 20184140 udp (cedros_fds)Cedros Fraud Detection Systemcedros_fdslast updated 27 Nov 20184141 tcpWorkflow Serveroirtgsvclast updated 27 Nov 20184141 udpWorkflow Serveroirtgsvclast updated 27 Nov 20184142 tcpDocument Serveroidocsvclast updated 27 Nov 20184142 udpDocument Serveroidocsvclast updated 27 Nov 20184143 tcpDocument Replicationoidsrlast updated 27 Nov 20184143 udpDocument Replicationoidsrlast updated 27 Nov 20184144 UnassignedN/Alast updated 27 Nov 20184145 tcpVVR Controlvvr-controllast updated 27 Nov 20184145 udpVVR Controlvvr-controllast updated 27 Nov 20184146 tcpTGCConnect Beacontgcconnectlast updated 27 Nov 20184146 udpTGCConnect Beacontgcconnectlast updated 27 Nov 20184147 tcpMultum Service Managervrxpservmanlast updated 27 Nov 20184147 udpMultum Service Managervrxpservmanlast updated 27 Nov 20184148 tcpHHB Handheld Clienthhb-handheldlast updated 27 Nov 20184148 udpHHB Handheld Clienthhb-handheldlast updated 27 Nov 20184149 tcpA10 GSLB Serviceagslblast updated 27 Nov 20184149 udpA10 GSLB Serviceagslblast updated 27 Nov 20184150 tcpPowerAlert Network Shutdown AgentPowerAlert-nsalast updated 27 Nov 20184150 udpPowerAlert Network Shutdown AgentPowerAlert-nsalast updated 27 Nov 20184151 tcpMen & Mice Remote Control IANA assigned this well-formed service name as a replacement for "menandmice_noh".menandmice-nohlast updated 27 Nov 20184151 tcp (menandmice_noh)Men & Mice Remote Controlmenandmice_nohlast updated 27 Nov 20184151 udpMen & Mice Remote Control IANA assigned this well-formed service name as a replacement for "menandmice_noh".menandmice-nohlast updated 27 Nov 20184151 udp (menandmice_noh)Men & Mice Remote Controlmenandmice_nohlast updated 27 Nov 20184152 tcpiDigTech Multiplex IANA assigned this well-formed service name as a replacement for "idig_mux".idig-muxlast updated 27 Nov 20184152 tcp (idig_mux)iDigTech Multiplexidig_muxlast updated 27 Nov 20184152 udpiDigTech Multiplex IANA assigned this well-formed service name as a replacement for "idig_mux".idig-muxlast updated 27 Nov 20184152 udp (idig_mux)iDigTech Multiplexidig_muxlast updated 27 Nov 20184153 tcpMBL Remote Battery Monitoringmbl-battdlast updated 27 Nov 20184153 udpMBL Remote Battery Monitoringmbl-battdlast updated 27 Nov 20184154 tcpatlinks device discoveryatlinkslast updated 27 Nov 20184154 udpatlinks device discoveryatlinkslast updated 27 Nov 20184155 tcpBazaar version control systembzrlast updated 27 Nov 20184155 udpBazaar version control systembzrlast updated 27 Nov 20184156 tcpSTAT Resultsstat-resultslast updated 27 Nov 20184156 udpSTAT Resultsstat-resultslast updated 27 Nov 20184157 tcpSTAT Scanner Controlstat-scannerlast updated 27 Nov 20184157 udpSTAT Scanner Controlstat-scannerlast updated 27 Nov 20184158 tcpSTAT Command Centerstat-cclast updated 27 Nov 20184158 udpSTAT Command Centerstat-cclast updated 27 Nov 20184159 tcpNetwork Security Servicensslast updated 27 Nov 20184159 udpNetwork Security Servicensslast updated 27 Nov 20184160 tcpJini Discoveryjini-discoverylast updated 27 Nov 20184160 udpJini Discoveryjini-discoverylast updated 27 Nov 20184161 tcpOMS Contactomscontactlast updated 27 Nov 20184161 udpOMS Contactomscontactlast updated 27 Nov 20184162 tcpOMS Topologyomstopologylast updated 27 Nov 20184162 udpOMS Topologyomstopologylast updated 27 Nov 20184163 tcpSilver Peak Peer Protocolsilverpeakpeerlast updated 27 Nov 20184163 udpSilver Peak Peer Protocolsilverpeakpeerlast updated 27 Nov 20184164 tcpSilver Peak Communication Protocolsilverpeakcommlast updated 27 Nov 20184164 udpSilver Peak Communication Protocolsilverpeakcommlast updated 27 Nov 20184165 tcpArcLink over Ethernetaltcplast updated 27 Nov 20184165 udpArcLink over Ethernetaltcplast updated 27 Nov 20184166 tcpJoost Peer to Peer Protocoljoostlast updated 27 Nov 20184166 udpJoost Peer to Peer Protocoljoostlast updated 27 Nov 20184167 tcpDeskDirect Global Networkddgnlast updated 27 Nov 20184167 udpDeskDirect Global Networkddgnlast updated 27 Nov 20184168 tcpPrintSoft License Serverpslicserlast updated 27 Nov 20184168 udpPrintSoft License Serverpslicserlast updated 27 Nov 20184169 tcpAutomation Drive Interface Transportiadtlast updated 27 Nov 20184169 udpInternet ADT Discovery Protocoliadt-disclast updated 27 Nov 20184170 tcpSMPTE Content Synchonization Protocold-cinema-csplast updated 27 Nov 20184170 udpReservedN/Alast updated 27 Nov 20184171 tcpMaxlogic Supervisor Communicationml-svnetlast updated 27 Nov 20184171 udpReservedN/Alast updated 27 Nov 20184172 tcpPC over IPpcoiplast updated 27 Nov 20184172 udpPC over IPpcoiplast updated 27 Nov 20184173 tcpReservedN/Alast updated 27 Nov 20184173 udpMMA Device Discoverymma-discoverylast updated 27 Nov 20184174 tcpStorMagic Cluster Servicessmclusterlast updated 27 Nov 20184174 udpStorMagic Discoverysm-disclast updated 27 Nov 20184175 tcpBrocade Cluster Communication Protocolbccplast updated 27 Nov 20184175 udpReservedN/Alast updated 27 Nov 20184176 tcpTranslattice Cluster IPC Proxytl-ipcproxylast updated 27 Nov 20184176 udpReservedN/Alast updated 27 Nov 20184177 tcpWello P2P pubsub servicewellolast updated 27 Nov 20184177 udpWello P2P pubsub servicewellolast updated 27 Nov 20184178 tcpStorManstormanlast updated 27 Nov 20184178 udpStorManstormanlast updated 27 Nov 20184179 tcpMaxum ServicesMaxumSPlast updated 27 Nov 20184179 udpMaxum ServicesMaxumSPlast updated 27 Nov 20184180 tcpHTTPXhttpxlast updated 27 Nov 20184180 udpHTTPXhttpxlast updated 27 Nov 20184181 tcpMacBakmacbaklast updated 27 Nov 20184181 udpMacBakmacbaklast updated 27 Nov 20184182 tcpProduction Company Pro TCP Servicepcptcpservicelast updated 27 Nov 20184182 udpProduction Company Pro TCP Servicepcptcpservicelast updated 27 Nov 20184183 tcpCyborgNet communications protocolcyborgnetlast updated 27 Nov 20184183 udpCyborgNet communications protocolcyborgnetlast updated 27 Nov 20184184 tcpUNIVERSE SUITE MESSAGE SERVICE IANA assigned this well-formed service name as a replacement for "universe_suite".universe-suitelast updated 27 Nov 20184184 tcp (universe_suite)UNIVERSE SUITE MESSAGE SERVICEuniverse_suitelast updated 27 Nov 20184184 udpUNIVERSE SUITE MESSAGE SERVICE IANA assigned this well-formed service name as a replacement for "universe_suite".universe-suitelast updated 27 Nov 20184184 udp (universe_suite)UNIVERSE SUITE MESSAGE SERVICEuniverse_suitelast updated 27 Nov 20184185 tcpWoven Control Plane Protocolwcpplast updated 27 Nov 20184185 udpWoven Control Plane Protocolwcpplast updated 27 Nov 20184186 tcpBox Backup Store Serviceboxbackupstorelast updated 27 Nov 20184186 udpReservedN/Alast updated 27 Nov 20184187 tcpCascade Proxy IANA assigned this well-formed service name as a replacement for "csc_proxy".csc-proxylast updated 27 Nov 20184187 tcp (csc_proxy)Cascade Proxycsc_proxylast updated 27 Nov 20184187 udpReservedN/Alast updated 27 Nov 20184188 tcpVatata Peer to Peer Protocolvatatalast updated 27 Nov 20184188 udpVatata Peer to Peer Protocolvatatalast updated 27 Nov 20184189 tcpPath Computation Element Communication Protocolpceplast updated 27 Nov 20184189 udpReservedN/Alast updated 27 Nov 20184190 tcpManageSieve Protocolsievelast updated 27 Nov 20184190 udpReservedN/Alast updated 27 Nov 20184191 tcpReservedN/Alast updated 27 Nov 20184191 udpDual Stack MIPv6 NAT Traversaldsmipv6last updated 27 Nov 20184192 tcpAzeti Agent Serviceazetilast updated 27 Nov 20184192 udpazeti blinddateazeti-bdlast updated 27 Nov 20184193 tcpPxPlus remote file srvrpvxplusiolast updated 27 Nov 20184193 udpReservedN/Alast updated 27 Nov 20184194-4196 UnassignedN/Alast updated 27 Nov 20184197 tcpHarman HControl Protocolhctllast updated 27 Nov 20184197 udpHarman HControl Protocolhctllast updated 27 Nov 20184198 UnassignedN/Alast updated 27 Nov 20184199 tcpEIMS ADMINeims-adminlast updated 27 Nov 20184199 udpEIMS ADMINeims-adminlast updated 27 Nov 20184200-4299 VRML Multi User Systemsvrml-multi-uselast updated 27 Nov 20184300 tcpCorel CCamcorelccamlast updated 27 Nov 20184300 udpCorel CCamcorelccamlast updated 27 Nov 20184301 tcpDiagnostic Datad-datalast updated 27 Nov 20184301 udpDiagnostic Datad-datalast updated 27 Nov 20184302 tcpDiagnostic Data Controld-data-controllast updated 27 Nov 20184302 udpDiagnostic Data Controld-data-controllast updated 27 Nov 20184303 tcpSimple Railroad Command Protocolsrcplast updated 27 Nov 20184303 udpSimple Railroad Command Protocolsrcplast updated 27 Nov 20184304 tcpOne-Wire Filesystem Serverowserverlast updated 27 Nov 20184304 udpOne-Wire Filesystem Serverowserverlast updated 27 Nov 20184305 tcpbetter approach to mobile ad-hoc networkingbatmanlast updated 27 Nov 20184305 udpbetter approach to mobile ad-hoc networkingbatmanlast updated 27 Nov 20184306 tcpHellgate Londonpinghgllast updated 27 Nov 20184306 udpHellgate Londonpinghgllast updated 27 Nov 20184307 tcpTrueConf Videoconference Servicetrueconflast updated 27 Nov 20184307 udpTrueConf Videoconference Servicetrueconflast updated 27 Nov 20184308 tcpCompX-LockViewcompx-lockviewlast updated 27 Nov 20184308 udpCompX-LockViewcompx-lockviewlast updated 27 Nov 20184309 tcpExsequi Appliance Discoverydserverlast updated 27 Nov 20184309 udpExsequi Appliance Discoverydserverlast updated 27 Nov 20184310 tcpMir-RT exchange servicemirrtexlast updated 27 Nov 20184310 udpMir-RT exchange servicemirrtexlast updated 27 Nov 20184311 tcpP6R Secure Server Management Consolep6ssmclast updated 27 Nov 20184311 udpReservedN/Alast updated 27 Nov 20184312 tcpParascale Membership Managerpscl-mgtlast updated 27 Nov 20184312 udpReservedN/Alast updated 27 Nov 20184313 tcpPERRLA User Servicesperrlalast updated 27 Nov 20184313 udpReservedN/Alast updated 27 Nov 20184314 tcpChoiceView Agentchoiceview-agtlast updated 27 Nov 20184314 udpReservedN/Alast updated 27 Nov 20184315 UnassignedN/Alast updated 27 Nov 20184316 tcpChoiceView Clientchoiceview-cltlast updated 27 Nov 20184316 udpReservedN/Alast updated 27 Nov 20184317-4319 UnassignedN/Alast updated 27 Nov 20184320 tcpFDT Remote Categorization Protocolfdt-rcatplast updated 27 Nov 20184320 udpFDT Remote Categorization Protocolfdt-rcatplast updated 27 Nov 20184321 tcpRemote Who Isrwhoislast updated 27 Nov 20184321 udpRemote Who Isrwhoislast updated 27 Nov 20184322 tcpTRIM Event Servicetrim-eventlast updated 27 Nov 20184322 udpTRIM Event Servicetrim-eventlast updated 27 Nov 20184323 tcpTRIM ICE Servicetrim-icelast updated 27 Nov 20184323 udpTRIM ICE Servicetrim-icelast updated 27 Nov 20184324 ReservedN/Alast updated 27 Nov 20184325 tcpCadcorp GeognoSIS Manager Servicegeognosismanlast updated 27 Nov 20184325 udpCadcorp GeognoSIS Manager Servicegeognosismanlast updated 27 Nov 20184326 tcpCadcorp GeognoSIS Servicegeognosislast updated 27 Nov 20184326 udpCadcorp GeognoSIS Servicegeognosislast updated 27 Nov 20184327 tcpJaxer Web Protocoljaxer-weblast updated 27 Nov 20184327 udpJaxer Web Protocoljaxer-weblast updated 27 Nov 20184328 tcpJaxer Manager Command Protocoljaxer-managerlast updated 27 Nov 20184328 udpJaxer Manager Command Protocoljaxer-managerlast updated 27 Nov 20184329 tcpPubliQare Distributed Environment Synchronisation Enginepubliqare-synclast updated 27 Nov 20184329 udpReservedN/Alast updated 27 Nov 20184330 tcpDEY Storage Administration REST APIdey-sapilast updated 27 Nov 20184330 udpReservedN/Alast updated 27 Nov 20184331 tcpktickets REST API for event management and ticketing systems (embedded POS devices)ktickets-restlast updated 27 Nov 20184331 udpReservedN/Alast updated 27 Nov 20184332 UnassignedN/Alast updated 27 Nov 20184333 tcpArrowHead Service Protocol (AHSP)ahsplast updated 27 Nov 20184333 udpArrowHead Service Protocol (AHSP)ahsplast updated 27 Nov 20184333 sctpArrowHead Service Protocol (AHSP)ahsplast updated 27 Nov 20184334 tcpNETCONF Call Home (SSH)netconf-ch-sshlast updated 27 Nov 20184334 udpReservedN/Alast updated 27 Nov 20184335 tcpNETCONF Call Home (TLS)netconf-ch-tlslast updated 27 Nov 20184335 udpReservedN/Alast updated 27 Nov 20184336 tcpRESTCONF Call Home (TLS)restconf-ch-tlslast updated 27 Nov 20184336 udpReservedN/Alast updated 27 Nov 20184337-4339 UnassignedN/Alast updated 27 Nov 20184340 tcpGaia Connector Protocolgaialast updated 27 Nov 20184340 udpGaia Connector Protocolgaialast updated 27 Nov 20184341 tcpLISP Data Packetslisp-datalast updated 27 Nov 20184341 udpLISP Data Packetslisp-datalast updated 27 Nov 20184342 tcpLISP-CONS Controllisp-conslast updated 27 Nov 20184342 udpLISP Control Packetslisp-controllast updated 27 Nov 20184343 tcpUNICALLunicalllast updated 27 Nov 20184343 udpUNICALLunicalllast updated 27 Nov 20184344 tcpVinaInstallvinainstalllast updated 27 Nov 20184344 udpVinaInstallvinainstalllast updated 27 Nov 20184345 tcpMacro 4 Network ASm4-network-aslast updated 27 Nov 20184345 udpMacro 4 Network ASm4-network-aslast updated 27 Nov 20184346 tcpELAN LMelanlmlast updated 27 Nov 20184346 udpELAN LMelanlmlast updated 27 Nov 20184347 tcpLAN Surveyorlansurveyorlast updated 27 Nov 20184347 udpLAN Surveyorlansurveyorlast updated 27 Nov 20184348 tcpITOSEitoselast updated 27 Nov 20184348 udpITOSEitoselast updated 27 Nov 20184349 tcpFile System Port Mapfsportmaplast updated 27 Nov 20184349 udpFile System Port Mapfsportmaplast updated 27 Nov 20184350 tcpNet Devicenet-devicelast updated 27 Nov 20184350 udpNet Devicenet-devicelast updated 27 Nov 20184351 tcpPLCY Net Servicesplcy-net-svcslast updated 27 Nov 20184351 udpPLCY Net Servicesplcy-net-svcslast updated 27 Nov 20184352 tcpProjector Linkpjlinklast updated 27 Nov 20184352 udpProjector Linkpjlinklast updated 27 Nov 20184353 tcpF5 iQueryf5-iquerylast updated 27 Nov 20184353 udpF5 iQueryf5-iquerylast updated 27 Nov 20184354 tcpQSNet Transmitterqsnet-translast updated 27 Nov 20184354 udpQSNet Transmitterqsnet-translast updated 27 Nov 20184355 tcpQSNet Workstationqsnet-workstlast updated 27 Nov 20184355 udpQSNet Workstationqsnet-workstlast updated 27 Nov 20184356 tcpQSNet Assistantqsnet-assistlast updated 27 Nov 20184356 udpQSNet Assistantqsnet-assistlast updated 27 Nov 20184357 tcpQSNet Conductorqsnet-condlast updated 27 Nov 20184357 udpQSNet Conductorqsnet-condlast updated 27 Nov 20184358 tcpQSNet Nucleusqsnet-nucllast updated 27 Nov 20184358 udpQSNet Nucleusqsnet-nucllast updated 27 Nov 20184359 tcpOMA BCAST Long-Term Key Messagesomabcastltkmlast updated 27 Nov 20184359 udpOMA BCAST Long-Term Key Messagesomabcastltkmlast updated 27 Nov 20184360 tcpMatrix VNet Communication Protocol IANA assigned this well-formed service name as a replacement for "matrix_vnet".matrix-vnetlast updated 27 Nov 20184360 tcp (matrix_vnet)Matrix VNet Communication Protocolmatrix_vnetlast updated 27 Nov 20184360 udpReservedN/Alast updated 27 Nov 20184361 tcpReservedN/Alast updated 27 Nov 20184361 udpNavCom Discovery and Control Portnacnllast updated 27 Nov 20184362 tcpReservedN/Alast updated 27 Nov 20184362 udpAFORE vNode Discovery protocolafore-vdp-disclast updated 27 Nov 20184363-4365 UnassignedN/Alast updated 27 Nov 20184366 udpShadowStream Systemshadowstreamlast updated 27 Nov 20184366 tcpReservedN/Alast updated 27 Nov 20184367 UnassignedN/Alast updated 27 Nov 20184368 tcpWeatherBrief Directwxbrieflast updated 27 Nov 20184368 udpWeatherBrief Directwxbrieflast updated 27 Nov 20184369 tcpErlang Port Mapper Daemonepmdlast updated 27 Nov 20184369 udpErlang Port Mapper Daemonepmdlast updated 27 Nov 20184370 tcpELPRO V2 Protocol Tunnel IANA assigned this well-formed service name as a replacement for "elpro_tunnel".elpro-tunnellast updated 27 Nov 20184370 tcp (elpro_tunnel)ELPRO V2 Protocol Tunnelelpro_tunnellast updated 27 Nov 20184370 udpELPRO V2 Protocol Tunnel IANA assigned this well-formed service name as a replacement for "elpro_tunnel".elpro-tunnellast updated 27 Nov 20184370 udp (elpro_tunnel)ELPRO V2 Protocol Tunnelelpro_tunnellast updated 27 Nov 20184371 tcpLAN2CAN Controll2c-controllast updated 27 Nov 20184371 udpLAN2CAN Discoveryl2c-disclast updated 27 Nov 20184372 tcpLAN2CAN Datal2c-datalast updated 27 Nov 20184372 udpLAN2CAN Datal2c-datalast updated 27 Nov 20184373 tcpRemote Authenticated Command Serviceremctllast updated 27 Nov 20184373 udpRemote Authenticated Command Serviceremctllast updated 27 Nov 20184374 tcpPSI Push-to-Talk Protocolpsi-pttlast updated 27 Nov 20184374 udpReservedN/Alast updated 27 Nov 20184375 tcpToltec EasySharetolteceslast updated 27 Nov 20184375 udpToltec EasySharetolteceslast updated 27 Nov 20184376 tcpBioAPI Interworkingbiplast updated 27 Nov 20184376 udpBioAPI Interworkingbiplast updated 27 Nov 20184377 tcpCambridge Pixel SPx Servercp-spxsvrlast updated 27 Nov 20184377 udpCambridge Pixel SPx Servercp-spxsvrlast updated 27 Nov 20184378 tcpCambridge Pixel SPx Displaycp-spxdpylast updated 27 Nov 20184378 udpCambridge Pixel SPx Displaycp-spxdpylast updated 27 Nov 20184379 tcpCTDBctdblast updated 27 Nov 20184379 udpCTDBctdblast updated 27 Nov 20184380-4388 UnassignedN/Alast updated 27 Nov 20184389 tcpXandros Community Management Servicexandros-cmslast updated 27 Nov 20184389 udpXandros Community Management Servicexandros-cmslast updated 27 Nov 20184390 tcpPhysical Access Controlwiegandlast updated 27 Nov 20184390 udpPhysical Access Controlwiegandlast updated 27 Nov 20184391 tcpAmerican Printware IMServer Protocolapwi-imserverlast updated 27 Nov 20184391 udpReservedN/Alast updated 27 Nov 20184392 tcpAmerican Printware RXServer Protocolapwi-rxserverlast updated 27 Nov 20184392 udpReservedN/Alast updated 27 Nov 20184393 tcpAmerican Printware RXSpooler Protocolapwi-rxspoolerlast updated 27 Nov 20184393 udpReservedN/Alast updated 27 Nov 20184394 tcpReservedN/Alast updated 27 Nov 20184394 udpAmerican Printware Discoveryapwi-disclast updated 27 Nov 20184395 tcpOmniVision communication for Virtual environmentsomnivisionesxlast updated 27 Nov 20184395 udpOmniVision communication for Virtual environmentsomnivisionesxlast updated 27 Nov 20184396 tcpFly Object Spaceflylast updated 27 Nov 20184396 udpReservedN/Alast updated 27 Nov 20184397-4399 UnassignedN/Alast updated 27 Nov 20184400 tcpASIGRA Servicesds-srvlast updated 27 Nov 20184400 udpASIGRA Servicesds-srvlast updated 27 Nov 20184401 tcpASIGRA Televaulting DS-System Serviceds-srvrlast updated 27 Nov 20184401 udpASIGRA Televaulting DS-System Serviceds-srvrlast updated 27 Nov 20184402 tcpASIGRA Televaulting DS-Client Serviceds-clntlast updated 27 Nov 20184402 udpASIGRA Televaulting DS-Client Serviceds-clntlast updated 27 Nov 20184403 tcpASIGRA Televaulting DS-Client Monitoring/Managementds-userlast updated 27 Nov 20184403 udpASIGRA Televaulting DS-Client Monitoring/Managementds-userlast updated 27 Nov 20184404 tcpASIGRA Televaulting DS-System Monitoring/Managementds-adminlast updated 27 Nov 20184404 udpASIGRA Televaulting DS-System Monitoring/Managementds-adminlast updated 27 Nov 20184405 tcpASIGRA Televaulting Message Level Restore serviceds-maillast updated 27 Nov 20184405 udpASIGRA Televaulting Message Level Restore serviceds-maillast updated 27 Nov 20184406 tcpASIGRA Televaulting DS-Sleeper Serviceds-slplast updated 27 Nov 20184406 udpASIGRA Televaulting DS-Sleeper Serviceds-slplast updated 27 Nov 20184407 tcpNetwork Access Control Agentnacagentlast updated 27 Nov 20184407 udpReservedN/Alast updated 27 Nov 20184408 tcpSLS Technology Control Centreslscclast updated 27 Nov 20184408 udpReservedN/Alast updated 27 Nov 20184409 tcpNet-Cabinet comunicationnetcabinet-comlast updated 27 Nov 20184409 udpReservedN/Alast updated 27 Nov 20184410 tcpRIB iTWO Application Serveritwo-serverlast updated 27 Nov 20184410 udpReservedN/Alast updated 27 Nov 20184411 tcpFound Messaging Protocolfoundlast updated 27 Nov 20184411 udpReservedN/Alast updated 27 Nov 20184412 tcpReservedN/Alast updated 27 Nov 20184412 udpSmallChatsmallchatlast updated 27 Nov 20184413 tcpAVI Systems NMSavi-nmslast updated 27 Nov 20184413 udpAVI Systems NMSavi-nms-disclast updated 27 Nov 20184414 tcpUpdog Monitoring and Status Frameworkupdoglast updated 27 Nov 20184414 udpReservedN/Alast updated 27 Nov 20184415 tcpBrocade Virtual Router Requestbrcd-vr-reqlast updated 27 Nov 20184415 udpReservedN/Alast updated 27 Nov 20184416 tcpPJJ Media Playerpjj-playerlast updated 27 Nov 20184416 udpPJJ Media Player discoverypjj-player-disclast updated 27 Nov 20184417 tcpWorkflow Director Communicationworkflowdirlast updated 27 Nov 20184417 udpReservedN/Alast updated 27 Nov 20184418 tcpReservedN/Alast updated 27 Nov 20184418 udpAXYS communication protocolaxysbridgelast updated 27 Nov 20184419 tcpColnod Binary Protocolcbplast updated 27 Nov 20184419 udpReservedN/Alast updated 27 Nov 20184420 tcpNVM Express over Fabrics storage accessnvmelast updated 27 Nov 20184420 udpNVM Express over Fabrics storage accessnvmelast updated 27 Nov 20184421 tcpMulti-Platform Remote Management for Cloud Infrastructurescaleftlast updated 27 Nov 20184421 udpReservedN/Alast updated 27 Nov 20184422 tcpTSEP Installation Service Protocoltsepisplast updated 27 Nov 20184422 udpReservedN/Alast updated 27 Nov 20184423 tcpthingkit secure meshthingkitlast updated 27 Nov 20184423 udpReservedN/Alast updated 27 Nov 20184424 UnassignedN/Alast updated 27 Nov 20184425 tcpNetROCKEY6 SMART Plus Servicenetrockey6last updated 27 Nov 20184425 udpNetROCKEY6 SMART Plus Servicenetrockey6last updated 27 Nov 20184426 tcpSMARTS Beacon Portbeacon-port-2last updated 27 Nov 20184426 udpSMARTS Beacon Portbeacon-port-2last updated 27 Nov 20184427 tcpDrizzle database serverdrizzlelast updated 27 Nov 20184427 udpReservedN/Alast updated 27 Nov 20184428 tcpOMV-Investigation Server-Clientomviserverlast updated 27 Nov 20184428 udpReservedN/Alast updated 27 Nov 20184429 tcpOMV Investigation Agent-Serveromviagentlast updated 27 Nov 20184429 udpReservedN/Alast updated 27 Nov 20184430 tcpREAL SQL Serverrsqlserverlast updated 27 Nov 20184430 udpREAL SQL Serverrsqlserverlast updated 27 Nov 20184431 tcpadWISE Pipewspipelast updated 27 Nov 20184431 udpReservedN/Alast updated 27 Nov 20184432 tcpL-ACOUSTICS managementl-acousticslast updated 27 Nov 20184432 udpL-ACOUSTICS managementl-acousticslast updated 27 Nov 20184433 tcpVersile Object Protocolvoplast updated 27 Nov 20184433 udpReservedN/Alast updated 27 Nov 20184434-4440 UnassignedN/Alast updated 27 Nov 20184441 tcpReservedN/Alast updated 27 Nov 20184441 udpNetblox Protocolnetbloxlast updated 27 Nov 20184442 tcpSarissarislast updated 27 Nov 20184442 udpSarissarislast updated 27 Nov 20184443 tcpPharospharoslast updated 27 Nov 20184443 udpPharospharoslast updated 27 Nov 20184444 tcpKRB524krb524last updated 27 Nov 20184444 udpKRB524krb524last updated 27 Nov 20184444 tcp (nv-video)NV Video defaultnv-videolast updated 27 Nov 20184444 udp (nv-video)NV Video defaultnv-videolast updated 27 Nov 20184445 tcpUPNOTIFYPupnotifyplast updated 27 Nov 20184445 udpUPNOTIFYPupnotifyplast updated 27 Nov 20184446 tcpN1-FWPn1-fwplast updated 27 Nov 20184446 udpN1-FWPn1-fwplast updated 27 Nov 20184447 tcpN1-RMGMTn1-rmgmtlast updated 27 Nov 20184447 udpN1-RMGMTn1-rmgmtlast updated 27 Nov 20184448 tcpASC Licence Managerasc-slmdlast updated 27 Nov 20184448 udpASC Licence Managerasc-slmdlast updated 27 Nov 20184449 tcpPrivateWireprivatewirelast updated 27 Nov 20184449 udpPrivateWireprivatewirelast updated 27 Nov 20184450 tcpCommon ASCII Messaging Protocolcamplast updated 27 Nov 20184450 udpCommon ASCII Messaging Protocolcamplast updated 27 Nov 20184451 tcpCTI System Msgctisystemmsglast updated 27 Nov 20184451 udpCTI System Msgctisystemmsglast updated 27 Nov 20184452 tcpCTI Program Loadctiprogramloadlast updated 27 Nov 20184452 udpCTI Program Loadctiprogramloadlast updated 27 Nov 20184453 tcpNSS Alert Managernssalertmgrlast updated 27 Nov 20184453 udpNSS Alert Managernssalertmgrlast updated 27 Nov 20184454 tcpNSS Agent Managernssagentmgrlast updated 27 Nov 20184454 udpNSS Agent Managernssagentmgrlast updated 27 Nov 20184455 tcpPR Chat Userprchat-userlast updated 27 Nov 20184455 udpPR Chat Userprchat-userlast updated 27 Nov 20184456 tcpPR Chat Serverprchat-serverlast updated 27 Nov 20184456 udpPR Chat Serverprchat-serverlast updated 27 Nov 20184457 tcpPR RegisterprRegisterlast updated 27 Nov 20184457 udpPR RegisterprRegisterlast updated 27 Nov 20184458 tcpMatrix Configuration Protocolmcplast updated 27 Nov 20184458 udpMatrix Configuration Protocolmcplast updated 27 Nov 20184459-4483 UnassignedN/Alast updated 27 Nov 20184484 tcphpssmgmt servicehpssmgmtlast updated 27 Nov 20184484 udphpssmgmt servicehpssmgmtlast updated 27 Nov 20184485 tcpAssyst Data Repository Serviceassyst-drlast updated 27 Nov 20184485 udpReservedN/Alast updated 27 Nov 20184486 tcpIntegrated Client Message Serviceicmslast updated 27 Nov 20184486 udpIntegrated Client Message Serviceicmslast updated 27 Nov 20184487 tcpProtocol for Remote Execution over TCPprex-tcplast updated 27 Nov 20184487 udpReservedN/Alast updated 27 Nov 20184488 tcpApple Wide Area Connectivity Service ICE Bootstrapawacs-icelast updated 27 Nov 20184488 udpApple Wide Area Connectivity Service ICE Bootstrapawacs-icelast updated 27 Nov 20184489-4499 UnassignedN/Alast updated 27 Nov 20184500 tcpIPsec NAT-Traversalipsec-nat-tlast updated 27 Nov 20184500 udpIPsec NAT-Traversalipsec-nat-tlast updated 27 Nov 20184501 UnassignedN/Alast updated 27 Nov 20184502 sctpA25 (FAP-FGW)a25-fap-fgwlast updated 27 Nov 20184503-4533 UnassignedN/Alast updated 27 Nov 20184534 tcpReservedN/Alast updated 27 Nov 20184534 udpArmagetron Advanced Game Serverarmagetronadlast updated 27 Nov 20184535 tcpEvent Heap Serverehslast updated 27 Nov 20184535 udpEvent Heap Serverehslast updated 27 Nov 20184536 tcpEvent Heap Server SSLehs-ssllast updated 27 Nov 20184536 udpEvent Heap Server SSLehs-ssllast updated 27 Nov 20184537 tcpWSS Security Servicewssauthsvclast updated 27 Nov 20184537 udpWSS Security Servicewssauthsvclast updated 27 Nov 20184538 tcpSoftware Data Exchange Gatewayswx-gatelast updated 27 Nov 20184538 udpSoftware Data Exchange Gatewayswx-gatelast updated 27 Nov 20184539-4544 UnassignedN/Alast updated 27 Nov 20184545 tcpWorldScoresworldscoreslast updated 27 Nov 20184545 udpWorldScoresworldscoreslast updated 27 Nov 20184546 tcpSF License Manager (Sentinel)sf-lmlast updated 27 Nov 20184546 udpSF License Manager (Sentinel)sf-lmlast updated 27 Nov 20184547 tcpLanner License Managerlanner-lmlast updated 27 Nov 20184547 udpLanner License Managerlanner-lmlast updated 27 Nov 20184548 tcpSynchromeshsynchromeshlast updated 27 Nov 20184548 udpSynchromeshsynchromeshlast updated 27 Nov 20184549 tcpAegate PMR Serviceaegatelast updated 27 Nov 20184549 udpAegate PMR Serviceaegatelast updated 27 Nov 20184550 tcpPerman I Interbase Servergds-adppiw-dblast updated 27 Nov 20184550 udpPerman I Interbase Servergds-adppiw-dblast updated 27 Nov 20184551 tcpMIH Servicesieee-mihlast updated 27 Nov 20184551 udpMIH Servicesieee-mihlast updated 27 Nov 20184552 tcpMen and Mice Monitoringmenandmice-monlast updated 27 Nov 20184552 udpMen and Mice Monitoringmenandmice-monlast updated 27 Nov 20184553 tcpICS host servicesicshostsvclast updated 27 Nov 20184553 udpReservedN/Alast updated 27 Nov 20184554 tcpMS FRS Replicationmsfrslast updated 27 Nov 20184554 udpMS FRS Replicationmsfrslast updated 27 Nov 20184555 tcpRSIP Portrsiplast updated 27 Nov 20184555 udpRSIP Portrsiplast updated 27 Nov 20184556 tcpDTN Bundle TCP CL Protocoldtn-bundlelast updated 27 Nov 20184556 udpDTN Bundle UDP CL Protocoldtn-bundlelast updated 27 Nov 20184556 dccpDTN Bundle DCCP CL Protocoldtn-bundlelast updated 27 Nov 20184557 tcpReservedN/Alast updated 27 Nov 20184557 udpMarathon everRun Quorum Service Servermtcevrunqsslast updated 27 Nov 20184558 tcpReservedN/Alast updated 27 Nov 20184558 udpMarathon everRun Quorum Service Managermtcevrunqmanlast updated 27 Nov 20184559 tcpHylaFAXhylafaxlast updated 27 Nov 20184559 udpHylaFAXhylafaxlast updated 27 Nov 20184560-4562 UnassignedN/Alast updated 27 Nov 20184563 tcpAmahi Anywhereamahi-anywherelast updated 27 Nov 20184563 udpReservedN/Alast updated 27 Nov 20184564-4565 UnassignedN/Alast updated 27 Nov 20184566 tcpKids Watch Time Control Servicekwtclast updated 27 Nov 20184566 udpKids Watch Time Control Servicekwtclast updated 27 Nov 20184567 tcpTRAMtramlast updated 27 Nov 20184567 udpTRAMtramlast updated 27 Nov 20184568 tcpBMC Reportingbmc-reportinglast updated 27 Nov 20184568 udpBMC Reportingbmc-reportinglast updated 27 Nov 20184569 tcpInter-Asterisk eXchangeiaxlast updated 27 Nov 20184569 udpInter-Asterisk eXchangeiaxlast updated 27 Nov 20184570 tcpService to distribute and update within a site deployment information for Oracle Communications Suitedeploymentmaplast updated 27 Nov 20184570 udpReservedN/Alast updated 27 Nov 20184571-4572 UnassignedN/Alast updated 27 Nov 20184573 tcpA port for communication between a server and client for a custom backup systemcardifftec-backlast updated 27 Nov 20184573 udpReservedN/Alast updated 27 Nov 20184574-4589 UnassignedN/Alast updated 27 Nov 20184590 tcpRID over HTTP/TLSridlast updated 27 Nov 20184590 udpReservedN/Alast updated 27 Nov 20184591 tcpHRPD L3T (AT-AN)l3t-at-anlast updated 27 Nov 20184591 udpHRPD L3T (AT-AN)l3t-at-anlast updated 27 Nov 20184592 tcpReservedN/Alast updated 27 Nov 20184592 udpHRPD-ITH (AT-AN)hrpd-ith-at-anlast updated 27 Nov 20184593 tcpIPT (ANRI-ANRI)ipt-anri-anrilast updated 27 Nov 20184593 udpIPT (ANRI-ANRI)ipt-anri-anrilast updated 27 Nov 20184594 tcpIAS-Session (ANRI-ANRI)ias-sessionlast updated 27 Nov 20184594 udpIAS-Session (ANRI-ANRI)ias-sessionlast updated 27 Nov 20184595 tcpIAS-Paging (ANRI-ANRI)ias-paginglast updated 27 Nov 20184595 udpIAS-Paging (ANRI-ANRI)ias-paginglast updated 27 Nov 20184596 tcpIAS-Neighbor (ANRI-ANRI)ias-neighborlast updated 27 Nov 20184596 udpIAS-Neighbor (ANRI-ANRI)ias-neighborlast updated 27 Nov 20184597 tcpA21 (AN-1xBS)a21-an-1xbslast updated 27 Nov 20184597 udpA21 (AN-1xBS)a21-an-1xbslast updated 27 Nov 20184598 tcpA16 (AN-AN)a16-an-anlast updated 27 Nov 20184598 udpA16 (AN-AN)a16-an-anlast updated 27 Nov 20184599 tcpA17 (AN-AN)a17-an-anlast updated 27 Nov 20184599 udpA17 (AN-AN)a17-an-anlast updated 27 Nov 20184600 tcpPiranha1piranha1last updated 27 Nov 20184600 udpPiranha1piranha1last updated 27 Nov 20184601 tcpPiranha2piranha2last updated 27 Nov 20184601 udpPiranha2piranha2last updated 27 Nov 20184602 tcpEAX MTS Servermtsserverlast updated 27 Nov 20184602 udpReservedN/Alast updated 27 Nov 20184603 tcpMen & Mice Upgrade Agentmenandmice-upglast updated 27 Nov 20184603 udpReservedN/Alast updated 27 Nov 20184604 tcpIdentity Registration Protocolirplast updated 27 Nov 20184604 udpReservedN/Alast updated 27 Nov 20184605 tcpDirect End to End Secure Chat Protocolsixchatlast updated 27 Nov 20184605 udpReservedN/Alast updated 27 Nov 20184606-4620 UnassignedN/Alast updated 27 Nov 20184621 tcpReservedN/Alast updated 27 Nov 20184621 udpBidirectional single port remote radio VOIP and Control streamventosolast updated 27 Nov 20184622-4657 UnassignedN/Alast updated 27 Nov 20184658 tcpPlayStation2 App Portplaysta2-applast updated 27 Nov 20184658 udpPlayStation2 App Portplaysta2-applast updated 27 Nov 20184659 tcpPlayStation2 Lobby Portplaysta2-loblast updated 27 Nov 20184659 udpPlayStation2 Lobby Portplaysta2-loblast updated 27 Nov 20184660 tcpsmaclmgrsmaclmgrlast updated 27 Nov 20184660 udpsmaclmgrsmaclmgrlast updated 27 Nov 20184661 tcpKar2ouche Peer location servicekar2ouchelast updated 27 Nov 20184661 udpKar2ouche Peer location servicekar2ouchelast updated 27 Nov 20184662 tcpOrbitNet Message Serviceomslast updated 27 Nov 20184662 udpOrbitNet Message Serviceomslast updated 27 Nov 20184663 tcpNote It! Message Servicenoteitlast updated 27 Nov 20184663 udpNote It! Message Servicenoteitlast updated 27 Nov 20184664 tcpRimage Messaging Serveremslast updated 27 Nov 20184664 udpRimage Messaging Serveremslast updated 27 Nov 20184665 tcpContainer Client Message Servicecontclientmslast updated 27 Nov 20184665 udpContainer Client Message Servicecontclientmslast updated 27 Nov 20184666 tcpE-Port Message Serviceeportcommlast updated 27 Nov 20184666 udpE-Port Message Serviceeportcommlast updated 27 Nov 20184667 tcpMMA Comm Servicesmmacommlast updated 27 Nov 20184667 udpMMA Comm Servicesmmacommlast updated 27 Nov 20184668 tcpMMA EDS Servicemmaedslast updated 27 Nov 20184668 udpMMA EDS Servicemmaedslast updated 27 Nov 20184669 tcpE-Port Data Serviceeportcommdatalast updated 27 Nov 20184669 udpE-Port Data Serviceeportcommdatalast updated 27 Nov 20184670 tcpLight packets transfer protocollightlast updated 27 Nov 20184670 udpLight packets transfer protocollightlast updated 27 Nov 20184671 tcpBull RSF action serveracterlast updated 27 Nov 20184671 udpBull RSF action serveracterlast updated 27 Nov 20184672 tcpremote file access serverrfalast updated 27 Nov 20184672 udpremote file access serverrfalast updated 27 Nov 20184673 tcpCXWS Operationscxwslast updated 27 Nov 20184673 udpCXWS Operationscxwslast updated 27 Nov 20184674 tcpAppIQ Agent Managementappiq-mgmtlast updated 27 Nov 20184674 udpAppIQ Agent Managementappiq-mgmtlast updated 27 Nov 20184675 tcpBIAP Device Statusdhct-statuslast updated 27 Nov 20184675 udpBIAP Device Statusdhct-statuslast updated 27 Nov 20184676 tcpBIAP Generic Alertdhct-alertslast updated 27 Nov 20184676 udpBIAP Generic Alertdhct-alertslast updated 27 Nov 20184677 tcpBusiness Continuity Servibcslast updated 27 Nov 20184677 udpBusiness Continuity Servibcslast updated 27 Nov 20184678 tcpboundary traversaltraversallast updated 27 Nov 20184678 udpboundary traversaltraversallast updated 27 Nov 20184679 tcpMGE UPS Supervisionmgesupervisionlast updated 27 Nov 20184679 udpMGE UPS Supervisionmgesupervisionlast updated 27 Nov 20184680 tcpMGE UPS Managementmgemanagementlast updated 27 Nov 20184680 udpMGE UPS Managementmgemanagementlast updated 27 Nov 20184681 tcpParliant Telephony Systemparliantlast updated 27 Nov 20184681 udpParliant Telephony Systemparliantlast updated 27 Nov 20184682 tcpfinisarfinisarlast updated 27 Nov 20184682 udpfinisarfinisarlast updated 27 Nov 20184683 tcpSpike Clipboard Servicespikelast updated 27 Nov 20184683 udpSpike Clipboard Servicespikelast updated 27 Nov 20184684 tcpRFID Reader Protocol 1.0rfid-rp1last updated 27 Nov 20184684 udpRFID Reader Protocol 1.0rfid-rp1last updated 27 Nov 20184685 tcpAutopac Protocolautopaclast updated 27 Nov 20184685 udpAutopac Protocolautopaclast updated 27 Nov 20184686 tcpManina Service Protocolmsp-oslast updated 27 Nov 20184686 udpManina Service Protocolmsp-oslast updated 27 Nov 20184687 tcpNetwork Scanner Tool FTPnstlast updated 27 Nov 20184687 udpNetwork Scanner Tool FTPnstlast updated 27 Nov 20184688 tcpMobile P2P Servicemobile-p2plast updated 27 Nov 20184688 udpMobile P2P Servicemobile-p2plast updated 27 Nov 20184689 tcpAltova DatabaseCentralaltovacentrallast updated 27 Nov 20184689 udpAltova DatabaseCentralaltovacentrallast updated 27 Nov 20184690 tcpPrelude IDS message protopreludelast updated 27 Nov 20184690 udpPrelude IDS message protopreludelast updated 27 Nov 20184691 tcpmonotone Netsync Protocolmtnlast updated 27 Nov 20184691 udpmonotone Netsync Protocolmtnlast updated 27 Nov 20184692 tcpConspiracy messagingconspiracylast updated 27 Nov 20184692 udpConspiracy messagingconspiracylast updated 27 Nov 20184693-4699 UnassignedN/Alast updated 27 Nov 20184700 tcpNetXMS Agentnetxms-agentlast updated 27 Nov 20184700 udpNetXMS Agentnetxms-agentlast updated 27 Nov 20184701 tcpNetXMS Managementnetxms-mgmtlast updated 27 Nov 20184701 udpNetXMS Managementnetxms-mgmtlast updated 27 Nov 20184702 tcpNetXMS Server Synchronizationnetxms-synclast updated 27 Nov 20184702 udpNetXMS Server Synchronizationnetxms-synclast updated 27 Nov 20184703 tcpNetwork Performance Quality Evaluation System Test Servicenpqes-testlast updated 27 Nov 20184703 udpReservedN/Alast updated 27 Nov 20184704 tcpAssuria Insiderassuria-inslast updated 27 Nov 20184704 udpReservedN/Alast updated 27 Nov 20184705-4710 UnassignedN/Alast updated 27 Nov 20184711 tcpTrinity Trust Network Node Communicationtrinity-distlast updated 27 Nov 20184711 udpTrinity Trust Network Node Communicationtrinity-distlast updated 27 Nov 20184711 sctpTrinity Trust Network Node Communicationtrinity-distlast updated 27 Nov 20184712-4724 UnassignedN/Alast updated 27 Nov 20184725 tcpTruckStar Servicetruckstarlast updated 27 Nov 20184725 udpTruckStar Servicetruckstarlast updated 27 Nov 20184726 tcpReservedN/Alast updated 27 Nov 20184726 udpA26 (FAP-FGW)a26-fap-fgwlast updated 27 Nov 20184727 tcpF-Link Client Information Servicefcislast updated 27 Nov 20184727 udpF-Link Client Information Service Discoveryfcis-disclast updated 27 Nov 20184728 tcpCA Port Multiplexercapmuxlast updated 27 Nov 20184728 udpCA Port Multiplexercapmuxlast updated 27 Nov 20184729 tcpReservedN/Alast updated 27 Nov 20184729 udpGSM Interface Tapgsmtaplast updated 27 Nov 20184730 tcpGearman Job Queue Systemgearmanlast updated 27 Nov 20184730 udpGearman Job Queue Systemgearmanlast updated 27 Nov 20184731 tcpRemote Capture Protocolremcaplast updated 27 Nov 20184731 udpReservedN/Alast updated 27 Nov 20184732 tcpReservedN/Alast updated 27 Nov 20184732 udpOHM server triggerohmtriggerlast updated 27 Nov 20184733 tcpRES Orchestration Catalog Servicesresorcslast updated 27 Nov 20184733 udpReservedN/Alast updated 27 Nov 20184734-4736 UnassignedN/Alast updated 27 Nov 20184737 tcpIPDR/SPipdr-splast updated 27 Nov 20184737 udpIPDR/SPipdr-splast updated 27 Nov 20184738 tcpSoleraTec Locatorsolera-lpnlast updated 27 Nov 20184738 udpSoleraTec Locatorsolera-lpnlast updated 27 Nov 20184739 tcpIP Flow Info Exportipfixlast updated 27 Nov 20184739 udpIP Flow Info Exportipfixlast updated 27 Nov 20184739 sctpIP Flow Info Exportipfixlast updated 27 Nov 20184740 tcpipfix protocol over TLSipfixslast updated 27 Nov 20184740 sctpipfix protocol over DTLSipfixslast updated 27 Nov 20184740 udpipfix protocol over DTLSipfixslast updated 27 Nov 20184741 tcpLuminizer Managerlumimgrdlast updated 27 Nov 20184741 udpLuminizer Managerlumimgrdlast updated 27 Nov 20184742 tcpSICCTsicctlast updated 27 Nov 20184742 udpSICCT Service Discovery Protocolsicct-sdplast updated 27 Nov 20184743 tcpopenhpi HPI serviceopenhpidlast updated 27 Nov 20184743 udpopenhpi HPI serviceopenhpidlast updated 27 Nov 20184744 tcpInternet File Synchronization Protocolifsplast updated 27 Nov 20184744 udpInternet File Synchronization Protocolifsplast updated 27 Nov 20184745 tcpFunambol Mobile Pushfmplast updated 27 Nov 20184745 udpFunambol Mobile Pushfmplast updated 27 Nov 20184746 tcpReservedN/Alast updated 27 Nov 20184746 udpIntelliAdmin Discoveryintelliadm-disclast updated 27 Nov 20184747 udppeer-to-peer file exchange protocolbuschtrommellast updated 27 Nov 20184747 tcpReservedN/Alast updated 27 Nov 20184748-4748 UnassignedN/Alast updated 27 Nov 20184749 tcpProfile for Macprofilemaclast updated 27 Nov 20184749 udpProfile for Macprofilemaclast updated 27 Nov 20184750 tcpSimple Service Auto Discoveryssadlast updated 27 Nov 20184750 udpSimple Service Auto Discoveryssadlast updated 27 Nov 20184751 tcpSimple Policy Control Protocolspocplast updated 27 Nov 20184751 udpSimple Policy Control Protocolspocplast updated 27 Nov 20184752 tcpSimple Network Audio Protocolsnaplast updated 27 Nov 20184752 udpSimple Network Audio Protocolsnaplast updated 27 Nov 20184753 tcpSimple Invocation of Methods Over Network (SIMON)simonlast updated 27 Nov 20184753 udpSimple Invocation of Methods Over Network (SIMON) Discoverysimon-disclast updated 27 Nov 20184754 tcpReservedN/Alast updated 27 Nov 20184754 udpGRE-in-UDP Encapsulationgre-in-udplast updated 27 Nov 20184755 tcpReservedN/Alast updated 27 Nov 20184755 udpGRE-in-UDP Encapsulation with DTLSgre-udp-dtlslast updated 27 Nov 20184756 tcpReticle Decision CenterRDCenterlast updated 27 Nov 20184756 udpReservedN/Alast updated 27 Nov 20184757-4773 UnassignedN/Alast updated 27 Nov 20184774 tcpConverge RPCconvergelast updated 27 Nov 20184774 udpReservedN/Alast updated 27 Nov 20184775-4783 UnassignedN/Alast updated 27 Nov 20184784 tcpBFD Multihop Controlbfd-multi-ctllast updated 27 Nov 20184784 udpBFD Multihop Controlbfd-multi-ctllast updated 27 Nov 20184785 tcpReservedN/Alast updated 27 Nov 20184785 udpCisco Nexus Control Protocolcncplast updated 27 Nov 20184786 tcpSmart Install Servicesmart-installlast updated 27 Nov 20184786 udpReservedN/Alast updated 27 Nov 20184787 tcpService Insertion Architecture (SIA) Control-Planesia-ctrl-planelast updated 27 Nov 20184787 udpReservedN/Alast updated 27 Nov 20184788 tcpeXtensible Messaging Client Protocolxmcplast updated 27 Nov 20184788 udpReservedN/Alast updated 27 Nov 20184789 udpVirtual eXtensible Local Area Network (VXLAN)vxlanlast updated 27 Nov 20184789 tcpReservedN/Alast updated 27 Nov 20184790 udpGeneric Protocol Extension for Virtual eXtensible Local Area Network (VXLAN)vxlan-gpelast updated 27 Nov 20184790 tcpReservedN/Alast updated 27 Nov 20184791 udpIP Routable RocErocelast updated 27 Nov 20184791 tcpReservedN/Alast updated 27 Nov 20184792-4799 UnassignedN/Alast updated 27 Nov 20184800 tcpIcona Instant Messenging Systemiimslast updated 27 Nov 20184800 udpIcona Instant Messenging Systemiimslast updated 27 Nov 20184801 tcpIcona Web Embedded Chatiweclast updated 27 Nov 20184801 udpIcona Web Embedded Chatiweclast updated 27 Nov 20184802 tcpIcona License System Serverilsslast updated 27 Nov 20184802 udpIcona License System Serverilsslast updated 27 Nov 20184803 tcpNotateit Messagingnotateitlast updated 27 Nov 20184803 udpNotateit Messaging Discoverynotateit-disclast updated 27 Nov 20184804 tcpReservedN/Alast updated 27 Nov 20184804 udpAJA ntv4 Video System Discoveryaja-ntv4-disclast updated 27 Nov 20184805-4826 UnassignedN/Alast updated 27 Nov 20184827 tcpHTCPhtcplast updated 27 Nov 20184827 udpHTCPhtcplast updated 27 Nov 20184828-4836 UnassignedN/Alast updated 27 Nov 20184837 tcpVaradero-0varadero-0last updated 27 Nov 20184837 udpVaradero-0varadero-0last updated 27 Nov 20184838 tcpVaradero-1varadero-1last updated 27 Nov 20184838 udpVaradero-1varadero-1last updated 27 Nov 20184839 tcpVaradero-2varadero-2last updated 27 Nov 20184839 udpVaradero-2varadero-2last updated 27 Nov 20184840 tcpOPC UA Connection Protocolopcua-tcplast updated 27 Nov 20184840 udpOPC UA Multicast Datagram Protocolopcua-udplast updated 27 Nov 20184841 tcpQUOSA Virtual Library Servicequosalast updated 27 Nov 20184841 udpQUOSA Virtual Library Servicequosalast updated 27 Nov 20184842 tcpnCode ICE-flow Library AppServergw-asvlast updated 27 Nov 20184842 udpnCode ICE-flow Library AppServergw-asvlast updated 27 Nov 20184843 tcpOPC UA TCP Protocol over TLS/SSLopcua-tlslast updated 27 Nov 20184843 udpOPC UA TCP Protocol over TLS/SSLopcua-tlslast updated 27 Nov 20184844 tcpnCode ICE-flow Library LogServergw-loglast updated 27 Nov 20184844 udpnCode ICE-flow Library LogServergw-loglast updated 27 Nov 20184845 tcpWordCruncher Remote Library Servicewcr-remliblast updated 27 Nov 20184845 udpWordCruncher Remote Library Servicewcr-remliblast updated 27 Nov 20184846 tcpContamac ICM Service IANA assigned this well-formed service name as a replacement for "contamac_icm".contamac-icmlast updated 27 Nov 20184846 tcp (contamac_icm)Contamac ICM Servicecontamac_icmlast updated 27 Nov 20184846 udpContamac ICM Service IANA assigned this well-formed service name as a replacement for "contamac_icm".contamac-icmlast updated 27 Nov 20184846 udp (contamac_icm)Contamac ICM Servicecontamac_icmlast updated 27 Nov 20184847 tcpWeb Fresh Communicationwfclast updated 27 Nov 20184847 udpWeb Fresh Communicationwfclast updated 27 Nov 20184848 tcpApp Server - Admin HTTPappserv-httplast updated 27 Nov 20184848 udpApp Server - Admin HTTPappserv-httplast updated 27 Nov 20184849 tcpApp Server - Admin HTTPSappserv-httpslast updated 27 Nov 20184849 udpApp Server - Admin HTTPSappserv-httpslast updated 27 Nov 20184850 tcpSun App Server - NAsun-as-nodeagtlast updated 27 Nov 20184850 udpSun App Server - NAsun-as-nodeagtlast updated 27 Nov 20184851 tcpApache Derby Replicationderby-replilast updated 27 Nov 20184851 udpApache Derby Replicationderby-replilast updated 27 Nov 20184852-4866 UnassignedN/Alast updated 27 Nov 20184867 tcpUnify Debuggerunify-debuglast updated 27 Nov 20184867 udpUnify Debuggerunify-debuglast updated 27 Nov 20184868 tcpPhoton Relayphrelaylast updated 27 Nov 20184868 udpPhoton Relayphrelaylast updated 27 Nov 20184869 tcpPhoton Relay Debugphrelaydbglast updated 27 Nov 20184869 udpPhoton Relay Debugphrelaydbglast updated 27 Nov 20184870 tcpCitcom Tracking Servicecc-trackinglast updated 27 Nov 20184870 udpCitcom Tracking Servicecc-trackinglast updated 27 Nov 20184871 tcpWiredwiredlast updated 27 Nov 20184871 udpWiredwiredlast updated 27 Nov 20184872-4875 UnassignedN/Alast updated 27 Nov 20184876 tcpTritium CAN Bus Bridge Servicetritium-canlast updated 27 Nov 20184876 udpTritium CAN Bus Bridge Servicetritium-canlast updated 27 Nov 20184877 tcpLighting Management Control Systemlmcslast updated 27 Nov 20184877 udpLighting Management Control Systemlmcslast updated 27 Nov 20184878 tcpReservedN/Alast updated 27 Nov 20184878 udpAgilent Instrument Discoveryinst-discoverylast updated 27 Nov 20184879 tcpWSDL Event Receiverwsdl-eventlast updated 27 Nov 20184879 udpReservedN/Alast updated 27 Nov 20184880 tcpIVI High-Speed LAN Instrument Protocolhisliplast updated 27 Nov 20184880 udpReservedN/Alast updated 27 Nov 20184881 tcpReservedN/Alast updated 27 Nov 20184881 udpSOCP Time Synchronization Protocolsocp-tlast updated 27 Nov 20184882 tcpReservedN/Alast updated 27 Nov 20184882 udpSOCP Control Protocolsocp-clast updated 27 Nov 20184883 tcpMeier-Phelps License Serverwmlserverlast updated 27 Nov 20184883 udpReservedN/Alast updated 27 Nov 20184884 tcpHiveStor Distributed File Systemhivestorlast updated 27 Nov 20184884 udpHiveStor Distributed File Systemhivestorlast updated 27 Nov 20184885 tcpABBSabbslast updated 27 Nov 20184885 udpABBSabbslast updated 27 Nov 20184886-4887 UnassignedN/Alast updated 27 Nov 20184888 tcpxcap code analysis portal public user accessxcap-portallast updated 27 Nov 20184888 udpReservedN/Alast updated 27 Nov 20184889 tcpxcap code analysis portal cluster control and administrationxcap-controllast updated 27 Nov 20184889 udpReservedN/Alast updated 27 Nov 20184890-4893 UnassignedN/Alast updated 27 Nov 20184894 tcpLysKOM Protocol Alyskomlast updated 27 Nov 20184894 udpLysKOM Protocol Alyskomlast updated 27 Nov 20184895-4898 UnassignedN/Alast updated 27 Nov 20184899 tcpRAdmin Portradmin-portlast updated 27 Nov 20184899 udpRAdmin Portradmin-portlast updated 27 Nov 20184900 tcpHFSQL Client/Server Database Enginehfcslast updated 27 Nov 20184900 udpHFSQL Client/Server Database Enginehfcslast updated 27 Nov 20184901 tcpFileLocator Remote Search Agent IANA assigned this well-formed service name as a replacement for "flr_agent".flr-agentlast updated 27 Nov 20184901 tcp (flr_agent)FileLocator Remote Search Agentflr_agentlast updated 27 Nov 20184901 udpReservedN/Alast updated 27 Nov 20184902 tcpmagicCONROL RF and Data Interfacemagiccontrollast updated 27 Nov 20184902 udpReservedN/Alast updated 27 Nov 20184903-4911 UnassignedN/Alast updated 27 Nov 20184912 tcpTechnicolor LUT Access Protocollutaplast updated 27 Nov 20184912 udpReservedN/Alast updated 27 Nov 20184913 tcpLUTher Control Protocollutcplast updated 27 Nov 20184914 tcpBones Remote Controlboneslast updated 27 Nov 20184914 udpBones Remote Controlboneslast updated 27 Nov 20184915 tcpFibics Remote Control Servicefrcslast updated 27 Nov 20184915 udpReservedN/Alast updated 27 Nov 20184916-4935 UnassignedN/Alast updated 27 Nov 20184936 udpSignal protocol port for autonomic networkingan-signalinglast updated 27 Nov 20184936 tcpReservedN/Alast updated 27 Nov 20184937 tcpReservedN/Alast updated 27 Nov 20184937 udpATSC-M/H Service Signaling Channelatsc-mh-ssclast updated 27 Nov 20184938-4939 UnassignedN/Alast updated 27 Nov 20184940 tcpEquitrac Officeeq-office-4940last updated 27 Nov 20184940 udpEquitrac Officeeq-office-4940last updated 27 Nov 20184941 tcpEquitrac Officeeq-office-4941last updated 27 Nov 20184941 udpEquitrac Officeeq-office-4941last updated 27 Nov 20184942 tcpEquitrac Officeeq-office-4942last updated 27 Nov 20184942 udpEquitrac Officeeq-office-4942last updated 27 Nov 20184943-4948 UnassignedN/Alast updated 27 Nov 20184949 tcpMunin Graphing Frameworkmuninlast updated 27 Nov 20184949 udpMunin Graphing Frameworkmuninlast updated 27 Nov 20184950 tcpSybase Server Monitorsybasesrvmonlast updated 27 Nov 20184950 udpSybase Server Monitorsybasesrvmonlast updated 27 Nov 20184951 tcpPWG WIMSpwgwimslast updated 27 Nov 20184951 udpPWG WIMSpwgwimslast updated 27 Nov 20184952 tcpSAG Directory Serversagxtsdslast updated 27 Nov 20184952 udpSAG Directory Serversagxtsdslast updated 27 Nov 20184953 tcpSynchronization Arbiterdbsyncarbiterlast updated 27 Nov 20184953 udpReservedN/Alast updated 27 Nov 20184954-4968 UnassignedN/Alast updated 27 Nov 20184969 tcpCCSS QMessageMonitorccss-qmmlast updated 27 Nov 20184969 udpCCSS QMessageMonitorccss-qmmlast updated 27 Nov 20184970 tcpCCSS QSystemMonitorccss-qsmlast updated 27 Nov 20184970 udpCCSS QSystemMonitorccss-qsmlast updated 27 Nov 20184971 tcpBackUp and Restore Programburplast updated 27 Nov 20184971 udpReservedN/Alast updated 27 Nov 20184972-4979 UnassignedN/Alast updated 27 Nov 20184980 udpCitrix Virtual Pathctxs-vpplast updated 27 Nov 20184980 tcpReservedN/Alast updated 27 Nov 20184981-4982 UnassignedN/Alast updated 27 Nov 20184983 UnassignedN/Alast updated 27 Nov 20184984 tcpWebYastwebyastlast updated 27 Nov 20184984 udpReservedN/Alast updated 27 Nov 20184985 tcpGER HC Standardgerhcslast updated 27 Nov 20184985 udpReservedN/Alast updated 27 Nov 20184986 tcpModel Railway Interface Programmriplast updated 27 Nov 20184986 udpModel Railway Interface Programmriplast updated 27 Nov 20184987 tcpSMAR Ethernet Port 1smar-se-port1last updated 27 Nov 20184987 udpSMAR Ethernet Port 1smar-se-port1last updated 27 Nov 20184988 tcpSMAR Ethernet Port 2smar-se-port2last updated 27 Nov 20184988 udpSMAR Ethernet Port 2smar-se-port2last updated 27 Nov 20184989 tcpParallel for GAUSS (tm)parallellast updated 27 Nov 20184989 udpParallel for GAUSS (tm)parallellast updated 27 Nov 20184990 tcpBusySync Calendar Synch. Protocolbusycallast updated 27 Nov 20184990 udpBusySync Calendar Synch. Protocolbusycallast updated 27 Nov 20184991 tcpVITA Radio Transportvrtlast updated 27 Nov 20184991 udpVITA Radio Transportvrtlast updated 27 Nov 20184992-4998 UnassignedN/Alast updated 27 Nov 20184999 tcpHFSQL Client/Server Database Engine Managerhfcs-managerlast updated 27 Nov 20184999 udpHFSQL Client/Server Database Engine Managerhfcs-managerlast updated 27 Nov 20185000 tcp-commplex-mainlast updated 27 Nov 20185000 udp-commplex-mainlast updated 27 Nov 20185001 tcp-commplex-linklast updated 27 Nov 20185001 udp-commplex-linklast updated 27 Nov 20185002 tcpradio free ethernetrfelast updated 27 Nov 20185002 udpradio free ethernetrfelast updated 27 Nov 20185003 tcpFileMaker, Inc. - Proprietary transportfmpro-internallast updated 27 Nov 20185003 udpFileMaker, Inc. - Proprietary name bindingfmpro-internallast updated 27 Nov 20185004 tcpRTP media dataavt-profile-1last updated 27 Nov 20185004 udpRTP media dataavt-profile-1last updated 27 Nov 20185004 dccpRTP media dataavt-profile-1last updated 27 Nov 20185005 tcpRTP control protocolavt-profile-2last updated 27 Nov 20185005 udpRTP control protocolavt-profile-2last updated 27 Nov 20185005 dccpRTP control protocolavt-profile-2last updated 27 Nov 20185006 tcpwsm serverwsm-serverlast updated 27 Nov 20185006 udpwsm serverwsm-serverlast updated 27 Nov 20185007 tcpwsm server sslwsm-server-ssllast updated 27 Nov 20185007 udpwsm server sslwsm-server-ssllast updated 27 Nov 20185008 tcpSynapsis EDGEsynapsis-edgelast updated 27 Nov 20185008 udpSynapsis EDGEsynapsis-edgelast updated 27 Nov 20185009 tcpMicrosoft Windows Filesystemwinfslast updated 27 Nov 20185009 udpMicrosoft Windows Filesystemwinfslast updated 27 Nov 20185010 tcpTelepathStarttelelpathstartlast updated 27 Nov 20185010 udpTelepathStarttelelpathstartlast updated 27 Nov 20185011 tcpTelepathAttacktelelpathattacklast updated 27 Nov 20185011 udpTelepathAttacktelelpathattacklast updated 27 Nov 20185012 tcpNetOnTap Servicensplast updated 27 Nov 20185012 udpNetOnTap Servicensplast updated 27 Nov 20185013 tcpFileMaker, Inc. - Proprietary transportfmpro-v6last updated 27 Nov 20185013 udpFileMaker, Inc. - Proprietary transportfmpro-v6last updated 27 Nov 20185014 tcpReservedN/Alast updated 27 Nov 20185014 udpOverlay Network Protocolonpsocketlast updated 27 Nov 20185015 tcpFileMaker, Inc. - Web publishingfmwplast updated 27 Nov 20185015 udpReservedN/Alast updated 27 Nov 20185016-5019 UnassignedN/Alast updated 27 Nov 20185020 tcpzenginkyo-1zenginkyo-1last updated 27 Nov 20185020 udpzenginkyo-1zenginkyo-1last updated 27 Nov 20185021 tcpzenginkyo-2zenginkyo-2last updated 27 Nov 20185021 udpzenginkyo-2zenginkyo-2last updated 27 Nov 20185022 tcpmice servermicelast updated 27 Nov 20185022 udpmice servermicelast updated 27 Nov 20185023 tcpHtuil Server for PLD2htuilsrvlast updated 27 Nov 20185023 udpHtuil Server for PLD2htuilsrvlast updated 27 Nov 20185024 tcpSCPI-TELNETscpi-telnetlast updated 27 Nov 20185024 udpSCPI-TELNETscpi-telnetlast updated 27 Nov 20185025 tcpSCPI-RAWscpi-rawlast updated 27 Nov 20185025 udpSCPI-RAWscpi-rawlast updated 27 Nov 20185026 tcpStorix I/O daemon (data)strexec-dlast updated 27 Nov 20185026 udpStorix I/O daemon (data)strexec-dlast updated 27 Nov 20185027 tcpStorix I/O daemon (stat)strexec-slast updated 27 Nov 20185027 udpStorix I/O daemon (stat)strexec-slast updated 27 Nov 20185028 tcpQuiqum Virtual Relaisqvrlast updated 27 Nov 20185028 udpReservedN/Alast updated 27 Nov 20185029 tcpInfobright Database Serverinfobrightlast updated 27 Nov 20185029 udpInfobright Database Serverinfobrightlast updated 27 Nov 20185030 tcpSurfPasssurfpasslast updated 27 Nov 20185030 udpSurfPasssurfpasslast updated 27 Nov 20185031 tcpReservedN/Alast updated 27 Nov 20185031 udpDirect Message Protocoldmplast updated 27 Nov 20185032 tcpSignaCert Enterprise Trust Server Agentsignacert-agentlast updated 27 Nov 20185032 udpReservedN/Alast updated 27 Nov 20185033 tcpJanstor Secure Datajtnetd-serverlast updated 27 Nov 20185033 udpReservedN/Alast updated 27 Nov 20185034 tcpJanstor Statusjtnetd-statuslast updated 27 Nov 20185034 udpReservedN/Alast updated 27 Nov 20185035-5041 UnassignedN/Alast updated 27 Nov 20185042 tcpasnaacceler8dbasnaacceler8dblast updated 27 Nov 20185042 udpasnaacceler8dbasnaacceler8dblast updated 27 Nov 20185043 tcpShopWorX Administrationswxadminlast updated 27 Nov 20185043 udpShopWorX Administrationswxadminlast updated 27 Nov 20185044 tcpLXI Event Servicelxi-evntsvclast updated 27 Nov 20185044 udpLXI Event Servicelxi-evntsvclast updated 27 Nov 20185045 tcpOpen Settlement Protocolosplast updated 27 Nov 20185045 udpReservedN/Alast updated 27 Nov 20185046 tcpReservedN/Alast updated 27 Nov 20185046 udpVishay PM UDP Servicevpm-udplast updated 27 Nov 20185047 tcpReservedN/Alast updated 27 Nov 20185047 udpiSCAPE Data Broadcastingiscapelast updated 27 Nov 20185048 tcpTexai Message Servicetexailast updated 27 Nov 20185048 udpReservedN/Alast updated 27 Nov 20185049 tcpiVocalize Web Conferenceivocalizelast updated 27 Nov 20185049 udpiVocalize Web Conferenceivocalizelast updated 27 Nov 20185050 tcpmultimedia conference control toolmmcclast updated 27 Nov 20185050 udpmultimedia conference control toolmmcclast updated 27 Nov 20185051 tcpITA Agentita-agentlast updated 27 Nov 20185051 udpITA Agentita-agentlast updated 27 Nov 20185052 tcpITA Managerita-managerlast updated 27 Nov 20185052 udpITA Managerita-managerlast updated 27 Nov 20185053 tcpRLM License Serverrlmlast updated 27 Nov 20185053 udpRLM Discovery Serverrlm-disclast updated 27 Nov 20185054 tcpRLM administrative interfacerlm-adminlast updated 27 Nov 20185054 udpReservedN/Alast updated 27 Nov 20185055 tcpUNOTunotlast updated 27 Nov 20185055 udpUNOTunotlast updated 27 Nov 20185056 tcpIntecom Pointspan 1intecom-ps1last updated 27 Nov 20185056 udpIntecom Pointspan 1intecom-ps1last updated 27 Nov 20185057 tcpIntecom Pointspan 2intecom-ps2last updated 27 Nov 20185057 udpIntecom Pointspan 2intecom-ps2last updated 27 Nov 20185058 tcpReservedN/Alast updated 27 Nov 20185058 udpLocus Discoverylocus-disclast updated 27 Nov 20185059 tcpSIP Directory Servicessdslast updated 27 Nov 20185059 udpSIP Directory Servicessdslast updated 27 Nov 20185060 tcpSIPsiplast updated 27 Nov 20185060 udpSIPsiplast updated 27 Nov 20185060 sctpSIPsiplast updated 27 Nov 20185061 tcpSIP-TLSsipslast updated 27 Nov 20185061 udpSIP-TLSsipslast updated 27 Nov 20185061 sctpSIP-TLSsipslast updated 27 Nov 20185062 tcpLocalisation accessna-localiselast updated 27 Nov 20185062 udpLocalisation accessna-localiselast updated 27 Nov 20185063 tcpcentrify secure RPCcsrpclast updated 27 Nov 20185063 udpReservedN/Alast updated 27 Nov 20185064 tcpChannel Access 1ca-1last updated 27 Nov 20185064 udpChannel Access 1ca-1last updated 27 Nov 20185065 tcpChannel Access 2ca-2last updated 27 Nov 20185065 udpChannel Access 2ca-2last updated 27 Nov 20185066 tcpSTANAG-5066-SUBNET-INTFstanag-5066last updated 27 Nov 20185066 udpSTANAG-5066-SUBNET-INTFstanag-5066last updated 27 Nov 20185067 tcpAuthentx Serviceauthentxlast updated 27 Nov 20185067 udpAuthentx Serviceauthentxlast updated 27 Nov 20185068 tcpBitforest Data Servicebitforestsrvlast updated 27 Nov 20185068 udpReservedN/Alast updated 27 Nov 20185069 tcpI/Net 2000-NPRi-net-2000-nprlast updated 27 Nov 20185069 udpI/Net 2000-NPRi-net-2000-nprlast updated 27 Nov 20185070 tcpVersaTrans Server Agent Servicevtsaslast updated 27 Nov 20185070 udpVersaTrans Server Agent Servicevtsaslast updated 27 Nov 20185071 tcpPowerSchoolpowerschoollast updated 27 Nov 20185071 udpPowerSchoolpowerschoollast updated 27 Nov 20185072 tcpAnything In Anythingayiyalast updated 27 Nov 20185072 udpAnything In Anythingayiyalast updated 27 Nov 20185073 tcpAdvantage Group Port Mgrtag-pmlast updated 27 Nov 20185073 udpAdvantage Group Port Mgrtag-pmlast updated 27 Nov 20185074 tcpALES Queryalesquerylast updated 27 Nov 20185074 udpALES Queryalesquerylast updated 27 Nov 20185075 tcpExperimental Physics and Industrial Control Systempvaccesslast updated 27 Nov 20185075 udpReservedN/Alast updated 27 Nov 20185076-5077 UnassignedN/Alast updated 27 Nov 20185078 udpPixelPusher pixel datapixelpusherlast updated 27 Nov 20185078 tcpReservedN/Alast updated 27 Nov 20185079 tcpReservedN/Alast updated 27 Nov 20185079 udpCambridge Pixel SPx Reportscp-spxrptslast updated 27 Nov 20185080 tcpOnScreen Data Collection Serviceonscreenlast updated 27 Nov 20185080 udpOnScreen Data Collection Serviceonscreenlast updated 27 Nov 20185081 tcpSDL - Ent Trans Serversdl-etslast updated 27 Nov 20185081 udpSDL - Ent Trans Serversdl-etslast updated 27 Nov 20185082 tcpQpur Communication Protocolqcplast updated 27 Nov 20185082 udpQpur Communication Protocolqcplast updated 27 Nov 20185083 tcpQpur File Protocolqfplast updated 27 Nov 20185083 udpQpur File Protocolqfplast updated 27 Nov 20185084 tcpEPCglobal Low-Level Reader Protocolllrplast updated 27 Nov 20185084 udpEPCglobal Low-Level Reader Protocolllrplast updated 27 Nov 20185085 tcpEPCglobal Encrypted LLRPencrypted-llrplast updated 27 Nov 20185085 udpEPCglobal Encrypted LLRPencrypted-llrplast updated 27 Nov 20185086 tcpAprigo Collection Serviceaprigo-cslast updated 27 Nov 20185086 udpReservedN/Alast updated 27 Nov 20185087 tcpBIOTIC - Binary Internet of Things Interoperable Communicationbioticlast updated 27 Nov 20185087 udpReservedN/Alast updated 27 Nov 20185088-5089 UnassignedN/Alast updated 27 Nov 20185090 sctpCandidate ARcarlast updated 27 Nov 20185091 sctpContext Transfer Protocolcxtplast updated 27 Nov 20185092 tcpReservedN/Alast updated 27 Nov 20185092 udpMagpie Binarymagpielast updated 27 Nov 20185093 tcpSentinel LMsentinel-lmlast updated 27 Nov 20185093 udpSentinel LMsentinel-lmlast updated 27 Nov 20185094 tcpHART-IPhart-iplast updated 27 Nov 20185094 udpHART-IPhart-iplast updated 27 Nov 20185095-5098 UnassignedN/Alast updated 27 Nov 20185099 tcpSentLM Srv2Srvsentlm-srv2srvlast updated 27 Nov 20185099 udpSentLM Srv2Srvsentlm-srv2srvlast updated 27 Nov 20185100 tcpSocalia service muxsocalialast updated 27 Nov 20185100 udpSocalia service muxsocalialast updated 27 Nov 20185101 tcpTalarian_TCPtalarian-tcplast updated 27 Nov 20185101 udpTalarian_UDPtalarian-udplast updated 27 Nov 20185102 tcpOracle OMS non-secureoms-nonsecurelast updated 27 Nov 20185102 udpOracle OMS non-secureoms-nonsecurelast updated 27 Nov 20185103 tcpActifio C2Cactifio-c2clast updated 27 Nov 20185103 udpReservedN/Alast updated 27 Nov 20185104 tcpReservedN/Alast updated 27 Nov 20185104 udpTinyMessagetinymessagelast updated 27 Nov 20185105 tcpReservedN/Alast updated 27 Nov 20185105 udpHughes Association Protocolhughes-aplast updated 27 Nov 20185106 tcpActifio UDS Agentactifioudsagentlast updated 27 Nov 20185106 udpReservedN/Alast updated 27 Nov 20185107 tcpDisk to Disk replication between Actifio Clustersactifiorepliclast updated 27 Nov 20185107 udpReservedN/Alast updated 27 Nov 20185108-5110 UnassignedN/Alast updated 27 Nov 20185111 tcpTAEP AS servicetaep-as-svclast updated 27 Nov 20185111 udpTAEP AS servicetaep-as-svclast updated 27 Nov 20185112 tcpPeerMe Msg Cmd Servicepm-cmdsvrlast updated 27 Nov 20185112 udpPeerMe Msg Cmd Servicepm-cmdsvrlast updated 27 Nov 20185113 UnassignedN/Alast updated 27 Nov 20185114 tcpEnterprise Vault Servicesev-serviceslast updated 27 Nov 20185114 udpReservedN/Alast updated 27 Nov 20185115 tcpSymantec Autobuild Serviceautobuildlast updated 27 Nov 20185115 udpReservedN/Alast updated 27 Nov 20185116 tcpReservedN/Alast updated 27 Nov 20185116 udpEPSON Projecter Image Transferemb-proj-cmdlast updated 27 Nov 20185117 tcpGradeCam Image Processinggradecamlast updated 27 Nov 20185117 udpReservedN/Alast updated 27 Nov 20185118-5119 UnassignedN/Alast updated 27 Nov 20185120 tcpBarracuda Backup Protocolbarracuda-bbslast updated 27 Nov 20185120 udpBarracuda Backup Protocolbarracuda-bbslast updated 27 Nov 20185121-5132 UnassignedN/Alast updated 27 Nov 20185133 tcpPolicy Commandernbt-pclast updated 27 Nov 20185133 udpPolicy Commandernbt-pclast updated 27 Nov 20185134 tcpPP ActivationServerppactivationlast updated 27 Nov 20185134 udpReservedN/Alast updated 27 Nov 20185135 tcpERP-Scaleerp-scalelast updated 27 Nov 20185135 udpReservedN/Alast updated 27 Nov 20185136 tcpReservedN/Alast updated 27 Nov 20185136 udpMinotaur SAminotaur-salast updated 27 Nov 20185137 tcpMyCTS server portctsdlast updated 27 Nov 20185137 udpMyCTS server portctsdlast updated 27 Nov 20185138-5144 UnassignedN/Alast updated 27 Nov 20185145 tcpRMONITOR SECURE IANA assigned this well-formed service name as a replacement for "rmonitor_secure".rmonitor-securelast updated 27 Nov 20185145 tcp (rmonitor_secure)RMONITOR SECURErmonitor_securelast updated 27 Nov 20185145 udpRMONITOR SECURE IANA assigned this well-formed service name as a replacement for "rmonitor_secure".rmonitor-securelast updated 27 Nov 20185145 udp (rmonitor_secure)RMONITOR SECURErmonitor_securelast updated 27 Nov 20185146 tcpSocial Alarm Servicesocial-alarmlast updated 27 Nov 20185146 udpReservedN/Alast updated 27 Nov 20185147-5149 UnassignedN/Alast updated 27 Nov 20185150 tcpAscend Tunnel Management Protocolatmplast updated 27 Nov 20185150 udpAscend Tunnel Management Protocolatmplast updated 27 Nov 20185151 tcpESRI SDE Instance IANA assigned this well-formed service name as a replacement for "esri_sde".esri-sdelast updated 27 Nov 20185151 tcp (esri_sde)ESRI SDE Instanceesri_sdelast updated 27 Nov 20185151 udpESRI SDE Remote Start IANA assigned this well-formed service name as a replacement for "esri_sde".esri-sdelast updated 27 Nov 20185151 udp (esri_sde)ESRI SDE Remote Startesri_sdelast updated 27 Nov 20185152 tcpESRI SDE Instance Discoverysde-discoverylast updated 27 Nov 20185152 udpESRI SDE Instance Discoverysde-discoverylast updated 27 Nov 20185153 tcpReservedN/Alast updated 27 Nov 20185153 udpReservedN/Alast updated 27 Nov 20185154 tcpBZFlag game serverbzflaglast updated 27 Nov 20185154 udpBZFlag game serverbzflaglast updated 27 Nov 20185155 tcpOracle asControl Agentasctrl-agentlast updated 27 Nov 20185155 udpOracle asControl Agentasctrl-agentlast updated 27 Nov 20185156 tcpRussian Online Gamerugameonlinelast updated 27 Nov 20185156 udpReservedN/Alast updated 27 Nov 20185157 tcpMediat Remote Object Exchangemediatlast updated 27 Nov 20185157 udpReservedN/Alast updated 27 Nov 20185158-5160 UnassignedN/Alast updated 27 Nov 20185161 tcpSNMP over SSH Transport Modelsnmpsshlast updated 27 Nov 20185161 udpReservedN/Alast updated 27 Nov 20185162 tcpSNMP Notification over SSH Transport Modelsnmpssh-traplast updated 27 Nov 20185162 udpReservedN/Alast updated 27 Nov 20185163 tcpShadow Backupsbackuplast updated 27 Nov 20185163 udpReservedN/Alast updated 27 Nov 20185164 tcpVirtual Protocol Adaptervpalast updated 27 Nov 20185164 udpVirtual Protocol Adapter Discoveryvpa-disclast updated 27 Nov 20185165 tcpife_1corp IANA assigned this well-formed service name as a replacement for "ife_icorp".ife-icorplast updated 27 Nov 20185165 tcp (ife_icorp)ife_1corpife_icorplast updated 27 Nov 20185165 udpife_1corp IANA assigned this well-formed service name as a replacement for "ife_icorp".ife-icorplast updated 27 Nov 20185165 udp (ife_icorp)ife_1corpife_icorplast updated 27 Nov 20185166 tcpWinPCS Service Connectionwinpcslast updated 27 Nov 20185166 udpWinPCS Service Connectionwinpcslast updated 27 Nov 20185167 tcpSCTE104 Connectionscte104last updated 27 Nov 20185167 udpSCTE104 Connectionscte104last updated 27 Nov 20185168 tcpSCTE30 Connectionscte30last updated 27 Nov 20185168 udpSCTE30 Connectionscte30last updated 27 Nov 20185169-5171 UnassignedN/Alast updated 27 Nov 20185172 tcpPC over IP Endpoint Managementpcoip-mgmtlast updated 27 Nov 20185172 udpReservedN/Alast updated 27 Nov 20185173-5189 UnassignedN/Alast updated 27 Nov 20185190 tcpAmerica-Onlineaollast updated 27 Nov 20185190 udpAmerica-Onlineaollast updated 27 Nov 20185191 tcpAmericaOnline1aol-1last updated 27 Nov 20185191 udpAmericaOnline1aol-1last updated 27 Nov 20185192 tcpAmericaOnline2aol-2last updated 27 Nov 20185192 udpAmericaOnline2aol-2last updated 27 Nov 20185193 tcpAmericaOnline3aol-3last updated 27 Nov 20185193 udpAmericaOnline3aol-3last updated 27 Nov 20185194 tcpCipherPoint Config Servicecpscommlast updated 27 Nov 20185194 udpReservedN/Alast updated 27 Nov 20185195 tcpThe protocol is used by a license server and client programs to control use of program licenses that float to networked machinesampl-liclast updated 27 Nov 20185195 udpReservedN/Alast updated 27 Nov 20185196 tcpThe protocol is used by two programs that exchange "table" data used in the AMPL modeling languageampl-tableproxylast updated 27 Nov 20185196 udpReservedN/Alast updated 27 Nov 20185197 tcpTunstall Lone worker device interfacetunstall-lwplast updated 27 Nov 20185197 udpReservedN/Alast updated 27 Nov 20185198-5199 UnassignedN/Alast updated 27 Nov 20185200 tcpTARGUS GetDatatargus-getdatalast updated 27 Nov 20185200 udpTARGUS GetDatatargus-getdatalast updated 27 Nov 20185201 tcpTARGUS GetData 1targus-getdata1last updated 27 Nov 20185201 udpTARGUS GetData 1targus-getdata1last updated 27 Nov 20185202 tcpTARGUS GetData 2targus-getdata2last updated 27 Nov 20185202 udpTARGUS GetData 2targus-getdata2last updated 27 Nov 20185203 tcpTARGUS GetData 3targus-getdata3last updated 27 Nov 20185203 udpTARGUS GetData 3targus-getdata3last updated 27 Nov 20185204-5208 UnassignedN/Alast updated 27 Nov 20185209 tcpNomad Device Video Transfernomadlast updated 27 Nov 20185209 udpReservedN/Alast updated 27 Nov 20185210-5214 UnassignedN/Alast updated 27 Nov 20185215 tcpNOTEZA Data Safety Servicenotezalast updated 27 Nov 20185215 udpReservedN/Alast updated 27 Nov 20185215 sctpNOTEZA Data Safety Servicenotezalast updated 27 Nov 20185216-5220 UnassignedN/Alast updated 27 Nov 20185221 tcp3eTI Extensible Management Protocol for OAMP3exmplast updated 27 Nov 20185221 udpReservedN/Alast updated 27 Nov 20185222 tcpXMPP Client Connectionxmpp-clientlast updated 27 Nov 20185222 udpReservedN/Alast updated 27 Nov 20185223 tcpHP Virtual Machine Group Managementhpvirtgrplast updated 27 Nov 20185223 udpHP Virtual Machine Group Managementhpvirtgrplast updated 27 Nov 20185224 tcpHP Virtual Machine Console Operationshpvirtctrllast updated 27 Nov 20185224 udpHP Virtual Machine Console Operationshpvirtctrllast updated 27 Nov 20185225 tcpHP Serverhp-serverlast updated 27 Nov 20185225 udpHP Serverhp-serverlast updated 27 Nov 20185226 tcpHP Statushp-statuslast updated 27 Nov 20185226 udpHP Statushp-statuslast updated 27 Nov 20185227 tcpHP System Performance Metric Serviceperfdlast updated 27 Nov 20185227 udpHP System Performance Metric Serviceperfdlast updated 27 Nov 20185228 tcpHP Virtual Room Servicehpvroomlast updated 27 Nov 20185228 udpReservedN/Alast updated 27 Nov 20185229 tcpNetflow/IPFIX/sFlow Collector and Forwarder Managementjaxflowlast updated 27 Nov 20185229 udpReservedN/Alast updated 27 Nov 20185230 tcpJaxMP RealFlow application and protocol datajaxflow-datalast updated 27 Nov 20185230 udpReservedN/Alast updated 27 Nov 20185231 tcpRemote Control of Scan Software for Cruse Scannerscrusecontrollast updated 27 Nov 20185231 udpReservedN/Alast updated 27 Nov 20185232 tcpCruse Scanning System Servicecsedaemonlast updated 27 Nov 20185232 udpReservedN/Alast updated 27 Nov 20185233 tcpEtinnae Network File Serviceenfslast updated 27 Nov 20185233 udpReservedN/Alast updated 27 Nov 20185234 tcpEEnet communicationseenetlast updated 27 Nov 20185234 udpEEnet communicationseenetlast updated 27 Nov 20185235 tcpGalaxy Network Servicegalaxy-networklast updated 27 Nov 20185235 udpGalaxy Network Servicegalaxy-networklast updated 27 Nov 20185236 tcp-padl2simlast updated 27 Nov 20185236 udp-padl2simlast updated 27 Nov 20185237 tcpm-net discoverymnet-discoverylast updated 27 Nov 20185237 udpm-net discoverymnet-discoverylast updated 27 Nov 20185238-5244 UnassignedN/Alast updated 27 Nov 20185245 tcpDownTools Control Protocoldowntoolslast updated 27 Nov 20185245 udpDownTools Discovery Protocoldowntools-disclast updated 27 Nov 20185246 tcpReservedN/Alast updated 27 Nov 20185246 udpCAPWAP Control Protocolcapwap-controllast updated 27 Nov 20185247 tcpReservedN/Alast updated 27 Nov 20185247 udpCAPWAP Data Protocolcapwap-datalast updated 27 Nov 20185248 tcpCA Access Control Web Servicecaacwslast updated 27 Nov 20185248 udpCA Access Control Web Servicecaacwslast updated 27 Nov 20185249 tcpCA AC Lang Servicecaaclang2last updated 27 Nov 20185249 udpCA AC Lang Servicecaaclang2last updated 27 Nov 20185250 tcpsoaGatewaysoagatewaylast updated 27 Nov 20185250 udpsoaGatewaysoagatewaylast updated 27 Nov 20185251 tcpCA eTrust VM Servicecaevmslast updated 27 Nov 20185251 udpCA eTrust VM Servicecaevmslast updated 27 Nov 20185252 tcpMovaz SSCmovaz-ssclast updated 27 Nov 20185252 udpMovaz SSCmovaz-ssclast updated 27 Nov 20185253 tcpKohler Power Device Protocolkpdplast updated 27 Nov 20185253 udpReservedN/Alast updated 27 Nov 20185254 tcpLogCabin storage servicelogcabinlast updated 27 Nov 20185254 udpReservedN/Alast updated 27 Nov 20185255-5263 UnassignedN/Alast updated 27 Nov 20185264 tcp3Com Network Jack Port 13com-njack-1last updated 27 Nov 20185264 udp3Com Network Jack Port 13com-njack-1last updated 27 Nov 20185265 tcp3Com Network Jack Port 23com-njack-2last updated 27 Nov 20185265 udp3Com Network Jack Port 23com-njack-2last updated 27 Nov 20185266-5268 UnassignedN/Alast updated 27 Nov 20185269 tcpXMPP Server Connectionxmpp-serverlast updated 27 Nov 20185269 udpReservedN/Alast updated 27 Nov 20185270 tcpCartographer XMPcartographerxmplast updated 27 Nov 20185270 udpCartographer XMPcartographerxmplast updated 27 Nov 20185271 tcpStageSoft CueLink messagingcuelinklast updated 27 Nov 20185271 udpStageSoft CueLink discoverycuelink-disclast updated 27 Nov 20185272 tcpPKpklast updated 27 Nov 20185272 udpPKpklast updated 27 Nov 20185273-5279 UnassignedN/Alast updated 27 Nov 20185280 tcpBidirectional-streams Over Synchronous HTTP (BOSH)xmpp-boshlast updated 27 Nov 20185280 udpReservedN/Alast updated 27 Nov 20185281 tcpUndo License Managerundo-lmlast updated 27 Nov 20185281 udpReservedN/Alast updated 27 Nov 20185282 tcpMarimba Transmitter Porttransmit-portlast updated 27 Nov 20185282 udpMarimba Transmitter Porttransmit-portlast updated 27 Nov 20185283-5297 UnassignedN/Alast updated 27 Nov 20185298 tcpXMPP Link-Local Messagingpresencelast updated 27 Nov 20185298 udpXMPP Link-Local Messagingpresencelast updated 27 Nov 20185299 tcpNLG Data Servicenlg-datalast updated 27 Nov 20185299 udpNLG Data Servicenlg-datalast updated 27 Nov 20185300 tcpHA cluster heartbeathacl-hblast updated 27 Nov 20185300 udpHA cluster heartbeathacl-hblast updated 27 Nov 20185301 tcpHA cluster general serviceshacl-gslast updated 27 Nov 20185301 udpHA cluster general serviceshacl-gslast updated 27 Nov 20185302 tcpHA cluster configurationhacl-cfglast updated 27 Nov 20185302 udpHA cluster configurationhacl-cfglast updated 27 Nov 20185303 tcpHA cluster probinghacl-probelast updated 27 Nov 20185303 udpHA cluster probinghacl-probelast updated 27 Nov 20185304 tcpHA Cluster Commandshacl-locallast updated 27 Nov 20185304 udpHA Cluster Commandshacl-locallast updated 27 Nov 20185305 tcpHA Cluster Testhacl-testlast updated 27 Nov 20185305 udpHA Cluster Testhacl-testlast updated 27 Nov 20185306 tcpSun MC Groupsun-mc-grplast updated 27 Nov 20185306 udpSun MC Groupsun-mc-grplast updated 27 Nov 20185307 tcpSCO AIPsco-aiplast updated 27 Nov 20185307 udpSCO AIPsco-aiplast updated 27 Nov 20185308 tcpCFenginecfenginelast updated 27 Nov 20185308 udpCFenginecfenginelast updated 27 Nov 20185309 tcpJ Printerjprinterlast updated 27 Nov 20185309 udpJ Printerjprinterlast updated 27 Nov 20185310 tcpOutlawsoutlawslast updated 27 Nov 20185310 udpOutlawsoutlawslast updated 27 Nov 20185311 UnassignedN/Alast updated 27 Nov 20185312 tcpPermabit Client-Serverpermabit-cslast updated 27 Nov 20185312 udpPermabit Client-Serverpermabit-cslast updated 27 Nov 20185313 tcpReal-time & Reliable Datarrdplast updated 27 Nov 20185313 udpReal-time & Reliable Datarrdplast updated 27 Nov 20185314 tcpopalis-rbt-ipcopalis-rbt-ipclast updated 27 Nov 20185314 udpopalis-rbt-ipcopalis-rbt-ipclast updated 27 Nov 20185315 tcpHA Cluster UDP Pollinghacl-polllast updated 27 Nov 20185315 udpHA Cluster UDP Pollinghacl-polllast updated 27 Nov 20185316 tcpHPBladeSystem Monitor Servicehpblademslast updated 27 Nov 20185316 udpUnassignedN/Alast updated 27 Nov 20185317 tcpHP Device Monitor Servicehpdevmslast updated 27 Nov 20185317 udpReservedN/Alast updated 27 Nov 20185318 tcpPKIX Certificate Management using CMS (CMC)pkix-cmclast updated 27 Nov 20185318 udpReservedN/Alast updated 27 Nov 20185319 UnassignedN/Alast updated 27 Nov 20185320 tcpWebservices-based Zn interface of BSFbsfserver-znlast updated 27 Nov 20185320 udpReservedN/Alast updated 27 Nov 20185321 tcpWebservices-based Zn interface of BSF over SSLbsfsvr-zn-ssllast updated 27 Nov 20185321 udpReservedN/Alast updated 27 Nov 20185322-5342 UnassignedN/Alast updated 27 Nov 20185343 tcpSculptor Database Serverkfserverlast updated 27 Nov 20185343 udpSculptor Database Serverkfserverlast updated 27 Nov 20185344 tcpxkoto DRCPxkotodrcplast updated 27 Nov 20185344 udpxkoto DRCPxkotodrcplast updated 27 Nov 20185345-5348 UnassignedN/Alast updated 27 Nov 20185349 tcpSTUN over TLSstunslast updated 27 Nov 20185349 udpSTUN over DTLSstunslast updated 27 Nov 20185349 tcp (turns)TURN over TLSturnslast updated 27 Nov 20185349 udp (turns)TURN over DTLSturnslast updated 27 Nov 20185349 tcp (stun-behaviors)STUN Behavior Discovery over TLSstun-behaviorslast updated 27 Nov 20185349 udp (stun-behaviors)Reserved for a future enhancement of STUN-BEHAVIORstun-behaviorslast updated 27 Nov 20185350 tcpReservedN/Alast updated 27 Nov 20185350 udpPort Control Protocol Multicastpcp-multicastlast updated 27 Nov 20185351 tcpReservedN/Alast updated 27 Nov 20185351 udpPort Control Protocolpcplast updated 27 Nov 20185352 tcpDNS Long-Lived Queriesdns-llqlast updated 27 Nov 20185352 udpDNS Long-Lived Queriesdns-llqlast updated 27 Nov 20185353 tcpMulticast DNSmdnslast updated 27 Nov 20185353 udpMulticast DNSmdnslast updated 27 Nov 20185354 tcpMulticast DNS Responder IPCmdnsresponderlast updated 27 Nov 20185354 udpMulticast DNS Responder IPCmdnsresponderlast updated 27 Nov 20185355 tcpLLMNRllmnrlast updated 27 Nov 20185355 udpLLMNRllmnrlast updated 27 Nov 20185356 tcpMicrosoft Small Businessms-smlbizlast updated 27 Nov 20185356 udpMicrosoft Small Businessms-smlbizlast updated 27 Nov 20185357 tcpWeb Services for Deviceswsdapilast updated 27 Nov 20185357 udpWeb Services for Deviceswsdapilast updated 27 Nov 20185358 tcpWS for Devices Securedwsdapi-slast updated 27 Nov 20185358 udpWS for Devices Securedwsdapi-slast updated 27 Nov 20185359 tcpMicrosoft Alerterms-alerterlast updated 27 Nov 20185359 udpMicrosoft Alerterms-alerterlast updated 27 Nov 20185360 tcpProtocol for Windows SideShowms-sideshowlast updated 27 Nov 20185360 udpProtocol for Windows SideShowms-sideshowlast updated 27 Nov 20185361 tcpSecure Protocol for Windows SideShowms-s-sideshowlast updated 27 Nov 20185361 udpSecure Protocol for Windows SideShowms-s-sideshowlast updated 27 Nov 20185362 tcpMicrosoft Windows Server WSD2 Serviceserverwsd2last updated 27 Nov 20185362 udpMicrosoft Windows Server WSD2 Serviceserverwsd2last updated 27 Nov 20185363 tcpWindows Network Projectionnet-projectionlast updated 27 Nov 20185363 udpWindows Network Projectionnet-projectionlast updated 27 Nov 20185364 udpMicrosoft Kernel Debuggerkdnetlast updated 27 Nov 20185364 tcpReservedN/Alast updated 27 Nov 20185365-5396 UnassignedN/Alast updated 27 Nov 20185397 tcpStressTester(tm) Injectorstresstesterlast updated 27 Nov 20185397 udpStressTester(tm) Injectorstresstesterlast updated 27 Nov 20185398 tcpElektron Administrationelektron-adminlast updated 27 Nov 20185398 udpElektron Administrationelektron-adminlast updated 27 Nov 20185399 tcpSecurityChasesecuritychaselast updated 27 Nov 20185399 udpSecurityChasesecuritychaselast updated 27 Nov 20185400 tcpExcerpt Searchexcerptlast updated 27 Nov 20185400 udpExcerpt Searchexcerptlast updated 27 Nov 20185401 tcpExcerpt Search Secureexcerptslast updated 27 Nov 20185401 udpExcerpt Search Secureexcerptslast updated 27 Nov 20185402 tcpOmniCast MFTPmftplast updated 27 Nov 20185402 udpOmniCast MFTPmftplast updated 27 Nov 20185403 tcpHPOMS-CI-LSTNhpoms-ci-lstnlast updated 27 Nov 20185403 udpHPOMS-CI-LSTNhpoms-ci-lstnlast updated 27 Nov 20185404 tcpHPOMS-DPS-LSTNhpoms-dps-lstnlast updated 27 Nov 20185404 udpHPOMS-DPS-LSTNhpoms-dps-lstnlast updated 27 Nov 20185405 tcpNetSupportnetsupportlast updated 27 Nov 20185405 udpNetSupportnetsupportlast updated 27 Nov 20185406 tcpSystemics Soxsystemics-soxlast updated 27 Nov 20185406 udpSystemics Soxsystemics-soxlast updated 27 Nov 20185407 tcpForesyte-Clearforesyte-clearlast updated 27 Nov 20185407 udpForesyte-Clearforesyte-clearlast updated 27 Nov 20185408 tcpForesyte-Secforesyte-seclast updated 27 Nov 20185408 udpForesyte-Secforesyte-seclast updated 27 Nov 20185409 tcpSalient Data Serversalient-dtasrvlast updated 27 Nov 20185409 udpSalient Data Serversalient-dtasrvlast updated 27 Nov 20185410 tcpSalient User Managersalient-usrmgrlast updated 27 Nov 20185410 udpSalient User Managersalient-usrmgrlast updated 27 Nov 20185411 tcpActNetactnetlast updated 27 Nov 20185411 udpActNetactnetlast updated 27 Nov 20185412 tcpContinuuscontinuuslast updated 27 Nov 20185412 udpContinuuscontinuuslast updated 27 Nov 20185413 tcpWWIOTALKwwiotalklast updated 27 Nov 20185413 udpWWIOTALKwwiotalklast updated 27 Nov 20185414 tcpStatusDstatusdlast updated 27 Nov 20185414 udpStatusDstatusdlast updated 27 Nov 20185415 tcpNS Serverns-serverlast updated 27 Nov 20185415 udpNS Serverns-serverlast updated 27 Nov 20185416 tcpSNS Gatewaysns-gatewaylast updated 27 Nov 20185416 udpSNS Gatewaysns-gatewaylast updated 27 Nov 20185417 tcpSNS Agentsns-agentlast updated 27 Nov 20185417 udpSNS Agentsns-agentlast updated 27 Nov 20185418 tcpMCNTPmcntplast updated 27 Nov 20185418 udpMCNTPmcntplast updated 27 Nov 20185419 tcpDJ-ICEdj-icelast updated 27 Nov 20185419 udpDJ-ICEdj-icelast updated 27 Nov 20185420 tcpCylink-Ccylink-clast updated 27 Nov 20185420 udpCylink-Ccylink-clast updated 27 Nov 20185421 tcpNet Support 2netsupport2last updated 27 Nov 20185421 udpNet Support 2netsupport2last updated 27 Nov 20185422 tcpSalient MUXsalient-muxlast updated 27 Nov 20185422 udpSalient MUXsalient-muxlast updated 27 Nov 20185423 tcpVIRTUALUSERvirtualuserlast updated 27 Nov 20185423 udpVIRTUALUSERvirtualuserlast updated 27 Nov 20185424 tcpBeyond Remotebeyond-remotelast updated 27 Nov 20185424 udpBeyond Remotebeyond-remotelast updated 27 Nov 20185425 tcpBeyond Remote Command Channelbr-channellast updated 27 Nov 20185425 udpBeyond Remote Command Channelbr-channellast updated 27 Nov 20185426 tcpDEVBASICdevbasiclast updated 27 Nov 20185426 udpDEVBASICdevbasiclast updated 27 Nov 20185427 tcpSCO-PEER-TTAsco-peer-ttalast updated 27 Nov 20185427 udpSCO-PEER-TTAsco-peer-ttalast updated 27 Nov 20185428 tcpTELACONSOLEtelaconsolelast updated 27 Nov 20185428 udpTELACONSOLEtelaconsolelast updated 27 Nov 20185429 tcpBilling and Accounting System Exchangebaselast updated 27 Nov 20185429 udpBilling and Accounting System Exchangebaselast updated 27 Nov 20185430 tcpRADEC CORPradec-corplast updated 27 Nov 20185430 udpRADEC CORPradec-corplast updated 27 Nov 20185431 tcpPARK AGENTpark-agentlast updated 27 Nov 20185431 udpPARK AGENTpark-agentlast updated 27 Nov 20185432 tcpPostgreSQL Databasepostgresqllast updated 27 Nov 20185432 udpPostgreSQL Databasepostgresqllast updated 27 Nov 20185433 tcpPyrrho DBMSpyrrholast updated 27 Nov 20185433 udpPyrrho DBMSpyrrholast updated 27 Nov 20185434 tcpSGI Array Services Daemonsgi-arraydlast updated 27 Nov 20185434 udpSGI Array Services Daemonsgi-arraydlast updated 27 Nov 20185435 tcpSCEANICS situation and action notificationsceanicslast updated 27 Nov 20185435 udpSCEANICS situation and action notificationsceanicslast updated 27 Nov 20185436 tcpReservedN/Alast updated 27 Nov 20185436 udppmip6-cntlpmip6-cntllast updated 27 Nov 20185437 tcpReservedN/Alast updated 27 Nov 20185437 udppmip6-datapmip6-datalast updated 27 Nov 20185438-5442 UnassignedN/Alast updated 27 Nov 20185443 tcpPearson HTTPSspsslast updated 27 Nov 20185443 udpPearson HTTPSspsslast updated 27 Nov 20185444 UnassignedN/Alast updated 27 Nov 20185445 tcpServer Message Block over Remote Direct Memory Accesssmbdirectlast updated 27 Nov 20185445 udpReservedN/Alast updated 27 Nov 20185445 sctpServer Message Block over Remote Direct Memory Accesssmbdirectlast updated 27 Nov 20185446-5449 UnassignedN/Alast updated 27 Nov 20185450 tcpTiePie engineering data acquisitiontiepielast updated 27 Nov 20185450 udpTiePie engineering data acquisition (discovery)tiepie-disclast updated 27 Nov 20185451-5452 UnassignedN/Alast updated 27 Nov 20185453 tcpSureBoxsureboxlast updated 27 Nov 20185453 udpSureBoxsureboxlast updated 27 Nov 20185454 tcpAPC 5454apc-5454last updated 27 Nov 20185454 udpAPC 5454apc-5454last updated 27 Nov 20185455 tcpAPC 5455apc-5455last updated 27 Nov 20185455 udpAPC 5455apc-5455last updated 27 Nov 20185456 tcpAPC 5456apc-5456last updated 27 Nov 20185456 udpAPC 5456apc-5456last updated 27 Nov 20185457-5460 UnassignedN/Alast updated 27 Nov 20185461 tcpSILKMETERsilkmeterlast updated 27 Nov 20185461 udpSILKMETERsilkmeterlast updated 27 Nov 20185462 tcpTTL Publisherttl-publisherlast updated 27 Nov 20185462 udpTTL Publisherttl-publisherlast updated 27 Nov 20185463 tcpTTL Price Proxyttlpriceproxylast updated 27 Nov 20185463 udpTTL Price Proxyttlpriceproxylast updated 27 Nov 20185464 tcpQuail Networks Object Brokerquailnetlast updated 27 Nov 20185464 udpQuail Networks Object Brokerquailnetlast updated 27 Nov 20185465 tcpNETOPS-BROKERnetops-brokerlast updated 27 Nov 20185465 udpNETOPS-BROKERnetops-brokerlast updated 27 Nov 20185466-5469 UnassignedN/Alast updated 27 Nov 20185470 tcpThe Apsolab company's data collection protocol (native api)apsolab-collast updated 27 Nov 20185470 udpReservedN/Alast updated 27 Nov 20185471 tcpThe Apsolab company's secure data collection protocol (native api)apsolab-colslast updated 27 Nov 20185471 udpReservedN/Alast updated 27 Nov 20185472 tcpThe Apsolab company's dynamic tag protocolapsolab-taglast updated 27 Nov 20185472 udpReservedN/Alast updated 27 Nov 20185473 tcpThe Apsolab company's secure dynamic tag protocolapsolab-tagslast updated 27 Nov 20185473 udpReservedN/Alast updated 27 Nov 20185474 udpThe Apsolab company's status query protocolapsolab-rpclast updated 27 Nov 20185474 tcpReservedN/Alast updated 27 Nov 20185475 tcpThe Apsolab company's data retrieval protocolapsolab-datalast updated 27 Nov 20185475 udpReservedN/Alast updated 27 Nov 20185476-5499 UnassignedN/Alast updated 27 Nov 20185500 tcpfcp-addr-srvr1fcp-addr-srvr1last updated 27 Nov 20185500 udpfcp-addr-srvr1fcp-addr-srvr1last updated 27 Nov 20185501 tcpfcp-addr-srvr2fcp-addr-srvr2last updated 27 Nov 20185501 udpfcp-addr-srvr2fcp-addr-srvr2last updated 27 Nov 20185502 tcpfcp-srvr-inst1fcp-srvr-inst1last updated 27 Nov 20185502 udpfcp-srvr-inst1fcp-srvr-inst1last updated 27 Nov 20185503 tcpfcp-srvr-inst2fcp-srvr-inst2last updated 27 Nov 20185503 udpfcp-srvr-inst2fcp-srvr-inst2last updated 27 Nov 20185504 tcpfcp-cics-gw1fcp-cics-gw1last updated 27 Nov 20185504 udpfcp-cics-gw1fcp-cics-gw1last updated 27 Nov 20185505 tcpCheckout Databasecheckoutdblast updated 27 Nov 20185505 udpCheckout Databasecheckoutdblast updated 27 Nov 20185506 tcpAmcom Mobile Connectamclast updated 27 Nov 20185506 udpAmcom Mobile Connectamclast updated 27 Nov 20185507 tcpPowerSysLab Electrical Managementpsl-managementlast updated 27 Nov 20185507 udpReservedN/Alast updated 27 Nov 20185508-5549 UnassignedN/Alast updated 27 Nov 20185550 tcpModel Railway control using the CBUS message protocolcbuslast updated 27 Nov 20185550 udpReservedN/Alast updated 27 Nov 20185551-5552 UnassignedN/Alast updated 27 Nov 20185553 tcpSGI Eventmond Portsgi-eventmondlast updated 27 Nov 20185553 udpSGI Eventmond Portsgi-eventmondlast updated 27 Nov 20185554 tcpSGI ESP HTTPsgi-esphttplast updated 27 Nov 20185554 udpSGI ESP HTTPsgi-esphttplast updated 27 Nov 20185555 tcpPersonal Agentpersonal-agentlast updated 27 Nov 20185555 udpPersonal Agentpersonal-agentlast updated 27 Nov 20185556 tcpFreeciv gameplayfreecivlast updated 27 Nov 20185556 udpFreeciv gameplayfreecivlast updated 27 Nov 20185557 tcpSandlab FARENETfarenetlast updated 27 Nov 20185557 udpReservedN/Alast updated 27 Nov 20185558-5564 UnassignedN/Alast updated 27 Nov 20185565 tcpHPE Advanced BURAhpe-dp-buralast updated 27 Nov 20185565 udpReservedN/Alast updated 27 Nov 20185566 tcpWestec Connectwestec-connectlast updated 27 Nov 20185566 udpReservedN/Alast updated 27 Nov 20185567 tcpDOF Protocol Stack Multicast/Secure Transportdof-dps-mc-seclast updated 27 Nov 20185567 udpDOF Protocol Stack Multicast/Secure Transportdof-dps-mc-seclast updated 27 Nov 20185568 tcpSession Data Transport Multicastsdtlast updated 27 Nov 20185568 udpSession Data Transport Multicastsdtlast updated 27 Nov 20185569 tcpPLASA E1.33, Remote Device Management (RDM) controller status notificationsrdmnet-ctrllast updated 27 Nov 20185569 udpPLASA E1.33, Remote Device Management (RDM) messagesrdmnet-devicelast updated 27 Nov 20185570-5572 UnassignedN/Alast updated 27 Nov 20185573 tcpSAS Domain Management Messaging Protocolsdmmplast updated 27 Nov 20185573 udpSAS Domain Management Messaging Protocolsdmmplast updated 27 Nov 20185574 tcpSAS IO Forwardinglsi-bobcatlast updated 27 Nov 20185574 udpReservedN/Alast updated 27 Nov 20185575 tcpOracle Access Protocolora-oaplast updated 27 Nov 20185575 udpReservedN/Alast updated 27 Nov 20185576-5578 UnassignedN/Alast updated 27 Nov 20185579 tcpFleetDisplay Tracking Servicefdtrackslast updated 27 Nov 20185579 udpReservedN/Alast updated 27 Nov 20185580 tcpT-Mobile SMS Protocol Message 0tmosms0last updated 27 Nov 20185580 udpT-Mobile SMS Protocol Message 0tmosms0last updated 27 Nov 20185581 tcpT-Mobile SMS Protocol Message 1tmosms1last updated 27 Nov 20185581 udpT-Mobile SMS Protocol Message 1tmosms1last updated 27 Nov 20185582 tcpT-Mobile SMS Protocol Message 3fac-restorelast updated 27 Nov 20185582 udpT-Mobile SMS Protocol Message 3fac-restorelast updated 27 Nov 20185583 tcpT-Mobile SMS Protocol Message 2tmo-icon-synclast updated 27 Nov 20185583 udpT-Mobile SMS Protocol Message 2tmo-icon-synclast updated 27 Nov 20185584 tcpBeInSync-Webbis-weblast updated 27 Nov 20185584 udpBeInSync-Webbis-weblast updated 27 Nov 20185585 tcpBeInSync-syncbis-synclast updated 27 Nov 20185585 udpBeInSync-syncbis-synclast updated 27 Nov 20185586 tcpPlanning to send mobile terminated SMS to the specific port so that the SMS is not visible to the clientatt-mt-smslast updated 27 Nov 20185586 udpReservedN/Alast updated 27 Nov 20185587-5596 UnassignedN/Alast updated 27 Nov 20185597 tcpinin secure messagingininmessaginglast updated 27 Nov 20185597 udpinin secure messagingininmessaginglast updated 27 Nov 20185598 tcpMCT Market Data Feedmctfeedlast updated 27 Nov 20185598 udpMCT Market Data Feedmctfeedlast updated 27 Nov 20185599 tcpEnterprise Security Remote Installesinstalllast updated 27 Nov 20185599 udpEnterprise Security Remote Installesinstalllast updated 27 Nov 20185600 tcpEnterprise Security Manageresmmanagerlast updated 27 Nov 20185600 udpEnterprise Security Manageresmmanagerlast updated 27 Nov 20185601 tcpEnterprise Security Agentesmagentlast updated 27 Nov 20185601 udpEnterprise Security Agentesmagentlast updated 27 Nov 20185602 tcpA1-MSCa1-msclast updated 27 Nov 20185602 udpA1-MSCa1-msclast updated 27 Nov 20185603 tcpA1-BSa1-bslast updated 27 Nov 20185603 udpA1-BSa1-bslast updated 27 Nov 20185604 tcpA3-SDUNodea3-sdunodelast updated 27 Nov 20185604 udpA3-SDUNodea3-sdunodelast updated 27 Nov 20185605 tcpA4-SDUNodea4-sdunodelast updated 27 Nov 20185605 udpA4-SDUNodea4-sdunodelast updated 27 Nov 20185606-5617 UnassignedN/Alast updated 27 Nov 20185618 tcpFiscal Registering Protocolefrlast updated 27 Nov 20185618 udpReservedN/Alast updated 27 Nov 20185619-5626 UnassignedN/Alast updated 27 Nov 20185627 tcpNode Initiated Network Association Formaninaflast updated 27 Nov 20185627 udpNode Initiated Network Association Formaninaflast updated 27 Nov 20185628 tcpHTrust APIhtrustlast updated 27 Nov 20185628 udpHTrust APIhtrustlast updated 27 Nov 20185629 tcpSymantec Storage Foundation for Databasesymantec-sfdblast updated 27 Nov 20185629 udpSymantec Storage Foundation for Databasesymantec-sfdblast updated 27 Nov 20185630 tcpPreciseCommunicationprecise-commlast updated 27 Nov 20185630 udpPreciseCommunicationprecise-commlast updated 27 Nov 20185631 tcppcANYWHEREdatapcanywheredatalast updated 27 Nov 20185631 udppcANYWHEREdatapcanywheredatalast updated 27 Nov 20185632 tcppcANYWHEREstatpcanywherestatlast updated 27 Nov 20185632 udppcANYWHEREstatpcanywherestatlast updated 27 Nov 20185633 tcpBE Operations Request Listenerbeorllast updated 27 Nov 20185633 udpBE Operations Request Listenerbeorllast updated 27 Nov 20185634 tcpSF Message Servicexprtldlast updated 27 Nov 20185634 udpSF Message Servicexprtldlast updated 27 Nov 20185635 tcpSFM Authentication Subsystemsfmssolast updated 27 Nov 20185635 udpReservedN/Alast updated 27 Nov 20185636 tcpSFMdb - SFM DB serversfm-db-serverlast updated 27 Nov 20185636 udpReservedN/Alast updated 27 Nov 20185637 tcpSymantec CSSCcssclast updated 27 Nov 20185637 udpReservedN/Alast updated 27 Nov 20185638 tcpSymantec Fingerprint Lookup and Container Reference Serviceflcrslast updated 27 Nov 20185638 udpReservedN/Alast updated 27 Nov 20185639 tcpSymantec Integrity Checking Serviceicslast updated 27 Nov 20185639 udpReservedN/Alast updated 27 Nov 20185640-5645 UnassignedN/Alast updated 27 Nov 20185646 tcpVentureforth Mobilevfmobilelast updated 27 Nov 20185646 udpReservedN/Alast updated 27 Nov 20185647-5665 UnassignedN/Alast updated 27 Nov 20185666 tcpNagios Remote Plugin Executornrpelast updated 27 Nov 20185666 udpReservedN/Alast updated 27 Nov 20185667-5669 UnassignedN/Alast updated 27 Nov 20185670 tcpZeroMQ file publish-subscribe protocolfilemqlast updated 27 Nov 20185670 udpLocal area discovery and messaging over ZeroMQzre-disclast updated 27 Nov 20185671 tcpamqp protocol over TLS/SSLamqpslast updated 27 Nov 20185671 udpamqp protocol over TLS/SSLamqpslast updated 27 Nov 20185672 tcpAMQPamqplast updated 27 Nov 20185672 udpAMQPamqplast updated 27 Nov 20185672 sctpAMQPamqplast updated 27 Nov 20185673 tcpJACL Message Serverjmslast updated 27 Nov 20185673 udpJACL Message Serverjmslast updated 27 Nov 20185674 tcpHyperSCSI Porthyperscsi-portlast updated 27 Nov 20185674 udpHyperSCSI Porthyperscsi-portlast updated 27 Nov 20185675 tcpV5UA application portv5ualast updated 27 Nov 20185675 udpV5UA application portv5ualast updated 27 Nov 20185675 sctpV5UA application portv5ualast updated 27 Nov 20185676 tcpRA Administrationraadminlast updated 27 Nov 20185676 udpRA Administrationraadminlast updated 27 Nov 20185677 tcpQuest Central DB2 Launchrquestdb2-lnchrlast updated 27 Nov 20185677 udpQuest Central DB2 Launchrquestdb2-lnchrlast updated 27 Nov 20185678 tcpRemote Replication Agent Connectionrraclast updated 27 Nov 20185678 udpRemote Replication Agent Connectionrraclast updated 27 Nov 20185679 tcpDirect Cable Connect Managerdccmlast updated 27 Nov 20185679 udpDirect Cable Connect Managerdccmlast updated 27 Nov 20185680 tcpAuriga Router Serviceauriga-routerlast updated 27 Nov 20185680 udpAuriga Router Serviceauriga-routerlast updated 27 Nov 20185681 tcpNet-coneX Control Protocolncxcplast updated 27 Nov 20185681 udpNet-coneX Control Protocolncxcplast updated 27 Nov 20185682 tcpReservedN/Alast updated 27 Nov 20185682 udpBrightCore control & data transfer exchangebrightcorelast updated 27 Nov 20185683 tcpConstrained Application Protocol (CoAP)coaplast updated 27 Nov 20185683 udpConstrained Application Protocolcoaplast updated 27 Nov 20185684 tcpConstrained Application Protocol (CoAP)coapslast updated 27 Nov 20185684 udpDTLS-secured CoAPcoapslast updated 27 Nov 20185685-5686 UnassignedN/Alast updated 27 Nov 20185687 udpGOG multiplayer game protocolgog-multiplayerlast updated 27 Nov 20185687 tcpReservedN/Alast updated 27 Nov 20185688 tcpGGZ Gaming Zoneggzlast updated 27 Nov 20185688 udpGGZ Gaming Zoneggzlast updated 27 Nov 20185689 tcpQM video network management protocolqmvideolast updated 27 Nov 20185689 udpQM video network management protocolqmvideolast updated 27 Nov 20185690-5692 UnassignedN/Alast updated 27 Nov 20185693 tcpRobert Bosch Data Transferrbsystemlast updated 27 Nov 20185693 udpReservedN/Alast updated 27 Nov 20185694-5695 UnassignedN/Alast updated 27 Nov 20185696 tcpKey Management Interoperability Protocolkmiplast updated 27 Nov 20185696 udpReservedN/Alast updated 27 Nov 20185697-5699 UnassignedN/Alast updated 27 Nov 20185700 tcpDell SupportAssist data center managementsupportassistlast updated 27 Nov 20185700 udpReservedN/Alast updated 27 Nov 20185701-5704 UnassignedN/Alast updated 27 Nov 20185705 tcpStorageOS REST APIstorageoslast updated 27 Nov 20185705 udpReservedN/Alast updated 27 Nov 20185706-5712 UnassignedN/Alast updated 27 Nov 20185713 tcpproshare conf audioproshareaudiolast updated 27 Nov 20185713 udpproshare conf audioproshareaudiolast updated 27 Nov 20185714 tcpproshare conf videoprosharevideolast updated 27 Nov 20185714 udpproshare conf videoprosharevideolast updated 27 Nov 20185715 tcpproshare conf dataprosharedatalast updated 27 Nov 20185715 udpproshare conf dataprosharedatalast updated 27 Nov 20185716 tcpproshare conf requestprosharerequestlast updated 27 Nov 20185716 udpproshare conf requestprosharerequestlast updated 27 Nov 20185717 tcpproshare conf notifyprosharenotifylast updated 27 Nov 20185717 udpproshare conf notifyprosharenotifylast updated 27 Nov 20185718 tcpDPM Communication Serverdpmlast updated 27 Nov 20185718 udpDPM Communication Serverdpmlast updated 27 Nov 20185719 tcpDPM Agent Coordinatordpm-agentlast updated 27 Nov 20185719 udpDPM Agent Coordinatordpm-agentlast updated 27 Nov 20185720 tcpMS-Licensingms-licensinglast updated 27 Nov 20185720 udpMS-Licensingms-licensinglast updated 27 Nov 20185721 tcpDesktop Passthru Servicedtptlast updated 27 Nov 20185721 udpDesktop Passthru Servicedtptlast updated 27 Nov 20185722 tcpMicrosoft DFS Replication Servicemsdfsrlast updated 27 Nov 20185722 udpMicrosoft DFS Replication Servicemsdfsrlast updated 27 Nov 20185723 tcpOperations Manager - Health Serviceomhslast updated 27 Nov 20185723 udpOperations Manager - Health Serviceomhslast updated 27 Nov 20185724 tcpOperations Manager - SDK Serviceomsdklast updated 27 Nov 20185724 udpOperations Manager - SDK Serviceomsdklast updated 27 Nov 20185725 tcpMicrosoft Identity Lifecycle Managerms-ilmlast updated 27 Nov 20185725 udpReservedN/Alast updated 27 Nov 20185726 tcpMicrosoft Lifecycle Manager Secure Token Servicems-ilm-stslast updated 27 Nov 20185726 udpReservedN/Alast updated 27 Nov 20185727 tcpASG Event Notification Frameworkasgenflast updated 27 Nov 20185727 udpReservedN/Alast updated 27 Nov 20185728 tcpDist. I/O Comm. Service Data and Controlio-dist-datalast updated 27 Nov 20185728 udpDist. I/O Comm. Service Group Membershipio-dist-grouplast updated 27 Nov 20185729 tcpOpenmail User Agent Layeropenmaillast updated 27 Nov 20185729 udpOpenmail User Agent Layeropenmaillast updated 27 Nov 20185730 tcpSteltor's calendar accessunienglast updated 27 Nov 20185730 udpSteltor's calendar accessunienglast updated 27 Nov 20185731-5740 UnassignedN/Alast updated 27 Nov 20185741 tcpIDA Discover Port 1ida-discover1last updated 27 Nov 20185741 udpIDA Discover Port 1ida-discover1last updated 27 Nov 20185742 tcpIDA Discover Port 2ida-discover2last updated 27 Nov 20185742 udpIDA Discover Port 2ida-discover2last updated 27 Nov 20185743 tcpWatchdoc NetPOD Protocolwatchdoc-podlast updated 27 Nov 20185743 udpWatchdoc NetPOD Protocolwatchdoc-podlast updated 27 Nov 20185744 tcpWatchdoc Serverwatchdoclast updated 27 Nov 20185744 udpWatchdoc Serverwatchdoclast updated 27 Nov 20185745 tcpfcopy-serverfcopy-serverlast updated 27 Nov 20185745 udpfcopy-serverfcopy-serverlast updated 27 Nov 20185746 tcpfcopys-serverfcopys-serverlast updated 27 Nov 20185746 udpfcopys-serverfcopys-serverlast updated 27 Nov 20185747 tcpWildbits Tunatictunaticlast updated 27 Nov 20185747 udpWildbits Tunatictunaticlast updated 27 Nov 20185748 tcpWildbits Tunalyzertunalyzerlast updated 27 Nov 20185748 udpWildbits Tunalyzertunalyzerlast updated 27 Nov 20185749 UnassignedN/Alast updated 27 Nov 20185750 tcpBladelogic Agent Servicerscdlast updated 27 Nov 20185750 udpBladelogic Agent Servicerscdlast updated 27 Nov 20185751-5754 UnassignedN/Alast updated 27 Nov 20185755 tcpOpenMail Desk Gateway serveropenmailglast updated 27 Nov 20185755 udpOpenMail Desk Gateway serveropenmailglast updated 27 Nov 20185756 UnassignedN/Alast updated 27 Nov 20185757 tcpOpenMail X.500 Directory Serverx500mslast updated 27 Nov 20185757 udpOpenMail X.500 Directory Serverx500mslast updated 27 Nov 20185758-5765 UnassignedN/Alast updated 27 Nov 20185766 tcpOpenMail NewMail Serveropenmailnslast updated 27 Nov 20185766 udpOpenMail NewMail Serveropenmailnslast updated 27 Nov 20185767 tcpOpenMail Suer Agent Layer (Secure)s-openmaillast updated 27 Nov 20185767 udpOpenMail Suer Agent Layer (Secure)s-openmaillast updated 27 Nov 20185768 tcpOpenMail CMTS Serveropenmailpxylast updated 27 Nov 20185768 udpOpenMail CMTS Serveropenmailpxylast updated 27 Nov 20185769 tcpx509solutions Internal CAspramscalast updated 27 Nov 20185769 udpx509solutions Internal CAspramscalast updated 27 Nov 20185770 tcpx509solutions Secure Dataspramsdlast updated 27 Nov 20185770 udpx509solutions Secure Dataspramsdlast updated 27 Nov 20185771 tcpNetAgentnetagentlast updated 27 Nov 20185771 udpNetAgentnetagentlast updated 27 Nov 20185772-5776 UnassignedN/Alast updated 27 Nov 20185777 tcpDALI Portdali-portlast updated 27 Nov 20185777 udpDALI Portdali-portlast updated 27 Nov 20185778-5779 UnassignedN/Alast updated 27 Nov 20185780 tcpVisual Tag System RPCvts-rpclast updated 27 Nov 20185780 udpReservedN/Alast updated 27 Nov 20185781 tcp3PAR Event Reporting Service3par-evtslast updated 27 Nov 20185781 udp3PAR Event Reporting Service3par-evtslast updated 27 Nov 20185782 tcp3PAR Management Service3par-mgmtlast updated 27 Nov 20185782 udp3PAR Management Service3par-mgmtlast updated 27 Nov 20185783 tcp3PAR Management Service with SSL3par-mgmt-ssllast updated 27 Nov 20185783 udp3PAR Management Service with SSL3par-mgmt-ssllast updated 27 Nov 20185784 tcpReservedN/Alast updated 27 Nov 20185784 udpCisco Interbox Application Redundancyibarlast updated 27 Nov 20185785 tcp3PAR Inform Remote Copy3par-rcopylast updated 27 Nov 20185785 udp3PAR Inform Remote Copy3par-rcopylast updated 27 Nov 20185786 tcpReservedN/Alast updated 27 Nov 20185786 udpredundancy notificationcisco-redulast updated 27 Nov 20185787 tcpReservedN/Alast updated 27 Nov 20185787 udpCisco WAAS Cluster Protocolwaasclusterlast updated 27 Nov 20185788-5792 UnassignedN/Alast updated 27 Nov 20185793 tcpXtreamX Supervised Peer messagextreamxlast updated 27 Nov 20185793 udpXtreamX Supervised Peer messagextreamxlast updated 27 Nov 20185794 tcpReservedN/Alast updated 27 Nov 20185794 udpSimple Peered Discovery Protocolspdplast updated 27 Nov 20185795-5812 UnassignedN/Alast updated 27 Nov 20185813 tcpICMPDicmpdlast updated 27 Nov 20185813 udpICMPDicmpdlast updated 27 Nov 20185814 tcpSupport Automationspt-automationlast updated 27 Nov 20185814 udpSupport Automationspt-automationlast updated 27 Nov 20185815-5840 UnassignedN/Alast updated 27 Nov 20185841 tcpZ-firm ShipRush interface for web access and bidirectional datashiprush-d-chlast updated 27 Nov 20185841 udpReservedN/Alast updated 27 Nov 20185842 tcpReversion Backup/Restorereversionlast updated 27 Nov 20185842 udpReservedN/Alast updated 27 Nov 20185843-5858 UnassignedN/Alast updated 27 Nov 20185859 tcpWHEREHOOwherehoolast updated 27 Nov 20185859 udpWHEREHOOwherehoolast updated 27 Nov 20185860-5862 UnassignedN/Alast updated 27 Nov 20185863 tcpPlanetPress Suite Messengppsuitemsglast updated 27 Nov 20185863 udpPlanetPress Suite Messengppsuitemsglast updated 27 Nov 20185864-5867 UnassignedN/Alast updated 27 Nov 20185868 tcpDiameter over TLS/TCPdiameterslast updated 27 Nov 20185868 udpReservedN/Alast updated 27 Nov 20185868 sctpDiameter over DTLS/SCTPdiameterslast updated 27 Nov 20185869-5882 UnassignedN/Alast updated 27 Nov 20185883 tcpJavascript Unit Test Environmentjutelast updated 27 Nov 20185884-5899 UnassignedN/Alast updated 27 Nov 20185900 tcpRemote Framebufferrfblast updated 27 Nov 20185900 udpRemote Framebufferrfblast updated 27 Nov 20185901-5909 UnassignedN/Alast updated 27 Nov 20185910 tcpContext Managementcmlast updated 27 Nov 20185910 udpContext Managementcmlast updated 27 Nov 20185910 sctpContext Managementcmlast updated 27 Nov 20185911 tcpController Pilot Data Link Communicationcpdlclast updated 27 Nov 20185911 udpController Pilot Data Link Communicationcpdlclast updated 27 Nov 20185911 sctpController Pilot Data Link Communicationcpdlclast updated 27 Nov 20185912 tcpFlight Information Servicesfislast updated 27 Nov 20185912 udpFlight Information Servicesfislast updated 27 Nov 20185912 sctpFlight Information Servicesfislast updated 27 Nov 20185913 tcpAutomatic Dependent Surveillanceads-clast updated 27 Nov 20185913 udpAutomatic Dependent Surveillanceads-clast updated 27 Nov 20185913 sctpAutomatic Dependent Surveillanceads-clast updated 27 Nov 20185914-5962 UnassignedN/Alast updated 27 Nov 20185963 tcpIndy Application Serverindylast updated 27 Nov 20185963 udpIndy Application Serverindylast updated 27 Nov 20185964-5967 UnassignedN/Alast updated 27 Nov 20185968 tcpmppolicy-v5mppolicy-v5last updated 27 Nov 20185968 udpmppolicy-v5mppolicy-v5last updated 27 Nov 20185969 tcpmppolicy-mgrmppolicy-mgrlast updated 27 Nov 20185969 udpmppolicy-mgrmppolicy-mgrlast updated 27 Nov 20185970-5983 UnassignedN/Alast updated 27 Nov 20185984 tcpCouchDBcouchdblast updated 27 Nov 20185984 udpCouchDBcouchdblast updated 27 Nov 20185985 tcpWBEM WS-Management HTTPwsmanlast updated 27 Nov 20185985 udpWBEM WS-Management HTTPwsmanlast updated 27 Nov 20185986 tcpWBEM WS-Management HTTP over TLS/SSLwsmanslast updated 27 Nov 20185986 udpWBEM WS-Management HTTP over TLS/SSLwsmanslast updated 27 Nov 20185987 tcpWBEM RMIwbem-rmilast updated 27 Nov 20185987 udpWBEM RMIwbem-rmilast updated 27 Nov 20185988 tcpWBEM CIM-XML (HTTP)wbem-httplast updated 27 Nov 20185988 udpWBEM CIM-XML (HTTP)wbem-httplast updated 27 Nov 20185989 tcpWBEM CIM-XML (HTTPS)wbem-httpslast updated 27 Nov 20185989 udpWBEM CIM-XML (HTTPS)wbem-httpslast updated 27 Nov 20185990 tcpWBEM Export HTTPSwbem-exp-httpslast updated 27 Nov 20185990 udpWBEM Export HTTPSwbem-exp-httpslast updated 27 Nov 20185991 tcpNUXSLnuxsllast updated 27 Nov 20185991 udpNUXSLnuxsllast updated 27 Nov 20185992 tcpConsul InSight Securityconsul-insightlast updated 27 Nov 20185992 udpConsul InSight Securityconsul-insightlast updated 27 Nov 20185993 tcpDMTF WBEM CIM RESTcim-rslast updated 27 Nov 20185993 udpReservedN/Alast updated 27 Nov 20185994-5998 UnassignedN/Alast updated 27 Nov 20185999 tcpCVSupcvsuplast updated 27 Nov 20185999 udpCVSupcvsuplast updated 27 Nov 20186000-6063 tcpX Window Systemx11last updated 27 Nov 20186000-6063 udpX Window Systemx11last updated 27 Nov 20186064 tcpNDL-AHP-SVCndl-ahp-svclast updated 27 Nov 20186064 udpNDL-AHP-SVCndl-ahp-svclast updated 27 Nov 20186065 tcpWinPharaohwinpharaohlast updated 27 Nov 20186065 udpWinPharaohwinpharaohlast updated 27 Nov 20186066 tcpEWCTSPewctsplast updated 27 Nov 20186066 udpEWCTSPewctsplast updated 27 Nov 20186067 UnassignedN/Alast updated 27 Nov 20186068 tcpGSMP/ANCPgsmp-ancplast updated 27 Nov 20186068 udpReservedN/Alast updated 27 Nov 20186069 tcpTRIPtriplast updated 27 Nov 20186069 udpTRIPtriplast updated 27 Nov 20186070 tcpMessageasapmessageasaplast updated 27 Nov 20186070 udpMessageasapmessageasaplast updated 27 Nov 20186071 tcpSSDTPssdtplast updated 27 Nov 20186071 udpSSDTPssdtplast updated 27 Nov 20186072 tcpDIAGNOSE-PROCdiagnose-proclast updated 27 Nov 20186072 udpDIAGNOSE-PROCdiagnose-proclast updated 27 Nov 20186073 tcpDirectPlay8directplay8last updated 27 Nov 20186073 udpDirectPlay8directplay8last updated 27 Nov 20186074 tcpMicrosoft Maxmaxlast updated 27 Nov 20186074 udpMicrosoft Maxmaxlast updated 27 Nov 20186075 tcpMicrosoft DPM Access Control Managerdpm-acmlast updated 27 Nov 20186075 udpReservedN/Alast updated 27 Nov 20186076 tcpMicrosoft DPM WCF Certificatesmsft-dpm-certlast updated 27 Nov 20186076 udpReservedN/Alast updated 27 Nov 20186077 tcpiConstruct Servericonstructsrvlast updated 27 Nov 20186077 udpReservedN/Alast updated 27 Nov 20186078-6079 UnassignedN/Alast updated 27 Nov 20186080 udpGeneric UDP Encapsulationguelast updated 27 Nov 20186080 tcpReservedN/Alast updated 27 Nov 20186081 udpGeneric Network Virtualization Encapsulation (Geneve)genevelast updated 27 Nov 20186081 tcpReservedN/Alast updated 27 Nov 20186082 tcpReservedN/Alast updated 27 Nov 20186082 udpAPCO Project 25 Common Air Interface - UDP encapsulationp25cailast updated 27 Nov 20186083 tcpReservedN/Alast updated 27 Nov 20186083 udptelecomsoftware miami broadcastmiami-bcastlast updated 27 Nov 20186084 tcpPeer to Peer Infrastructure Configurationreload-configlast updated 27 Nov 20186084 udpReservedN/Alast updated 27 Nov 20186085 tcpkonspire2b p2p networkkonspire2blast updated 27 Nov 20186085 udpkonspire2b p2p networkkonspire2blast updated 27 Nov 20186086 tcpPDTP P2Ppdtplast updated 27 Nov 20186086 udpPDTP P2Ppdtplast updated 27 Nov 20186087 tcpLocal Download Sharing Serviceldsslast updated 27 Nov 20186087 udpLocal Download Sharing Serviceldsslast updated 27 Nov 20186088 tcpSuperDog License Managerdoglmslast updated 27 Nov 20186088 udpSuperDog License Manager Notifierdoglms-notifylast updated 27 Nov 20186089-6098 UnassignedN/Alast updated 27 Nov 20186099 tcpRAXA Managementraxa-mgmtlast updated 27 Nov 20186099 udpReservedN/Alast updated 27 Nov 20186100 tcpSynchroNet-dbsynchronet-dblast updated 27 Nov 20186100 udpSynchroNet-dbsynchronet-dblast updated 27 Nov 20186101 tcpSynchroNet-rtcsynchronet-rtclast updated 27 Nov 20186101 udpSynchroNet-rtcsynchronet-rtclast updated 27 Nov 20186102 tcpSynchroNet-updsynchronet-updlast updated 27 Nov 20186102 udpSynchroNet-updsynchronet-updlast updated 27 Nov 20186103 tcpRETSretslast updated 27 Nov 20186103 udpRETSretslast updated 27 Nov 20186104 tcpDBDBdbdblast updated 27 Nov 20186104 udpDBDBdbdblast updated 27 Nov 20186105 tcpPrima Serverprimaserverlast updated 27 Nov 20186105 udpPrima Serverprimaserverlast updated 27 Nov 20186106 tcpMPS Servermpsserverlast updated 27 Nov 20186106 udpMPS Servermpsserverlast updated 27 Nov 20186107 tcpETC Controletc-controllast updated 27 Nov 20186107 udpETC Controletc-controllast updated 27 Nov 20186108 tcpSercomm-SCAdminsercomm-scadminlast updated 27 Nov 20186108 udpSercomm-SCAdminsercomm-scadminlast updated 27 Nov 20186109 tcpGLOBECAST-IDglobecast-idlast updated 27 Nov 20186109 udpGLOBECAST-IDglobecast-idlast updated 27 Nov 20186110 tcpHP SoftBench CMsoftcmlast updated 27 Nov 20186110 udpHP SoftBench CMsoftcmlast updated 27 Nov 20186111 tcpHP SoftBench Sub-Process Controlspclast updated 27 Nov 20186111 udpHP SoftBench Sub-Process Controlspclast updated 27 Nov 20186112 tcpDesk-Top Sub-Process Control Daemondtspcdlast updated 27 Nov 20186112 udpDesk-Top Sub-Process Control Daemondtspcdlast updated 27 Nov 20186113 tcpDaylite Serverdayliteserverlast updated 27 Nov 20186113 udpReservedN/Alast updated 27 Nov 20186114 tcpWRspice IPC Servicewrspicelast updated 27 Nov 20186114 udpReservedN/Alast updated 27 Nov 20186115 tcpXic IPC Servicexiclast updated 27 Nov 20186115 udpReservedN/Alast updated 27 Nov 20186116 tcpXicTools License Manager Servicextlservlast updated 27 Nov 20186116 udpReservedN/Alast updated 27 Nov 20186117 tcpDaylite Touch Syncdaylitetouchlast updated 27 Nov 20186117 udpReservedN/Alast updated 27 Nov 20186118 udpTransparent Inter Process Communicationtipclast updated 27 Nov 20186118 tcpReservedN/Alast updated 27 Nov 20186119-6120 UnassignedN/Alast updated 27 Nov 20186121 tcpSPDY for a faster webspdylast updated 27 Nov 20186121 udpReservedN/Alast updated 27 Nov 20186122 tcpBackup Express Web Serverbex-webadminlast updated 27 Nov 20186122 udpBackup Express Web Serverbex-webadminlast updated 27 Nov 20186123 tcpBackup Expressbackup-expresslast updated 27 Nov 20186123 udpBackup Expressbackup-expresslast updated 27 Nov 20186124 tcpPhlexible Network Backup Servicepnbslast updated 27 Nov 20186124 udpPhlexible Network Backup Servicepnbslast updated 27 Nov 20186125-6129 UnassignedN/Alast updated 27 Nov 20186130 tcpThe DameWare Mobile Gateway Servicedamewaremobgtwylast updated 27 Nov 20186130 udpReservedN/Alast updated 27 Nov 20186131-6132 UnassignedN/Alast updated 27 Nov 20186133 tcpNew Boundary Tech WOLnbt-wollast updated 27 Nov 20186133 udpNew Boundary Tech WOLnbt-wollast updated 27 Nov 20186134-6139 UnassignedN/Alast updated 27 Nov 20186140 tcpPulsonix Network License Servicepulsonixnlslast updated 27 Nov 20186140 udpPulsonix Network License Servicepulsonixnlslast updated 27 Nov 20186141 tcpMeta Corporation License Managermeta-corplast updated 27 Nov 20186141 udpMeta Corporation License Managermeta-corplast updated 27 Nov 20186142 tcpAspen Technology License Manageraspentec-lmlast updated 27 Nov 20186142 udpAspen Technology License Manageraspentec-lmlast updated 27 Nov 20186143 tcpWatershed License Managerwatershed-lmlast updated 27 Nov 20186143 udpWatershed License Managerwatershed-lmlast updated 27 Nov 20186144 tcpStatSci License Manager - 1statsci1-lmlast updated 27 Nov 20186144 udpStatSci License Manager - 1statsci1-lmlast updated 27 Nov 20186145 tcpStatSci License Manager - 2statsci2-lmlast updated 27 Nov 20186145 udpStatSci License Manager - 2statsci2-lmlast updated 27 Nov 20186146 tcpLone Wolf Systems License Managerlonewolf-lmlast updated 27 Nov 20186146 udpLone Wolf Systems License Managerlonewolf-lmlast updated 27 Nov 20186147 tcpMontage License Managermontage-lmlast updated 27 Nov 20186147 udpMontage License Managermontage-lmlast updated 27 Nov 20186148 tcpRicardo North America License Managerricardo-lmlast updated 27 Nov 20186148 udpRicardo North America License Managerricardo-lmlast updated 27 Nov 20186149 tcptal-podtal-podlast updated 27 Nov 20186149 udptal-podtal-podlast updated 27 Nov 20186150-6158 UnassignedN/Alast updated 27 Nov 20186159 tcpEFB Application Control Interfaceefb-acilast updated 27 Nov 20186159 udpReservedN/Alast updated 27 Nov 20186160 tcpEmerson Extensible Control and Management Protocolecmplast updated 27 Nov 20186160 udpEmerson Extensible Control and Management Protocol Dataecmp-datalast updated 27 Nov 20186161 tcpPATROL Internet Srv Mgrpatrol-ismlast updated 27 Nov 20186161 udpPATROL Internet Srv Mgrpatrol-ismlast updated 27 Nov 20186162 tcpPATROL Collectorpatrol-colllast updated 27 Nov 20186162 udpPATROL Collectorpatrol-colllast updated 27 Nov 20186163 tcpPrecision Scribe Cnx Portpscribelast updated 27 Nov 20186163 udpPrecision Scribe Cnx Portpscribelast updated 27 Nov 20186164-6199 UnassignedN/Alast updated 27 Nov 20186200 tcpLM-X License Manager by X-Formationlm-xlast updated 27 Nov 20186200 udpLM-X License Manager by X-Formationlm-xlast updated 27 Nov 20186201 tcpReservedN/Alast updated 27 Nov 20186201 udpManagement of service nodes in a processing grid for thermodynamic calculationsthermo-calclast updated 27 Nov 20186202-6208 UnassignedN/Alast updated 27 Nov 20186209 tcpQMTP over TLSqmtpslast updated 27 Nov 20186209 udpQMTP over TLSqmtpslast updated 27 Nov 20186210-6221 UnassignedN/Alast updated 27 Nov 20186222 tcpRadmind Access Protocolradmindlast updated 27 Nov 20186222 udpRadmind Access Protocolradmindlast updated 27 Nov 20186223-6240 UnassignedN/Alast updated 27 Nov 20186241 tcpJEOL Network Services Data Transport Protocol 1jeol-nsdtp-1last updated 27 Nov 20186241 udpJEOL Network Services Dynamic Discovery Protocol 1jeol-nsddp-1last updated 27 Nov 20186242 tcpJEOL Network Services Data Transport Protocol 2jeol-nsdtp-2last updated 27 Nov 20186242 udpJEOL Network Services Dynamic Discovery Protocol 2jeol-nsddp-2last updated 27 Nov 20186243 tcpJEOL Network Services Data Transport Protocol 3jeol-nsdtp-3last updated 27 Nov 20186243 udpJEOL Network Services Dynamic Discovery Protocol 3jeol-nsddp-3last updated 27 Nov 20186244 tcpJEOL Network Services Data Transport Protocol 4jeol-nsdtp-4last updated 27 Nov 20186244 udpJEOL Network Services Dynamic Discovery Protocol 4jeol-nsddp-4last updated 27 Nov 20186245-6250 UnassignedN/Alast updated 27 Nov 20186251 tcpTL1 Raw Over SSL/TLStl1-raw-ssllast updated 27 Nov 20186251 udpTL1 Raw Over SSL/TLStl1-raw-ssllast updated 27 Nov 20186252 tcpTL1 over SSHtl1-sshlast updated 27 Nov 20186252 udpTL1 over SSHtl1-sshlast updated 27 Nov 20186253 tcpCRIPcriplast updated 27 Nov 20186253 udpCRIPcriplast updated 27 Nov 20186254-6266 UnassignedN/Alast updated 27 Nov 20186267 tcpGridLAB-D User Interfacegldlast updated 27 Nov 20186267 udpReservedN/Alast updated 27 Nov 20186268 tcpGrid Authenticationgridlast updated 27 Nov 20186268 udpGrid Authenticationgridlast updated 27 Nov 20186269 tcpGrid Authentication Altgrid-altlast updated 27 Nov 20186269 udpGrid Authentication Altgrid-altlast updated 27 Nov 20186270-6299 UnassignedN/Alast updated 27 Nov 20186300 tcpBMC GRXbmc-grxlast updated 27 Nov 20186300 udpBMC GRXbmc-grxlast updated 27 Nov 20186301 tcpBMC CONTROL-D LDAP SERVER IANA assigned this well-formed service name as a replacement for "bmc_ctd_ldap".bmc-ctd-ldaplast updated 27 Nov 20186301 tcp (bmc_ctd_ldap)BMC CONTROL-D LDAP SERVERbmc_ctd_ldaplast updated 27 Nov 20186301 udpBMC CONTROL-D LDAP SERVER IANA assigned this well-formed service name as a replacement for "bmc_ctd_ldap".bmc-ctd-ldaplast updated 27 Nov 20186301 udp (bmc_ctd_ldap)BMC CONTROL-D LDAP SERVERbmc_ctd_ldaplast updated 27 Nov 20186302-6305 UnassignedN/Alast updated 27 Nov 20186306 tcpUnified Fabric Management Protocolufmplast updated 27 Nov 20186306 udpUnified Fabric Management Protocolufmplast updated 27 Nov 20186307-6314 UnassignedN/Alast updated 27 Nov 20186315 tcpSensor Control Unit Protocolscuplast updated 27 Nov 20186315 udpSensor Control Unit Protocol Discovery Protocolscup-disclast updated 27 Nov 20186316 tcpEthernet Sensor Communications Protocolabb-escplast updated 27 Nov 20186316 udpEthernet Sensor Communications Protocolabb-escplast updated 27 Nov 20186317 tcpNavtech Radar Sensor Data Commandnav-data-cmdlast updated 27 Nov 20186317 udpNavtech Radar Sensor Datanav-datalast updated 27 Nov 20186318-6319 UnassignedN/Alast updated 27 Nov 20186320 tcpDouble-Take Replication Servicerepsvclast updated 27 Nov 20186320 udpDouble-Take Replication Servicerepsvclast updated 27 Nov 20186321 tcpEmpress Software Connectivity Server 1emp-server1last updated 27 Nov 20186321 udpEmpress Software Connectivity Server 1emp-server1last updated 27 Nov 20186322 tcpEmpress Software Connectivity Server 2emp-server2last updated 27 Nov 20186322 udpEmpress Software Connectivity Server 2emp-server2last updated 27 Nov 20186323 UnassignedN/Alast updated 27 Nov 20186324 tcpHR Device Network Configuration Servicehrd-ncslast updated 27 Nov 20186324 udpHR Device Network servicehrd-ns-disclast updated 27 Nov 20186325 tcpDouble-Take Management Servicedt-mgmtsvclast updated 27 Nov 20186325 udpReservedN/Alast updated 27 Nov 20186326 tcpDouble-Take Virtual Recovery Assistantdt-vralast updated 27 Nov 20186326 udpReservedN/Alast updated 27 Nov 20186327-6342 UnassignedN/Alast updated 27 Nov 20186343 tcpsFlow traffic monitoringsflowlast updated 27 Nov 20186343 udpsFlow traffic monitoringsflowlast updated 27 Nov 20186344 tcpArgus-Spectr security and fire-prevention systems servicestreletzlast updated 27 Nov 20186344 udpReservedN/Alast updated 27 Nov 20186345-6345 UnassignedN/Alast updated 27 Nov 20186346 tcpgnutella-svcgnutella-svclast updated 27 Nov 20186346 udpgnutella-svcgnutella-svclast updated 27 Nov 20186347 tcpgnutella-rtrgnutella-rtrlast updated 27 Nov 20186347 udpgnutella-rtrgnutella-rtrlast updated 27 Nov 20186348-6349 UnassignedN/Alast updated 27 Nov 20186350 tcpApp Discovery and Access Protocoladaplast updated 27 Nov 20186350 udpApp Discovery and Access Protocoladaplast updated 27 Nov 20186351-6354 UnassignedN/Alast updated 27 Nov 20186355 tcpPMCS applicationspmcslast updated 27 Nov 20186355 udpPMCS applicationspmcslast updated 27 Nov 20186356-6359 UnassignedN/Alast updated 27 Nov 20186360 tcpMetaEdit+ Multi-Usermetaedit-mulast updated 27 Nov 20186360 udpMetaEdit+ Multi-Usermetaedit-mulast updated 27 Nov 20186361-6362 UnassignedN/Alast updated 27 Nov 20186363 udpNamed Data Networkingndnlast updated 27 Nov 20186363 tcpReservedN/Alast updated 27 Nov 20186364-6369 UnassignedN/Alast updated 27 Nov 20186370 tcpMetaEdit+ Server Administrationmetaedit-selast updated 27 Nov 20186370 udpMetaEdit+ Server Administrationmetaedit-selast updated 27 Nov 20186371-6378 UnassignedN/Alast updated 27 Nov 20186379 tcpAn advanced key-value cache and storeredislast updated 27 Nov 20186379 udpReservedN/Alast updated 27 Nov 20186380-6381 UnassignedN/Alast updated 27 Nov 20186382 tcpMetatude Dialogue Servermetatude-mdslast updated 27 Nov 20186382 udpMetatude Dialogue Servermetatude-mdslast updated 27 Nov 20186383-6388 UnassignedN/Alast updated 27 Nov 20186389 tcpclariion-evr01clariion-evr01last updated 27 Nov 20186389 udpclariion-evr01clariion-evr01last updated 27 Nov 20186390 tcpMetaEdit+ WebService APImetaedit-wslast updated 27 Nov 20186390 udpMetaEdit+ WebService APImetaedit-wslast updated 27 Nov 20186391-6399 UnassignedN/Alast updated 27 Nov 20186400 Business Objects CMS contact portboe-cmslast updated 27 Nov 20186401 boe-wasboe-waslast updated 27 Nov 20186402 boe-eventsrvboe-eventsrvlast updated 27 Nov 20186403 boe-cachesvrboe-cachesvrlast updated 27 Nov 20186404 Business Objects Enterprise internal serverboe-filesvrlast updated 27 Nov 20186405 Business Objects Enterprise internal serverboe-pagesvrlast updated 27 Nov 20186406 Business Objects Enterprise internal serverboe-processsvrlast updated 27 Nov 20186407 Business Objects Enterprise internal serverboe-resssvr1last updated 27 Nov 20186408 Business Objects Enterprise internal serverboe-resssvr2last updated 27 Nov 20186409 Business Objects Enterprise internal serverboe-resssvr3last updated 27 Nov 20186410 Business Objects Enterprise internal serverboe-resssvr4last updated 27 Nov 20186411-6416 UnassignedN/Alast updated 27 Nov 20186417 tcpFaxcom Message Servicefaxcomservicelast updated 27 Nov 20186417 udpFaxcom Message Servicefaxcomservicelast updated 27 Nov 20186418 tcpSYserver remote commandssyserverremotelast updated 27 Nov 20186418 udpReservedN/Alast updated 27 Nov 20186419 tcpSimple VDR Protocolsvdrplast updated 27 Nov 20186419 udpSimple VDR Protocol Discoverysvdrp-disclast updated 27 Nov 20186420 tcpNIM_VDRShellnim-vdrshelllast updated 27 Nov 20186420 udpNIM_VDRShellnim-vdrshelllast updated 27 Nov 20186421 tcpNIM_WANnim-wanlast updated 27 Nov 20186421 udpNIM_WANnim-wanlast updated 27 Nov 20186422-6431 UnassignedN/Alast updated 27 Nov 20186432 tcpPgBouncerpgbouncerlast updated 27 Nov 20186432 udpReservedN/Alast updated 27 Nov 20186433-6441 UnassignedN/Alast updated 27 Nov 20186442 tcpTransitory Application Request Protocoltarplast updated 27 Nov 20186442 udpReservedN/Alast updated 27 Nov 20186443 tcpService Registry Default HTTPS Domainsun-sr-httpslast updated 27 Nov 20186443 udpService Registry Default HTTPS Domainsun-sr-httpslast updated 27 Nov 20186444 tcpGrid Engine Qmaster Service IANA assigned this well-formed service name as a replacement for "sge_qmaster".sge-qmasterlast updated 27 Nov 20186444 tcp (sge_qmaster)Grid Engine Qmaster Servicesge_qmasterlast updated 27 Nov 20186444 udpGrid Engine Qmaster Service IANA assigned this well-formed service name as a replacement for "sge_qmaster".sge-qmasterlast updated 27 Nov 20186444 udp (sge_qmaster)Grid Engine Qmaster Servicesge_qmasterlast updated 27 Nov 20186445 tcpGrid Engine Execution Service IANA assigned this well-formed service name as a replacement for "sge_execd".sge-execdlast updated 27 Nov 20186445 tcp (sge_execd)Grid Engine Execution Servicesge_execdlast updated 27 Nov 20186445 udpGrid Engine Execution Service IANA assigned this well-formed service name as a replacement for "sge_execd".sge-execdlast updated 27 Nov 20186445 udp (sge_execd)Grid Engine Execution Servicesge_execdlast updated 27 Nov 20186446 tcpMySQL Proxymysql-proxylast updated 27 Nov 20186446 udpMySQL Proxymysql-proxylast updated 27 Nov 20186447-6454 UnassignedN/Alast updated 27 Nov 20186455 tcpSKIP Certificate Receiveskip-cert-recvlast updated 27 Nov 20186455 udpSKIP Certificate Receiveskip-cert-recvlast updated 27 Nov 20186456 tcpSKIP Certificate Sendskip-cert-sendlast updated 27 Nov 20186456 udpSKIP Certificate Sendskip-cert-sendlast updated 27 Nov 20186457-6463 UnassignedN/Alast updated 27 Nov 20186464 tcpPort assignment for medical device communication in accordance to IEEE 11073-20701ieee11073-20701last updated 27 Nov 20186464 udpPort assignment for medical device communication in accordance to IEEE 11073-20701ieee11073-20701last updated 27 Nov 20186465-6470 UnassignedN/Alast updated 27 Nov 20186471 tcpLVision License Managerlvision-lmlast updated 27 Nov 20186471 udpLVision License Managerlvision-lmlast updated 27 Nov 20186472-6479 UnassignedN/Alast updated 27 Nov 20186480 tcpService Registry Default HTTP Domainsun-sr-httplast updated 27 Nov 20186480 udpService Registry Default HTTP Domainsun-sr-httplast updated 27 Nov 20186481 tcpService Tagsservicetagslast updated 27 Nov 20186481 udpService Tagsservicetagslast updated 27 Nov 20186482 tcpLogical Domains Management Interfaceldoms-mgmtlast updated 27 Nov 20186482 udpLogical Domains Management Interfaceldoms-mgmtlast updated 27 Nov 20186483 tcpSunVTS RMISunVTS-RMIlast updated 27 Nov 20186483 udpSunVTS RMISunVTS-RMIlast updated 27 Nov 20186484 tcpService Registry Default JMS Domainsun-sr-jmslast updated 27 Nov 20186484 udpService Registry Default JMS Domainsun-sr-jmslast updated 27 Nov 20186485 tcpService Registry Default IIOP Domainsun-sr-iioplast updated 27 Nov 20186485 udpService Registry Default IIOP Domainsun-sr-iioplast updated 27 Nov 20186486 tcpService Registry Default IIOPS Domainsun-sr-iiopslast updated 27 Nov 20186486 udpService Registry Default IIOPS Domainsun-sr-iiopslast updated 27 Nov 20186487 tcpService Registry Default IIOPAuth Domainsun-sr-iiop-autlast updated 27 Nov 20186487 udpService Registry Default IIOPAuth Domainsun-sr-iiop-autlast updated 27 Nov 20186488 tcpService Registry Default JMX Domainsun-sr-jmxlast updated 27 Nov 20186488 udpService Registry Default JMX Domainsun-sr-jmxlast updated 27 Nov 20186489 tcpService Registry Default Admin Domainsun-sr-adminlast updated 27 Nov 20186489 udpService Registry Default Admin Domainsun-sr-adminlast updated 27 Nov 20186490-6499 UnassignedN/Alast updated 27 Nov 20186500 tcpBoKS Masterbokslast updated 27 Nov 20186500 udpBoKS Masterbokslast updated 27 Nov 20186501 tcpBoKS Servc IANA assigned this well-formed service name as a replacement for "boks_servc".boks-servclast updated 27 Nov 20186501 tcp (boks_servc)BoKS Servcboks_servclast updated 27 Nov 20186501 udpBoKS Servc IANA assigned this well-formed service name as a replacement for "boks_servc".boks-servclast updated 27 Nov 20186501 udp (boks_servc)BoKS Servcboks_servclast updated 27 Nov 20186502 tcpBoKS Servm IANA assigned this well-formed service name as a replacement for "boks_servm".boks-servmlast updated 27 Nov 20186502 tcp (boks_servm)BoKS Servmboks_servmlast updated 27 Nov 20186502 udpBoKS Servm IANA assigned this well-formed service name as a replacement for "boks_servm".boks-servmlast updated 27 Nov 20186502 udp (boks_servm)BoKS Servmboks_servmlast updated 27 Nov 20186503 tcpBoKS Clntd IANA assigned this well-formed service name as a replacement for "boks_clntd".boks-clntdlast updated 27 Nov 20186503 tcp (boks_clntd)BoKS Clntdboks_clntdlast updated 27 Nov 20186503 udpBoKS Clntd IANA assigned this well-formed service name as a replacement for "boks_clntd".boks-clntdlast updated 27 Nov 20186503 udp (boks_clntd)BoKS Clntdboks_clntdlast updated 27 Nov 20186504 UnassignedN/Alast updated 27 Nov 20186505 tcpBoKS Admin Private Port IANA assigned this well-formed service name as a replacement for "badm_priv".badm-privlast updated 27 Nov 20186505 tcp (badm_priv)BoKS Admin Private Portbadm_privlast updated 27 Nov 20186505 udpBoKS Admin Private Port IANA assigned this well-formed service name as a replacement for "badm_priv".badm-privlast updated 27 Nov 20186505 udp (badm_priv)BoKS Admin Private Portbadm_privlast updated 27 Nov 20186506 tcpBoKS Admin Public Port IANA assigned this well-formed service name as a replacement for "badm_pub".badm-publast updated 27 Nov 20186506 tcp (badm_pub)BoKS Admin Public Portbadm_publast updated 27 Nov 20186506 udpBoKS Admin Public Port IANA assigned this well-formed service name as a replacement for "badm_pub".badm-publast updated 27 Nov 20186506 udp (badm_pub)BoKS Admin Public Portbadm_publast updated 27 Nov 20186507 tcpBoKS Dir Server, Private Port IANA assigned this well-formed service name as a replacement for "bdir_priv".bdir-privlast updated 27 Nov 20186507 tcp (bdir_priv)BoKS Dir Server, Private Portbdir_privlast updated 27 Nov 20186507 udpBoKS Dir Server, Private Port IANA assigned this well-formed service name as a replacement for "bdir_priv".bdir-privlast updated 27 Nov 20186507 udp (bdir_priv)BoKS Dir Server, Private Portbdir_privlast updated 27 Nov 20186508 tcpBoKS Dir Server, Public Port IANA assigned this well-formed service name as a replacement for "bdir_pub".bdir-publast updated 27 Nov 20186508 tcp (bdir_pub)BoKS Dir Server, Public Portbdir_publast updated 27 Nov 20186508 udpBoKS Dir Server, Public Port IANA assigned this well-formed service name as a replacement for "bdir_pub".bdir-publast updated 27 Nov 20186508 udp (bdir_pub)BoKS Dir Server, Public Portbdir_publast updated 27 Nov 20186509 tcpMGCS-MFP Portmgcs-mfp-portlast updated 27 Nov 20186509 udpMGCS-MFP Portmgcs-mfp-portlast updated 27 Nov 20186510 tcpMCER Portmcer-portlast updated 27 Nov 20186510 udpMCER Portmcer-portlast updated 27 Nov 20186511 tcpReservedN/Alast updated 27 Nov 20186511 udpDatagram Congestion Control Protocol Encapsulation for NAT Traversaldccp-udplast updated 27 Nov 20186512-6512 UnassignedN/Alast updated 27 Nov 20186513 tcpNETCONF over TLSnetconf-tlslast updated 27 Nov 20186513 udpReservedN/Alast updated 27 Nov 20186514 tcpSyslog over TLSsyslog-tlslast updated 27 Nov 20186514 udpsyslog over DTLSsyslog-tlslast updated 27 Nov 20186514 dccpsyslog over DTLSsyslog-tlslast updated 27 Nov 20186515 tcpElipse RPC Protocolelipse-reclast updated 27 Nov 20186515 udpElipse RPC Protocolelipse-reclast updated 27 Nov 20186516-6542 UnassignedN/Alast updated 27 Nov 20186543 tcplds_distriblds-distriblast updated 27 Nov 20186543 udplds_distriblds-distriblast updated 27 Nov 20186544 tcpLDS Dump Servicelds-dumplast updated 27 Nov 20186544 udpLDS Dump Servicelds-dumplast updated 27 Nov 20186545-6546 UnassignedN/Alast updated 27 Nov 20186547 tcpAPC 6547apc-6547last updated 27 Nov 20186547 udpAPC 6547apc-6547last updated 27 Nov 20186548 tcpAPC 6548apc-6548last updated 27 Nov 20186548 udpAPC 6548apc-6548last updated 27 Nov 20186549 tcpAPC 6549apc-6549last updated 27 Nov 20186549 udpAPC 6549apc-6549last updated 27 Nov 20186550 tcpfg-sysupdatefg-sysupdatelast updated 27 Nov 20186550 udpfg-sysupdatefg-sysupdatelast updated 27 Nov 20186551 tcpSoftware Update Managersumlast updated 27 Nov 20186551 udpSoftware Update Managersumlast updated 27 Nov 20186552-6557 UnassignedN/Alast updated 27 Nov 20186558 tcp-xdsxdmlast updated 27 Nov 20186558 udp-xdsxdmlast updated 27 Nov 20186559-6565 UnassignedN/Alast updated 27 Nov 20186566 tcpSANE Control Portsane-portlast updated 27 Nov 20186566 udpSANE Control Portsane-portlast updated 27 Nov 20186567 ReservedN/Alast updated 27 Nov 20186568 tcpCanIt Storage Manager IANA assigned this well-formed service name as a replacement for "canit_store".canit-storelast updated 27 Nov 20186568 tcp (canit_store)CanIt Storage Managercanit_storelast updated 27 Nov 20186568 udpRoaring Penguin IP Address Reputation Collectionrp-reputationlast updated 27 Nov 20186569-6578 UnassignedN/Alast updated 27 Nov 20186579 tcpAffiliateaffiliatelast updated 27 Nov 20186579 udpAffiliateaffiliatelast updated 27 Nov 20186580 tcpParsec Masterserverparsec-masterlast updated 27 Nov 20186580 udpParsec Masterserverparsec-masterlast updated 27 Nov 20186581 tcpParsec Peer-to-Peerparsec-peerlast updated 27 Nov 20186581 udpParsec Peer-to-Peerparsec-peerlast updated 27 Nov 20186582 tcpParsec Gameserverparsec-gamelast updated 27 Nov 20186582 udpParsec Gameserverparsec-gamelast updated 27 Nov 20186583 tcpJOA Jewel SuitejoaJewelSuitelast updated 27 Nov 20186583 udpJOA Jewel SuitejoaJewelSuitelast updated 27 Nov 20186584-6587 UnassignedN/Alast updated 27 Nov 20186588 UnassignedN/Alast updated 27 Nov 20186589-6599 UnassignedN/Alast updated 27 Nov 20186600 tcpMicrosoft Hyper-V Live Migrationmshvlmlast updated 27 Nov 20186600 udpReservedN/Alast updated 27 Nov 20186601 tcpMicrosoft Threat Management Gateway SSTPmstmg-sstplast updated 27 Nov 20186601 udpReservedN/Alast updated 27 Nov 20186602 tcpWindows WSS Communication Frameworkwsscomfrmwklast updated 27 Nov 20186602 udpReservedN/Alast updated 27 Nov 20186603-6618 UnassignedN/Alast updated 27 Nov 20186619 tcpODETTE-FTP over TLS/SSLodette-ftpslast updated 27 Nov 20186619 udpODETTE-FTP over TLS/SSLodette-ftpslast updated 27 Nov 20186620 tcpKerberos V5 FTP Datakftp-datalast updated 27 Nov 20186620 udpKerberos V5 FTP Datakftp-datalast updated 27 Nov 20186621 tcpKerberos V5 FTP Controlkftplast updated 27 Nov 20186621 udpKerberos V5 FTP Controlkftplast updated 27 Nov 20186622 tcpMulticast FTPmcftplast updated 27 Nov 20186622 udpMulticast FTPmcftplast updated 27 Nov 20186623 tcpKerberos V5 Telnetktelnetlast updated 27 Nov 20186623 udpKerberos V5 Telnetktelnetlast updated 27 Nov 20186624 tcpDataScaler databasedatascaler-dblast updated 27 Nov 20186624 udpReservedN/Alast updated 27 Nov 20186625 tcpDataScaler controldatascaler-ctllast updated 27 Nov 20186625 udpReservedN/Alast updated 27 Nov 20186626 tcpWAGO Service and Updatewago-servicelast updated 27 Nov 20186626 udpWAGO Service and Updatewago-servicelast updated 27 Nov 20186627 tcpAllied Electronics NeXGennexgenlast updated 27 Nov 20186627 udpAllied Electronics NeXGennexgenlast updated 27 Nov 20186628 tcpAFE Stock Channel M/Cafesc-mclast updated 27 Nov 20186628 udpAFE Stock Channel M/Cafesc-mclast updated 27 Nov 20186629 tcpSecondary, (non ANDI) multi-protocol multi-function interface to the Allied ANDI-based family of forecourt controllersnexgen-auxlast updated 27 Nov 20186629 udpSecondary, (non ANDI) multi-protocol multi-function interface to the Allied ANDI-based family of forecourt controllersnexgen-auxlast updated 27 Nov 20186630 UnassignedN/Alast updated 27 Nov 20186631 UnassignedN/Alast updated 27 Nov 20186632 tcpeGenix mxODBC Connectmxodbc-connectlast updated 27 Nov 20186632 udpReservedN/Alast updated 27 Nov 20186633 tcpReservedN/Alast updated 27 Nov 20186633 udpCisco vPath Services Overlaycisco-vpath-tunlast updated 27 Nov 20186634 udpMPLS Performance Measurement out-of-band responsempls-pmlast updated 27 Nov 20186634 tcpReservedN/Alast updated 27 Nov 20186635 tcpReservedN/Alast updated 27 Nov 20186635 udpEncapsulate MPLS packets in UDP tunnels.mpls-udplast updated 27 Nov 20186636 tcpReservedN/Alast updated 27 Nov 20186636 udpEncapsulate MPLS packets in UDP tunnels with DTLS.mpls-udp-dtlslast updated 27 Nov 20186637-6639 UnassignedN/Alast updated 27 Nov 20186640 tcpOpen vSwitch Database protocolovsdblast updated 27 Nov 20186640 udpReservedN/Alast updated 27 Nov 20186641-6652 UnassignedN/Alast updated 27 Nov 20186653 tcpOpenFlowopenflowlast updated 27 Nov 20186653 udpOpenFlowopenflowlast updated 27 Nov 20186654 UnassignedN/Alast updated 27 Nov 20186655 tcpPC SOFT - Software factory UI/managerpcs-sf-ui-manlast updated 27 Nov 20186655 udpReservedN/Alast updated 27 Nov 20186656 tcpEmergency Message Control Serviceemgmsglast updated 27 Nov 20186656 udpReservedN/Alast updated 27 Nov 20186657 tcpReservedN/Alast updated 27 Nov 20186657 udpPalCom Discoverypalcom-disclast updated 27 Nov 20186658-6664 UnassignedN/Alast updated 27 Nov 20186665-6669 tcpIRCUirculast updated 27 Nov 20186665-6669 udpReservedN/Alast updated 27 Nov 20186670 tcpVocaltec Global Online Directoryvocaltec-goldlast updated 27 Nov 20186670 udpVocaltec Global Online Directoryvocaltec-goldlast updated 27 Nov 20186671 tcpP4P Portal Servicep4p-portallast updated 27 Nov 20186671 udpP4P Portal Servicep4p-portallast updated 27 Nov 20186672 tcpvision_server IANA assigned this well-formed service name as a replacement for "vision_server".vision-serverlast updated 27 Nov 20186672 tcp (vision_server)vision_servervision_serverlast updated 27 Nov 20186672 udpvision_server IANA assigned this well-formed service name as a replacement for "vision_server".vision-serverlast updated 27 Nov 20186672 udp (vision_server)vision_servervision_serverlast updated 27 Nov 20186673 tcpvision_elmd IANA assigned this well-formed service name as a replacement for "vision_elmd".vision-elmdlast updated 27 Nov 20186673 tcp (vision_elmd)vision_elmdvision_elmdlast updated 27 Nov 20186673 udpvision_elmd IANA assigned this well-formed service name as a replacement for "vision_elmd".vision-elmdlast updated 27 Nov 20186673 udp (vision_elmd)vision_elmdvision_elmdlast updated 27 Nov 20186674-6677 UnassignedN/Alast updated 27 Nov 20186678 tcpViscount Freedom Bridge Protocolvfbplast updated 27 Nov 20186678 udpViscount Freedom Bridge Discoveryvfbp-disclast updated 27 Nov 20186679 tcpOsorno Automationosautlast updated 27 Nov 20186679 udpOsorno Automationosautlast updated 27 Nov 20186680-6686 UnassignedN/Alast updated 27 Nov 20186687 tcpCleverView for cTrace Message Serviceclever-ctracelast updated 27 Nov 20186687 udpReservedN/Alast updated 27 Nov 20186688 tcpCleverView for TCP/IP Message Serviceclever-tcpiplast updated 27 Nov 20186688 udpReservedN/Alast updated 27 Nov 20186689 tcpTofino Security Appliancetsalast updated 27 Nov 20186689 udpTofino Security Appliancetsalast updated 27 Nov 20186690 tcpCLEVERDetect Message Servicecleverdetectlast updated 27 Nov 20186690 udpReservedN/Alast updated 27 Nov 20186691-6695 UnassignedN/Alast updated 27 Nov 20186696 tcpReservedN/Alast updated 27 Nov 20186696 udpBabel Routing Protocolbabellast updated 27 Nov 20186697 tcpInternet Relay Chat via TLS/SSLircs-ulast updated 27 Nov 20186697 udpReservedN/Alast updated 27 Nov 20186698-6699 UnassignedN/Alast updated 27 Nov 20186700 UnassignedN/Alast updated 27 Nov 20186701 tcpKTI/ICAD Nameserverkti-icad-srvrlast updated 27 Nov 20186701 udpKTI/ICAD Nameserverkti-icad-srvrlast updated 27 Nov 20186701 sctpUnassignedN/Alast updated 27 Nov 20186702 tcpe-Design networke-design-netlast updated 27 Nov 20186702 udpe-Design networke-design-netlast updated 27 Nov 20186702 sctpUnassignedN/Alast updated 27 Nov 20186703 tcpe-Design webe-design-weblast updated 27 Nov 20186703 udpe-Design webe-design-weblast updated 27 Nov 20186704 udpReservedN/Alast updated 27 Nov 20186704 tcpReservedN/Alast updated 27 Nov 20186704 sctpForCES HP (High Priority) channelfrc-hplast updated 27 Nov 20186705 udpReservedN/Alast updated 27 Nov 20186705 tcpReservedN/Alast updated 27 Nov 20186705 sctpForCES MP (Medium Priority) channelfrc-mplast updated 27 Nov 20186706 udpReservedN/Alast updated 27 Nov 20186706 tcpReservedN/Alast updated 27 Nov 20186706 sctpForCES LP (Low priority) channelfrc-lplast updated 27 Nov 20186707-6713 UnassignedN/Alast updated 27 Nov 20186714 tcpInternet Backplane Protocolibprotocollast updated 27 Nov 20186714 udpInternet Backplane Protocolibprotocollast updated 27 Nov 20186715 tcpFibotrader Communicationsfibotrader-comlast updated 27 Nov 20186715 udpFibotrader Communicationsfibotrader-comlast updated 27 Nov 20186716 tcpPrincity Agentprincity-agentlast updated 27 Nov 20186716 udpReservedN/Alast updated 27 Nov 20186717-6766 UnassignedN/Alast updated 27 Nov 20186767 tcpBMC PERFORM AGENTbmc-perf-agentlast updated 27 Nov 20186767 udpBMC PERFORM AGENTbmc-perf-agentlast updated 27 Nov 20186768 tcpBMC PERFORM MGRDbmc-perf-mgrdlast updated 27 Nov 20186768 udpBMC PERFORM MGRDbmc-perf-mgrdlast updated 27 Nov 20186769 tcpADInstruments GxP Serveradi-gxp-srvprtlast updated 27 Nov 20186769 udpADInstruments GxP Serveradi-gxp-srvprtlast updated 27 Nov 20186770 tcpPolyServe httpplysrv-httplast updated 27 Nov 20186770 udpPolyServe httpplysrv-httplast updated 27 Nov 20186771 tcpPolyServe httpsplysrv-httpslast updated 27 Nov 20186771 udpPolyServe httpsplysrv-httpslast updated 27 Nov 20186772-6776 UnassignedN/Alast updated 27 Nov 20186777 tcpnetTsunami Trackerntz-trackerlast updated 27 Nov 20186777 udpReservedN/Alast updated 27 Nov 20186778 tcpnetTsunami p2p storage systemntz-p2p-storagelast updated 27 Nov 20186778 udpReservedN/Alast updated 27 Nov 20186779-6783 UnassignedN/Alast updated 27 Nov 20186784 tcpReservedN/Alast updated 27 Nov 20186784 udpBidirectional Forwarding Detection (BFD) on Link Aggregation Group (LAG) Interfacesbfd-laglast updated 27 Nov 20186785 tcpDGPF Individual Exchangedgpf-exchglast updated 27 Nov 20186785 udpDGPF Individual Exchangedgpf-exchglast updated 27 Nov 20186786 tcpSun Java Web Console JMXsmc-jmxlast updated 27 Nov 20186786 udpSun Java Web Console JMXsmc-jmxlast updated 27 Nov 20186787 tcpSun Web Console Adminsmc-adminlast updated 27 Nov 20186787 udpSun Web Console Adminsmc-adminlast updated 27 Nov 20186788 tcpSMC-HTTPsmc-httplast updated 27 Nov 20186788 udpSMC-HTTPsmc-httplast updated 27 Nov 20186789 tcpGSS-API for the Oracle Remote Administration Daemonradglast updated 27 Nov 20186789 udpReservedN/Alast updated 27 Nov 20186790 tcpHNMPhnmplast updated 27 Nov 20186790 udpHNMPhnmplast updated 27 Nov 20186791 tcpHalcyon Network Managerhnmlast updated 27 Nov 20186791 udpHalcyon Network Managerhnmlast updated 27 Nov 20186792-6800 UnassignedN/Alast updated 27 Nov 20186801 tcpACNET Control System Protocolacnetlast updated 27 Nov 20186801 udpACNET Control System Protocolacnetlast updated 27 Nov 20186802-6816 UnassignedN/Alast updated 27 Nov 20186817 tcpPenTBox Secure IM Protocolpentbox-simlast updated 27 Nov 20186817 udpReservedN/Alast updated 27 Nov 20186818-6830 UnassignedN/Alast updated 27 Nov 20186831 tcpambit-lmambit-lmlast updated 27 Nov 20186831 udpambit-lmambit-lmlast updated 27 Nov 20186832-6840 UnassignedN/Alast updated 27 Nov 20186841 tcpNetmo Defaultnetmo-defaultlast updated 27 Nov 20186841 udpNetmo Defaultnetmo-defaultlast updated 27 Nov 20186842 tcpNetmo HTTPnetmo-httplast updated 27 Nov 20186842 udpNetmo HTTPnetmo-httplast updated 27 Nov 20186843-6849 UnassignedN/Alast updated 27 Nov 20186850 tcpICCRUSHMOREiccrushmorelast updated 27 Nov 20186850 udpICCRUSHMOREiccrushmorelast updated 27 Nov 20186851-6867 UnassignedN/Alast updated 27 Nov 20186868 tcpAcctopus Command Channelacctopus-cclast updated 27 Nov 20186868 udpAcctopus Statusacctopus-stlast updated 27 Nov 20186869-6887 UnassignedN/Alast updated 27 Nov 20186888 tcpMUSEmuselast updated 27 Nov 20186888 udpMUSEmuselast updated 27 Nov 20186889 UnassignedN/Alast updated 27 Nov 20186900 tcpR*TIME Viewer Data Interfacertimeviewerlast updated 27 Nov 20186900 udpReservedN/Alast updated 27 Nov 20186901 tcpNovell Jetstream messaging protocoljetstreamlast updated 27 Nov 20186901 udpReservedN/Alast updated 27 Nov 20186902-6934 UnassignedN/Alast updated 27 Nov 20186935 tcpEthoScan Serviceethoscanlast updated 27 Nov 20186935 udpEthoScan Serviceethoscanlast updated 27 Nov 20186936 tcpXenSource Management Servicexsmsvclast updated 27 Nov 20186936 udpXenSource Management Servicexsmsvclast updated 27 Nov 20186937-6945 UnassignedN/Alast updated 27 Nov 20186946 tcpBiometrics Serverbioserverlast updated 27 Nov 20186946 udpBiometrics Serverbioserverlast updated 27 Nov 20186947-6950 UnassignedN/Alast updated 27 Nov 20186951 tcpOTLPotlplast updated 27 Nov 20186951 udpOTLPotlplast updated 27 Nov 20186952-6960 UnassignedN/Alast updated 27 Nov 20186961 tcpJMACT3jmact3last updated 27 Nov 20186961 udpJMACT3jmact3last updated 27 Nov 20186962 tcpjmevt2jmevt2last updated 27 Nov 20186962 udpjmevt2jmevt2last updated 27 Nov 20186963 tcpswismgr1swismgr1last updated 27 Nov 20186963 udpswismgr1swismgr1last updated 27 Nov 20186964 tcpswismgr2swismgr2last updated 27 Nov 20186964 udpswismgr2swismgr2last updated 27 Nov 20186965 tcpswistrapswistraplast updated 27 Nov 20186965 udpswistrapswistraplast updated 27 Nov 20186966 tcpswispolswispollast updated 27 Nov 20186966 udpswispolswispollast updated 27 Nov 20186967-6968 UnassignedN/Alast updated 27 Nov 20186969 tcpacmsodaacmsodalast updated 27 Nov 20186969 udpacmsodaacmsodalast updated 27 Nov 20186970 tcpConductor test coordination protocolconductorlast updated 27 Nov 20186970 udpReservedN/Alast updated 27 Nov 20186970 sctpconductor for multiplexconductor-mpxlast updated 27 Nov 20186971-6996 UnassignedN/Alast updated 27 Nov 20186997 tcpMobility XE ProtocolMobilitySrvlast updated 27 Nov 20186997 udpMobility XE ProtocolMobilitySrvlast updated 27 Nov 20186998 tcpIATP-highPriiatp-highprilast updated 27 Nov 20186998 udpIATP-highPriiatp-highprilast updated 27 Nov 20186999 tcpIATP-normalPriiatp-normalprilast updated 27 Nov 20186999 udpIATP-normalPriiatp-normalprilast updated 27 Nov 20187000 tcpfile server itselfafs3-fileserverlast updated 27 Nov 20187000 udpfile server itselfafs3-fileserverlast updated 27 Nov 20187001 tcpcallbacks to cache managersafs3-callbacklast updated 27 Nov 20187001 udpcallbacks to cache managersafs3-callbacklast updated 27 Nov 20187002 tcpusers & groups databaseafs3-prserverlast updated 27 Nov 20187002 udpusers & groups databaseafs3-prserverlast updated 27 Nov 20187003 tcpvolume location databaseafs3-vlserverlast updated 27 Nov 20187003 udpvolume location databaseafs3-vlserverlast updated 27 Nov 20187004 tcpAFS/Kerberos authentication serviceafs3-kaserverlast updated 27 Nov 20187004 udpAFS/Kerberos authentication serviceafs3-kaserverlast updated 27 Nov 20187005 tcpvolume managment serverafs3-volserlast updated 27 Nov 20187005 udpvolume managment serverafs3-volserlast updated 27 Nov 20187006 tcperror interpretation serviceafs3-errorslast updated 27 Nov 20187006 udperror interpretation serviceafs3-errorslast updated 27 Nov 20187007 tcpbasic overseer processafs3-boslast updated 27 Nov 20187007 udpbasic overseer processafs3-boslast updated 27 Nov 20187008 tcpserver-to-server updaterafs3-updatelast updated 27 Nov 20187008 udpserver-to-server updaterafs3-updatelast updated 27 Nov 20187009 tcpremote cache manager serviceafs3-rmtsyslast updated 27 Nov 20187009 udpremote cache manager serviceafs3-rmtsyslast updated 27 Nov 20187010 tcponlinet uninterruptable power suppliesups-onlinetlast updated 27 Nov 20187010 udponlinet uninterruptable power suppliesups-onlinetlast updated 27 Nov 20187011 tcpTalon Discovery Porttalon-disclast updated 27 Nov 20187011 udpTalon Discovery Porttalon-disclast updated 27 Nov 20187012 tcpTalon Enginetalon-enginelast updated 27 Nov 20187012 udpTalon Enginetalon-enginelast updated 27 Nov 20187013 tcpMicrotalon Discoverymicrotalon-dislast updated 27 Nov 20187013 udpMicrotalon Discoverymicrotalon-dislast updated 27 Nov 20187014 tcpMicrotalon Communicationsmicrotalon-comlast updated 27 Nov 20187014 udpMicrotalon Communicationsmicrotalon-comlast updated 27 Nov 20187015 tcpTalon Webservertalon-webserverlast updated 27 Nov 20187015 udpTalon Webservertalon-webserverlast updated 27 Nov 20187016 tcpSPG Controls Carrierspglast updated 27 Nov 20187016 udpSPG Controls Carrierspglast updated 27 Nov 20187017 tcpGeneRic Autonomic Signaling Protocolgrasplast updated 27 Nov 20187017 udpGeneRic Autonomic Signaling Protocolgrasplast updated 27 Nov 20187018 tcpFISA Servicefisa-svclast updated 27 Nov 20187018 udpReservedN/Alast updated 27 Nov 20187019 tcpdoceri drawing service controldoceri-ctllast updated 27 Nov 20187019 udpdoceri drawing service screen viewdoceri-viewlast updated 27 Nov 20187020 tcpDP Servedpservelast updated 27 Nov 20187020 udpDP Servedpservelast updated 27 Nov 20187021 tcpDP Serve Admindpserveadminlast updated 27 Nov 20187021 udpDP Serve Admindpserveadminlast updated 27 Nov 20187022 tcpCT Discovery Protocolctdplast updated 27 Nov 20187022 udpCT Discovery Protocolctdplast updated 27 Nov 20187023 tcpComtech T2 NMCSct2nmcslast updated 27 Nov 20187023 udpComtech T2 NMCSct2nmcslast updated 27 Nov 20187024 tcpVormetric servicevmsvclast updated 27 Nov 20187024 udpVormetric servicevmsvclast updated 27 Nov 20187025 tcpVormetric Service IIvmsvc-2last updated 27 Nov 20187025 udpVormetric Service IIvmsvc-2last updated 27 Nov 20187026 tcpLoreji Webhosting Panelloreji-panellast updated 27 Nov 20187026 udpReservedN/Alast updated 27 Nov 20187027-7029 UnassignedN/Alast updated 27 Nov 20187030 tcpObjectPlanet probeop-probelast updated 27 Nov 20187030 udpObjectPlanet probeop-probelast updated 27 Nov 20187031 tcpIPOSPLANET retailing multi devices protocoliposplanetlast updated 27 Nov 20187031 udpReservedN/Alast updated 27 Nov 20187032-7039 UnassignedN/Alast updated 27 Nov 20187040 tcpReservedN/Alast updated 27 Nov 20187040 udpQuest application level network service discoveryquest-disclast updated 27 Nov 20187041-7069 UnassignedN/Alast updated 27 Nov 20187070 tcpARCParcplast updated 27 Nov 20187070 udpARCParcplast updated 27 Nov 20187071 tcpIWGADTS Aircraft Housekeeping Messageiwg1last updated 27 Nov 20187071 udpIWGADTS Aircraft Housekeeping Messageiwg1last updated 27 Nov 20187072 tcpiba Device Configuration Protocoliba-cfglast updated 27 Nov 20187072 udpiba Device Configuration Protocoliba-cfg-disclast updated 27 Nov 20187073 tcpMarTalk protocolmartalklast updated 27 Nov 20187073 udpReservedN/Alast updated 27 Nov 20187074-7079 UnassignedN/Alast updated 27 Nov 20187080 tcpEmpowerID Communicationempoweridlast updated 27 Nov 20187080 udpEmpowerID Communicationempoweridlast updated 27 Nov 20187081-7087 UnassignedN/Alast updated 27 Nov 20187088 tcpReservedN/Alast updated 27 Nov 20187088 udpZixi live video transport protocolzixi-transportlast updated 27 Nov 20187089-7094 UnassignedN/Alast updated 27 Nov 20187095 udpJava Discovery Protocoljdp-disclast updated 27 Nov 20187095 tcpReservedN/Alast updated 27 Nov 20187096-7098 UnassignedN/Alast updated 27 Nov 20187099 tcplazy-ptoplazy-ptoplast updated 27 Nov 20187099 udplazy-ptoplazy-ptoplast updated 27 Nov 20187100 tcpX Font Servicefont-servicelast updated 27 Nov 20187100 udpX Font Servicefont-servicelast updated 27 Nov 20187101 tcpEmbedded Light Control Networkelcnlast updated 27 Nov 20187101 udpEmbedded Light Control Networkelcnlast updated 27 Nov 20187102-7106 UnassignedN/Alast updated 27 Nov 20187107 tcpReservedN/Alast updated 27 Nov 20187107 udpAES-X170aes-x170last updated 27 Nov 20187108-7116 UnassignedN/Alast updated 27 Nov 20187117 tcpEncrypted chat and file transfer servicerothagalast updated 27 Nov 20187117 udpReservedN/Alast updated 27 Nov 20187118-7120 UnassignedN/Alast updated 27 Nov 20187121 tcpVirtual Prototypes License Managervirprot-lmlast updated 27 Nov 20187121 udpVirtual Prototypes License Managervirprot-lmlast updated 27 Nov 20187122-7127 UnassignedN/Alast updated 27 Nov 20187128 tcpintelligent data managerscenidmlast updated 27 Nov 20187128 udpintelligent data managerscenidmlast updated 27 Nov 20187129 tcpCatalog Content Searchscenccslast updated 27 Nov 20187129 udpCatalog Content Searchscenccslast updated 27 Nov 20187130-7160 UnassignedN/Alast updated 27 Nov 20187161 tcpCA BSM Commcabsm-commlast updated 27 Nov 20187161 udpCA BSM Commcabsm-commlast updated 27 Nov 20187162 tcpCA Storage Managercaistoragemgrlast updated 27 Nov 20187162 udpCA Storage Managercaistoragemgrlast updated 27 Nov 20187163 tcpCA Connection Brokercacsambrokerlast updated 27 Nov 20187163 udpCA Connection Brokercacsambrokerlast updated 27 Nov 20187164 tcpFile System Repository Agentfsrlast updated 27 Nov 20187164 udpFile System Repository Agentfsrlast updated 27 Nov 20187165 tcpDocument WCF Serverdoc-serverlast updated 27 Nov 20187165 udpDocument WCF Serverdoc-serverlast updated 27 Nov 20187166 tcpAruba eDiscovery Serveraruba-serverlast updated 27 Nov 20187166 udpAruba eDiscovery Serveraruba-serverlast updated 27 Nov 20187167 tcpCA SRM Agentcasrmagentlast updated 27 Nov 20187167 udpReservedN/Alast updated 27 Nov 20187168 tcpcncKadServer DB & Inventory Servicescnckadserverlast updated 27 Nov 20187168 udpReservedN/Alast updated 27 Nov 20187169 tcpConsequor Consulting Process Integration Bridgeccag-piblast updated 27 Nov 20187169 udpConsequor Consulting Process Integration Bridgeccag-piblast updated 27 Nov 20187170 tcpAdaptive Name/Service Resolutionnsrplast updated 27 Nov 20187170 udpAdaptive Name/Service Resolutionnsrplast updated 27 Nov 20187171 tcpDiscovery and Retention Mgt Productiondrm-productionlast updated 27 Nov 20187171 udpDiscovery and Retention Mgt Productiondrm-productionlast updated 27 Nov 20187172 tcpPort used for MetalBend programmable interfacemetalbendlast updated 27 Nov 20187172 udpReservedN/Alast updated 27 Nov 20187173 tcpzSecure Serverzsecurelast updated 27 Nov 20187173 udpReservedN/Alast updated 27 Nov 20187174 tcpClutildclutildlast updated 27 Nov 20187174 udpClutildclutildlast updated 27 Nov 20187175-7180 UnassignedN/Alast updated 27 Nov 20187181 udpJanus Guidewire Enterprise Discovery Service Busjanus-disclast updated 27 Nov 20187181 tcpReservedN/Alast updated 27 Nov 20187182-7199 UnassignedN/Alast updated 27 Nov 20187200 tcpFODMS FLIPfodmslast updated 27 Nov 20187200 udpFODMS FLIPfodmslast updated 27 Nov 20187201 tcpDLIPdliplast updated 27 Nov 20187201 udpDLIPdliplast updated 27 Nov 20187202 tcpInter-Channel Termination Protocol (ICTP) for multi-wavelength PON (Passive Optical Network) systemspon-ictplast updated 27 Nov 20187702 udpReservedN/Alast updated 27 Nov 20187203-7214 UnassignedN/Alast updated 27 Nov 20187215 tcpCommunication ports for PaperStream Server servicesPS-Serverlast updated 27 Nov 20187215 udpReservedN/Alast updated 27 Nov 20187216 tcpPaperStream Capture ProfessionalPS-Capture-Prolast updated 27 Nov 20187216 udpReservedN/Alast updated 27 Nov 20187217-7226 UnassignedN/Alast updated 27 Nov 20187227 tcpRegistry A & M Protocolramplast updated 27 Nov 20187227 udpRegistry A $ M Protocolramplast updated 27 Nov 20187228 tcpCitrix Universal Printing Portcitrixupplast updated 27 Nov 20187228 udpReservedN/Alast updated 27 Nov 20187229 tcpCitrix UPP Gatewaycitrixuppglast updated 27 Nov 20187229 udpReservedN/Alast updated 27 Nov 20187230-7234 UnassignedN/Alast updated 27 Nov 20187235 udpASP Coordination Protocolaspcoordinationlast updated 27 Nov 20187235 tcpReservedN/Alast updated 27 Nov 20187236 tcpWi-Fi Alliance Wi-Fi Display Protocoldisplaylast updated 27 Nov 20187236 udpReservedN/Alast updated 27 Nov 20187237 tcpPADS (Public Area Display System) Serverpadslast updated 27 Nov 20187237 udpReservedN/Alast updated 27 Nov 20187238-7243 UnassignedN/Alast updated 27 Nov 20187244 tcpFrontRow Calypso Human Interface Control Protocolfrc-hicplast updated 27 Nov 20187244 udpFrontRow Calypso Human Interface Control Protocolfrc-hicp-disclast updated 27 Nov 20187245-7261 UnassignedN/Alast updated 27 Nov 20187262 tcpCalypso Network Access Protocolcnaplast updated 27 Nov 20187262 udpCalypso Network Access Protocolcnaplast updated 27 Nov 20187263-7271 UnassignedN/Alast updated 27 Nov 20187272 tcpWatchMe Monitoring 7272watchme-7272last updated 27 Nov 20187272 udpWatchMe Monitoring 7272watchme-7272last updated 27 Nov 20187273 tcpOMA Roaming Locationoma-rlplast updated 27 Nov 20187273 udpOMA Roaming Locationoma-rlplast updated 27 Nov 20187274 tcpOMA Roaming Location SEComa-rlp-slast updated 27 Nov 20187274 udpOMA Roaming Location SEComa-rlp-slast updated 27 Nov 20187275 tcpOMA UserPlane Locationoma-ulplast updated 27 Nov 20187275 udpOMA UserPlane Locationoma-ulplast updated 27 Nov 20187276 tcpOMA Internal Location Protocoloma-ilplast updated 27 Nov 20187276 udpOMA Internal Location Protocoloma-ilplast updated 27 Nov 20187277 tcpOMA Internal Location Secure Protocoloma-ilp-slast updated 27 Nov 20187277 udpOMA Internal Location Secure Protocoloma-ilp-slast updated 27 Nov 20187278 tcpOMA Dynamic Content Delivery over CBSoma-dcdocbslast updated 27 Nov 20187278 udpOMA Dynamic Content Delivery over CBSoma-dcdocbslast updated 27 Nov 20187279 tcpCitrix Licensingctxliclast updated 27 Nov 20187279 udpCitrix Licensingctxliclast updated 27 Nov 20187280 tcpITACTIONSERVER 1itactionserver1last updated 27 Nov 20187280 udpITACTIONSERVER 1itactionserver1last updated 27 Nov 20187281 tcpITACTIONSERVER 2itactionserver2last updated 27 Nov 20187281 udpITACTIONSERVER 2itactionserver2last updated 27 Nov 20187282 tcpeventACTION/ussACTION (MZCA) servermzca-actionlast updated 27 Nov 20187282 udpeventACTION/ussACTION (MZCA) alertmzca-alertlast updated 27 Nov 20187283 tcpGeneral Statistics Rendezvous Protocolgenstatlast updated 27 Nov 20187283 udpReservedN/Alast updated 27 Nov 20187284-7299 UnassignedN/Alast updated 27 Nov 20187300-7359 The Swiss Exchangeswxlast updated 27 Nov 20187360-7364 UnassignedN/Alast updated 27 Nov 20187365 tcpLifeKeeper Communicationslcm-serverlast updated 27 Nov 20187365 udpLifeKeeper Communicationslcm-serverlast updated 27 Nov 20187366-7390 UnassignedN/Alast updated 27 Nov 20187391 tcpmind-file system servermindfilesyslast updated 27 Nov 20187391 udpmind-file system servermindfilesyslast updated 27 Nov 20187392 tcpmrss-rendezvous servermrssrendezvouslast updated 27 Nov 20187392 udpmrss-rendezvous servermrssrendezvouslast updated 27 Nov 20187393 tcpnFoldMan Remote Publishnfoldmanlast updated 27 Nov 20187393 udpnFoldMan Remote Publishnfoldmanlast updated 27 Nov 20187394 tcpFile system export of backup imagesfselast updated 27 Nov 20187394 udpFile system export of backup imagesfselast updated 27 Nov 20187395 tcpwinqeditwinqeditlast updated 27 Nov 20187395 udpwinqeditwinqeditlast updated 27 Nov 20187396 UnassignedN/Alast updated 27 Nov 20187397 tcpHexarc Command Languagehexarclast updated 27 Nov 20187397 udpHexarc Command Languagehexarclast updated 27 Nov 20187398-7399 UnassignedN/Alast updated 27 Nov 20187400 tcpRTPS Discoveryrtps-discoverylast updated 27 Nov 20187400 udpRTPS Discoveryrtps-discoverylast updated 27 Nov 20187401 tcpRTPS Data-Distribution User-Trafficrtps-dd-utlast updated 27 Nov 20187401 udpRTPS Data-Distribution User-Trafficrtps-dd-utlast updated 27 Nov 20187402 tcpRTPS Data-Distribution Meta-Trafficrtps-dd-mtlast updated 27 Nov 20187402 udpRTPS Data-Distribution Meta-Trafficrtps-dd-mtlast updated 27 Nov 20187403-7409 UnassignedN/Alast updated 27 Nov 20187410 tcpIonix Network Monitorionixnetmonlast updated 27 Nov 20187410 udpIonix Network Monitorionixnetmonlast updated 27 Nov 20187411 tcpStreaming of measurement datadaqstreamlast updated 27 Nov 20187411 udpStreaming of measurement datadaqstreamlast updated 27 Nov 20187412-7419 UnassignedN/Alast updated 27 Nov 20187420 tcpReservedN/Alast updated 27 Nov 20187420 udpMultichannel real-time lighting controlipluminarylast updated 27 Nov 20187421 tcpMatisse Port Monitormtportmonlast updated 27 Nov 20187421 udpMatisse Port Monitormtportmonlast updated 27 Nov 20187422-7425 UnassignedN/Alast updated 27 Nov 20187426 tcpOpenView DM Postmaster Managerpmdmgrlast updated 27 Nov 20187426 udpOpenView DM Postmaster Managerpmdmgrlast updated 27 Nov 20187427 tcpOpenView DM Event Agent Manageroveadmgrlast updated 27 Nov 20187427 udpOpenView DM Event Agent Manageroveadmgrlast updated 27 Nov 20187428 tcpOpenView DM Log Agent Managerovladmgrlast updated 27 Nov 20187428 udpOpenView DM Log Agent Managerovladmgrlast updated 27 Nov 20187429 tcpOpenView DM rqt communicationopi-socklast updated 27 Nov 20187429 udpOpenView DM rqt communicationopi-socklast updated 27 Nov 20187430 tcpOpenView DM xmpv7 api pipexmpv7last updated 27 Nov 20187430 udpOpenView DM xmpv7 api pipexmpv7last updated 27 Nov 20187431 tcpOpenView DM ovc/xmpv3 api pipepmdlast updated 27 Nov 20187431 udpOpenView DM ovc/xmpv3 api pipepmdlast updated 27 Nov 20187432-7436 UnassignedN/Alast updated 27 Nov 20187437 tcpFaximumfaximumlast updated 27 Nov 20187437 udpFaximumfaximumlast updated 27 Nov 20187438-7442 UnassignedN/Alast updated 27 Nov 20187443 tcpOracle Application Server HTTPSoracleas-httpslast updated 27 Nov 20187443 udpOracle Application Server HTTPSoracleas-httpslast updated 27 Nov 20187444-7470 UnassignedN/Alast updated 27 Nov 20187471 tcpStateless Transport Tunneling Protocolsttunnellast updated 27 Nov 20187471 udpReservedN/Alast updated 27 Nov 20187472 UnassignedN/Alast updated 27 Nov 20187473 tcpRise: The Vieneo Provinceriselast updated 27 Nov 20187473 udpRise: The Vieneo Provinceriselast updated 27 Nov 20187474 tcpNeo4j Graph Databaseneo4jlast updated 27 Nov 20187474 udpReservedN/Alast updated 27 Nov 20187475-7477 UnassignedN/Alast updated 27 Nov 20187478 tcpIT Asset Managementopenitlast updated 27 Nov 20187478 udpReservedN/Alast updated 27 Nov 20187479-7490 UnassignedN/Alast updated 27 Nov 20187491 tcptelops-lmdtelops-lmdlast updated 27 Nov 20187491 udptelops-lmdtelops-lmdlast updated 27 Nov 20187492-7499 UnassignedN/Alast updated 27 Nov 20187500 tcpSilhouette Usersilhouettelast updated 27 Nov 20187500 udpSilhouette Usersilhouettelast updated 27 Nov 20187501 tcpHP OpenView Bus Daemonovbuslast updated 27 Nov 20187501 udpHP OpenView Bus Daemonovbuslast updated 27 Nov 20187502-7507 UnassignedN/Alast updated 27 Nov 20187508 tcpAutomation Device Configuration Protocoladcplast updated 27 Nov 20187508 udpReservedN/Alast updated 27 Nov 20187509 tcpACPLT - process automation serviceacpltlast updated 27 Nov 20187509 udpReservedN/Alast updated 27 Nov 20187510 tcpHP OpenView Application Serverovhpaslast updated 27 Nov 20187510 udpHP OpenView Application Serverovhpaslast updated 27 Nov 20187511 tcppafec-lmpafec-lmlast updated 27 Nov 20187511 udppafec-lmpafec-lmlast updated 27 Nov 20187512-7541 UnassignedN/Alast updated 27 Nov 20187542 tcpSaratoga Transfer Protocolsaratogalast updated 27 Nov 20187542 udpSaratoga Transfer Protocolsaratogalast updated 27 Nov 20187543 tcpatul serveratullast updated 27 Nov 20187543 udpatul serveratullast updated 27 Nov 20187544 tcpFlowAnalyzer DisplayServernta-dslast updated 27 Nov 20187544 udpFlowAnalyzer DisplayServernta-dslast updated 27 Nov 20187545 tcpFlowAnalyzer UtilityServernta-uslast updated 27 Nov 20187545 udpFlowAnalyzer UtilityServernta-uslast updated 27 Nov 20187546 tcpCisco Fabric servicecfslast updated 27 Nov 20187546 udpCisco Fabric servicecfslast updated 27 Nov 20187547 tcpDSL Forum CWMPcwmplast updated 27 Nov 20187547 udpDSL Forum CWMPcwmplast updated 27 Nov 20187548 tcpThreat Information Distribution Protocoltidplast updated 27 Nov 20187548 udpThreat Information Distribution Protocoltidplast updated 27 Nov 20187549 tcpNetwork Layer Signaling Transport Layernls-tllast updated 27 Nov 20187549 udpNetwork Layer Signaling Transport Layernls-tllast updated 27 Nov 20187550 tcpReservedN/Alast updated 27 Nov 20187550 udpCloud Signaling Servicecloudsignalinglast updated 27 Nov 20187551 tcpControlONE Console signalingcontrolone-conlast updated 27 Nov 20187551 udpReservedN/Alast updated 27 Nov 20187552-7559 UnassignedN/Alast updated 27 Nov 20187560 tcpSniffer Command Protocolsncplast updated 27 Nov 20187560 udpSniffer Command Protocolsncplast updated 27 Nov 20187561-7562 UnassignedN/Alast updated 27 Nov 20187563 tcpControl Frameworkcfwlast updated 27 Nov 20187563 udpReservedN/Alast updated 27 Nov 20187564-7565 UnassignedN/Alast updated 27 Nov 20187566 tcpVSI Omegavsi-omegalast updated 27 Nov 20187566 udpVSI Omegavsi-omegalast updated 27 Nov 20187567-7568 UnassignedN/Alast updated 27 Nov 20187569 tcpDell EqualLogic Host Group Managementdell-eql-asmlast updated 27 Nov 20187569 udpReservedN/Alast updated 27 Nov 20187570 tcpAries Kfinderaries-kfinderlast updated 27 Nov 20187570 udpAries Kfinderaries-kfinderlast updated 27 Nov 20187571-7573 UnassignedN/Alast updated 27 Nov 20187574 tcpOracle Coherence Cluster Servicecoherencelast updated 27 Nov 20187574 udpOracle Coherence Cluster discovery servicecoherence-disclast updated 27 Nov 20187575-7587 UnassignedN/Alast updated 27 Nov 20187588 tcpSun License Managersun-lmlast updated 27 Nov 20187588 udpSun License Managersun-lmlast updated 27 Nov 20187589-7605 UnassignedN/Alast updated 27 Nov 20187606 tcpMIPI Alliance Debugmipi-debuglast updated 27 Nov 20187606 udpMIPI Alliance Debugmipi-debuglast updated 27 Nov 20187607-7623 UnassignedN/Alast updated 27 Nov 20187624 tcpInstrument Neutral Distributed Interfaceindilast updated 27 Nov 20187624 udpInstrument Neutral Distributed Interfaceindilast updated 27 Nov 20187625 UnassignedN/Alast updated 27 Nov 20187626 tcpSImple Middlebox COnfiguration (SIMCO) Serversimcolast updated 27 Nov 20187626 udpDe-registeredN/Alast updated 27 Nov 20187626 sctpSImple Middlebox COnfiguration (SIMCO)simcolast updated 27 Nov 20187627 tcpSOAP Service Portsoap-httplast updated 27 Nov 20187627 udpSOAP Service Portsoap-httplast updated 27 Nov 20187628 tcpPrimary Agent Work Notificationzen-pawnlast updated 27 Nov 20187628 udpPrimary Agent Work Notificationzen-pawnlast updated 27 Nov 20187629 tcpOpenXDAS Wire Protocolxdaslast updated 27 Nov 20187629 udpOpenXDAS Wire Protocolxdaslast updated 27 Nov 20187630 tcpHA Web Konsolehawklast updated 27 Nov 20187630 udpReservedN/Alast updated 27 Nov 20187631 tcpTESLA System Messagingtesla-sys-msglast updated 27 Nov 20187631 udpReservedN/Alast updated 27 Nov 20187632 UnassignedN/Alast updated 27 Nov 20187633 tcpPMDF Managementpmdfmgtlast updated 27 Nov 20187633 udpPMDF Managementpmdfmgtlast updated 27 Nov 20187634-7647 UnassignedN/Alast updated 27 Nov 20187648 tcpbonjour-cuseemecuseemelast updated 27 Nov 20187648 udpbonjour-cuseemecuseemelast updated 27 Nov 20187649-7662 UnassignedN/Alast updated 27 Nov 20187663 tcpProprietary immutable distributed data storageromelast updated 27 Nov 20187663 udpProprietary immutable distributed data storageromelast updated 27 Nov 20187664-7671 UnassignedN/Alast updated 27 Nov 20187672 tcpiMQ STOMP Serverimqstomplast updated 27 Nov 20187672 udpReservedN/Alast updated 27 Nov 20187673 tcpiMQ STOMP Server over SSLimqstompslast updated 27 Nov 20187673 udpReservedN/Alast updated 27 Nov 20187674 tcpiMQ SSL tunnelimqtunnelslast updated 27 Nov 20187674 udpiMQ SSL tunnelimqtunnelslast updated 27 Nov 20187675 tcpiMQ Tunnelimqtunnellast updated 27 Nov 20187675 udpiMQ Tunnelimqtunnellast updated 27 Nov 20187676 tcpiMQ Broker Rendezvousimqbrokerdlast updated 27 Nov 20187676 udpiMQ Broker Rendezvousimqbrokerdlast updated 27 Nov 20187677 tcpSun App Server - HTTPSsun-user-httpslast updated 27 Nov 20187677 udpSun App Server - HTTPSsun-user-httpslast updated 27 Nov 20187678-7679 UnassignedN/Alast updated 27 Nov 20187680 tcpPando Media Public Distributionpando-publast updated 27 Nov 20187680 udpPando Media Public Distributionpando-publast updated 27 Nov 20187681-7682 UnassignedN/Alast updated 27 Nov 20187683 tcpCleondris DMTdmtlast updated 27 Nov 20187683 udpReservedN/Alast updated 27 Nov 20187684-7686 UnassignedN/Alast updated 27 Nov 20187687 tcpBolt database connectionboltlast updated 27 Nov 20187687 udpReservedN/Alast updated 27 Nov 20187688 UnassignedN/Alast updated 27 Nov 20187689 tcpCollaber Network Servicecollaberlast updated 27 Nov 20187689 udpCollaber Network Servicecollaberlast updated 27 Nov 20187690-7696 UnassignedN/Alast updated 27 Nov 20187697 tcpKLIO communicationskliolast updated 27 Nov 20187697 udpKLIO communicationskliolast updated 27 Nov 20187698-7699 UnassignedN/Alast updated 27 Nov 20187700 tcpEM7 Secure Communicationsem7-secomlast